3VSFA

Crystal structure of 1,3gal43a, an exo-beta-1,3-galactanase from clostridium thermocellum
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 131
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vsfA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vsfA01
1AFCA 4QKRA 3C7OA 3A07A 2ZR1B 5B6TA 5C0PA 1TOOA 1PC8B 3PG0A 1TWEA 1S0FA 3MALA 1DJSB 3BTAA 4PC4A 1MC9A 3D60A 5A7VB 4IZEA 1AVAC 3UGGA 5D63A 1IOBA 41BIA 5BXSA 1FWUA 4KMIA 4GOYA 4ZOTA 5F90A 1AVWB 4H04A 3AKIA 1T4QA 1I1EA 3BAOA 1Y4WA 1HCEA 2YFSA 3UDAA 4XFUA 2VXRA 5FIXA 3BA7A 3OJMA 4ISRA 3LDKA 3FJAA 3FJBA 3FJCA 4UDIA 1QQKA 3IAGC 1HKNA 3AH1A 3RMXA 3R4SA 4KEIA 3LF7A 3CRHA 1M2TB 2QN4A 4G9MA 1W3FA 3OJ2A 4QO3A 4JRAA 3WAUA 3H6RB 3N7JA 3N7KA 2HW9A 4I8MA 5GLNA 2D23A 2D7RA 4D0TA 1K5UA 2R9KB 2NM1A 4IZXA 3AKHA 1BFCA 3ZXJA 3FJJA 3ZXDA 4XKIA 1WBAA 3V0BA 1OYGA 2K8RA 1PZZA 3C9ZA 1ISWA 2QYIB 4G6JA 4I4UA 1W18A 5JOZA 3BAVA 2ET2A 2HWMA 2BEAA 1FWVA 3WO4A 5DSSB 3WN2A 1DZCA 3CA3A 3O5WB 4KC3A 5BOWA 1IRPA 1HIBA 4DEPA 4U6DA 3BADA 4LO3A 2KLLA 4N2ZA 1S0LA 2D20A 3O4AA 4GAIA 1BLAA 4FFGA 3VT0A 1BFFA 1ISZA 4KC8A 1JT5A 3QEDA 2AXMA 4Z9WB 2VDTA 1JT4A 3WN1A 3CU1B 1BA7A 1MD6A 2WBCA 1WD3A 3VSSA 5B2HA 2AEYA 3ZX7A 3FUOA 2DREA 3ZC9A 3W9TA 4QBVA 1W2TA 4Q91A 4IY9A 3EF2A 3P53A 1JT3A 3BX1C 3BRFA 1HWOB 2VSAA 2WRYA 4EKXB 3JUTA 5BXTA 3H6SE 3N7LA 3RTJB 3BYKA 4L4IA 2Z48A 4O8NA 3PMEA 3CA4A 4KC7A 4L4HA 4I4PA 3S8KA 3OGGA 3NBCA 4LO3C 3OGFA 4LO0A 4OEEA 4D8HA 4UDJA 5FK8A 3ZXKA 4JQ0A 1UPSA 4I0YA 2UUSA 4AK5A 4F83A 2P23A 4UDKA 2HZ9A 1GYDB 2BEBA 2Z49A 1II4A 1RMLA 5JOXA 3QEFA 1ONKB 3S8JA 2QQUA 4I3NA 4QKSA 3P2NA 3BAQA 31BIA 1Y9GA 5EHAA 1E0OA 2X8FA 3BYNA 4FFFA 3HOMA 1IRAX 2MC2A 5GLOA 1FV2A 3LEMA 1ABRB 2NZ9A 5AYEA 4OWKA 1W3GA 4IHZA 4ZGRB 3BAGA 1YRZA 4GP0A 2GZBA 7I1BA 2XOAA 1Z4SA 4LO1A 2YUGA 1CVSA 1DQOA 4J2SA 1AVXB 2ADEA 4I6IA 1RY7A 1ITBA 1S0BA 4X3AA 2Y9WC 3O4CA 4IQPA 5FMDA 1ISVA 4I4SA 4H9WA 5BQUA 5FMBA 3WO2A 3PHZA 1YI7A 2HWAA 1XYFA 3WMYA 2K43A 1BFBA 4J2KA 3QC2A 4I4RA 4LO8B 2Q9XA 4X39A 3UJ0A 3I29B 1FMZA 3AJ5A 3JRRA 3POKA 4HA2A 3C2UA 1XHBA 3V0BB 4LO1C 3VUOA 1ST8A 4DENA 1BLDA 3SC7X 1PUMB 5FZYA 3QYDA 3C7HA 3BAUA 4IONA 5FNXA 5FKBA 4DCKC 2X2SA 1RZOB 4EFPA 3LIGA 3BA4A 3UJ4A 5D61A 2QQVA 5GLMA 3VSRA 2AC1A 3OM4A 5GLQA 1Q1UA 3HALA 5BQUC 3WASA 1TWMA 1W3AA 4MLGA 1R8OA 3WPYA 4KEJA 2X8TA 5BVPI 3IM5A 3LTQA 1IILA 4G9NA 3VSFA 3C7FA 5DZUA 4ZFYB 1V6XA 3VT1A 3D5ZA 4EB2B 4PVIA 4GAFA 4AK7A 5EG6C 5GAQA 5FNWA 5AYCA 4PVAA 2IWTB 3CAHA 4R6UB 3I2XA 2AEZA 2RQ9A 3FJKA 1V6VA 1EYLA 3OBTA 4LO7B 5AY9A 4OEFA 1JLXA 3UD7A 5HPZA 1DZDA 1ISXA 1ILR1 5JOYA 1L2HA 3R4UA 4JKQA 1VCLA 1S0EA 2IHOA 4XFTA 3AKGA 5BXRA 4FFHA 4J2YA 4D0ZA 3WINA 1I1BA 1WD4A 4X38A 5DVHA 3CU9A 3FFZA 5F8WA 2D7IA 3O4DA 3MPPG 3HMYA 2OXBA 2FFVA 1YXWA 4ZFWB 2LIQA 3PUBA 4TLPA 2K4AB 2X2TA 4I1EA 5F8SA 3VEQA 8I1BA 4G6MA 2FO1A 2P39A 5ANNA 4JKXB 4ONZA 1YBIA 3FJHA 2I1BA 1EVTA 3RSJA 1AF9A 2RG9B 2ADDA 4N1IA 3HN1A 3I2AA 4UDGA 5I1BA 3BAHA 3VWCA 1V6WA 3O4BA 1SZ6B 3NJ5A 2F2FA 3HSMA 2KKIA 1IHKA 1TTUA 4I4OA 3OM6A 2L5XA 3Q7XA 1XZZA 3WINC 1P63A 3AH4A 3WPZA 4OEGA 4ZFUB 3CA6A 4OUJA 2EXJA 1G82A 3FJIA 2Q3NB 1FQ9A 3V0AB 3R67A 2KI4A 3AJ6A 3O44A 4JAWA 3VSZA 4EFQA 2VU9A 2B4WA 1JTCA 3WMZA 4AK6A 4I4QA 4LO7C 2NP0A 1JY0A 1HCDA 3KF3A 3LLPA 5FKCA 2F2FC 3CA1A 3BRDA 1BASA 3HBWA 3WPVA 1G9AA 4P6AA 1G9DA 4UDKE 3IIRA 4LO0C 5BP5A 1N4KA 2XQRA 1DQGA 2BFHA 4J23B 3BRGC 5BXPA 1XG6A 3CRGA 4GOVA 3V0AA 3BB2A 1TP0A 1UYPA 5G00A 3UGFA 2DRZA 4IY8A 1HWMB 1YYNA 4A7KA 3FJFA 3UGHA 4HJJA 1IJTA 2EXHA 4KCAA 4NOVA 2KI6B 3FUQA 1A8DA 9ILBA 4GP3A 4P0LA 4N2RA 3V79C 1G9BA 1FV3A 21BIA 3LDRA 1HWPB 1V6UA 3RWKX 4I4VA 4II0A 1NZKA 4A7ZA 3WMVA 5BP5C 3CRIA 1EPWA 4CJMA 2ZQNA 2ESUA 5B6SA 5FMCA 4I1BA 4QD2B 3D61A 1QQLA 3ZXLA 3C7EA 5GLLA 4P0JA 4EQVA 2J3PA 4I7IA 4F34A 4USOA 3ILAA 1FN0A 3UD8A 3B9UA 4QBCA 4A7YA 3WPUA 1TIEA 3E8LC 4IYBA 4JPZA 3N0KA 4N4BA 5GLRA 4O8OA 1SR4A 4G1RA 3TAWA 3LIHA 3KF5A 5D62A 5GLPA 5A8CA 2ERMA 1YF8B 1GYHA 4KCBA 3CA0A 3FJDA 1F31A 2GO2A 2M49A 2Y9FA 4FGFA 2EXKA 3H6QA 1OQLB 1CE7B 3NBDA 3C7GA 3OM7A 5EC5A 4LO2A 1Q04A 4FFIA 5JMCA 4QQSA 3LFIA 2YFTA 3NBNA 3F62B 3BYJA 5A7VA 2RSTA 1S0CA 1YTOA 2D22A 3QR5A 3N7MA 3WO3A 1PT2A 5FK7A 3RTIB 4X37A 4Z8SB 1Y7BA 2Y9XE 2VXTI 4OWLA 3WATA 1SR4C 3AZWA 2NVHA 3ZXGA 5JOWA 2DRYA 3BA5A 2D44A 2E4MA 5JLVA 3A21A 4ZA3B 1UV4A 3WN0A 4KBBA 4I2SA 1Z2VA 3A23A 4OW4A 1PUUB 2NTDA 4QD2C 5E24E 4LO2C 1JQZA 3H6RA 3D5YA 2D24A 2MLLB 4ZLBB 2EXIA 4YOLA 3VT2A 1G9CA 3R4YA 4WBCA 4J2XA 6I1BA 1D0HA 1FMMS 1TFMB 4KEKA 1BARA 3OJVA 4ZBVB 3KMVA 1DFQA 1YIFA 3NQHA 3CA5A 4ZKTB 1BFGA 3P6JA 2ZQOA 3RMYA 3CQAA 4QALA 4Q9GA 3WMUA 5FLWA 2E4MC 3AZVA 3Q7WA 3D7WB 1S0GA 3OM5A 5AYDA 3BYLA 4U6BA 3FJ9A 1NUNA 3PIGA 4QC4A 1Q03A 3IM6A 5FZZA 3A22A 1RG8A 1DLLA 3IM7A 2VUAA 5DUYA 3T8SA 3LV4A 1JLYA 1K5VA 1S0DA 3QEEA 2D1ZA 2LIEA 4COTA 4Q9PA 3OBRA 3QZ4A 1DIWA 3O49A 1IT0A 1EV2A 2KH2A 3OM2A 1WL7A 1R8NA 5GLKA 1HWNB 3NBEA 2YFRA 3SNVA 3FGMA 3UD9A 1DFCA 4OWJA 5FZUA 2FGFA 2AQZA 1AVUA 2VSEA 4P0KA 3TC2A 1Y9MA 4HR6C 1PWAA 2F8XC 2FFUA 1T9FA 4I37A 5F8YA 1VKDA 4FVVA 1JT7A 2Y9GA 1GGPB 2VLCA 4JP0A 3ZC8A 4I4YA 3Q7YA 3P6IA 3U14A 1FGAA 3PIJA 1WBCA 4AN6A 4I96A 4D47A 4I4XA 2DS0A 3FJ8A 1M16A 1GYEB 2FDBM 3K1UA 3O4OA 3FJEA 3AKFA 4XFSA 4EEEB 3O3QA 1ISYA 3WA1A 3U75A 1J0SA 4ENDA 2AAIB 1AXMA 1KNMA 2MIBA 4USPA 2QQWA 4O8PA 3F1RA 3R4ZA 2D43A 3K1XA 4AN7B 3KSTA 2AFGA 5A8DA 3AH2A 2NYYA 2X8SA 4ISQA 1Z0HA 4EFRA 1QXMA
chains in the Genus database with same CATH superfamily
1AFCA 4QKRA 3C7OA 3A07A 2ZR1B 5B6TA 5C0PA 1TOOA 1PC8B 3PG0A 1TWEA 1S0FA 3MALA 1DJSB 3BTAA 4PC4A 1MC9A 3D60A 5A7VB 4IZEA 1AVAC 3UGGA 5D63A 1IOBA 41BIA 5BXSA 1FWUA 4KMIA 4GOYA 4ZOTA 4MZFB 5F90A 1AVWB 4H04A 3AKIA 1T4QA 1I1EA 3BAOA 1Y4WA 1HCEA 2YFSA 3UDAA 4XFUA 2VXRA 5FIXA 3BA7A 3OJMA 4ISRA 3LDKA 3FJAA 3FJBA 3FJCA 4UDIA 1QQKA 3IAGC 1HKNA 3AH1A 3RMXA 3R4SA 4KEIA 3LF7A 3CRHA 1M2TB 2QN4A 4G9MA 1W3FA 3OJ2A 4QO3A 4JRAA 3WAUA 3H6RB 3N7JA 3N7KA 2HW9A 4I8MA 5GLNA 2D23A 2D7RA 4D0TA 1K5UA 2R9KB 2NM1A 4IZXA 3AKHA 1BFCA 3ZXJA 3FJJA 3ZXDA 4XKIA 1WBAA 3V0BA 1OYGA 2K8RA 1PZZA 3C9ZA 1ISWA 2QYIB 4G6JA 4I4UA 1W18A 5JOZA 3BAVA 2ET2A 2HWMA 2BEAA 1FWVA 3WO4A 5DSSB 3WN2A 1DZCA 3CA3A 3O5WB 4KC3A 5BOWA 1IRPA 1HIBA 4DEPA 4U6DA 3BADA 4LO3A 2KLLA 4N2ZA 1S0LA 2D20A 3O4AA 4GAIA 1BLAA 4FFGA 5C2MA 3VT0A 1BFFA 1ISZA 4KC8A 1JT5A 3QEDA 2AXMA 4Z9WB 2VDTA 1JT4A 3WN1A 3CU1B 1BA7A 1MD6A 2WBCA 1WD3A 3VSSA 5B2HA 2AEYA 3ZX7A 3FUOA 2DREA 3ZC9A 3W9TA 4QBVA 1W2TA 4Q91A 4IY9A 3EF2A 3P53A 1JT3A 3BX1C 3BRFA 1HWOB 2VSAA 2WRYA 4EKXB 3JUTA 5BXTA 3H6SE 3N7LA 3RTJB 3BYKA 4L4IA 2Z48A 4O8NA 3PMEA 3CA4A 4KC7A 4L4HA 4I4PA 3S8KA 3OGGA 3NBCA 4LO3C 3OGFA 4LO0A 4OEEA 4D8HA 4UDJA 5FK8A 3ZXKA 2NS2A 4JQ0A 1UPSA 4I0YA 2UUSA 4AK5A 4F83A 2P23A 4UDKA 2HZ9A 1GYDB 2BEBA 2Z49A 1II4A 1RMLA 5JOXA 3QEFA 1ONKB 3S8JA 2QQUA 4I3NA 4QKSA 3P2NA 3BAQA 31BIA 1Y9GA 5EHAA 1E0OA 2X8FA 3BYNA 4FFFA 3HOMA 1IRAX 2MC2A 5GLOA 1FV2A 3LEMA 1ABRB 2NZ9A 5AYEA 4OWKA 1W3GA 4IHZA 4ZGRB 3BAGA 1YRZA 4GP0A 2GZBA 7I1BA 2XOAA 1Z4SA 4LO1A 2YUGA 1CVSA 1DQOA 4J2SA 1AVXB 2ADEA 4I6IA 1RY7A 1ITBA 1S0BA 4X3AA 2Y9WC 3O4CA 4IQPA 5FMDA 1ISVA 4I4SA 4H9WA 5BQUA 5FMBA 3WO2A 3PHZA 1YI7A 2HWAA 1XYFA 3WMYA 2K43A 1BFBA 4J2KA 3QC2A 4I4RA 4LO8B 2Q9XA 4X39A 3UJ0A 3I29B 1FMZA 3AJ5A 3JRRA 3POKA 4HA2A 3C2UA 1XHBA 3V0BB 4LO1C 3VUOA 1ST8A 4DENA 1BLDA 3SC7X 1PUMB 5FZYA 3QYDA 3C7HA 3BAUA 4IONA 4MZGB 5FNXA 5FKBA 4DCKC 2X2SA 1RZOB 4EFPA 3LIGA 3BA4A 3UJ4A 5D61A 2QQVA 5GLMA 3VSRA 2AC1A 3OM4A 5GLQA 1Q1UA 3HALA 5BQUC 3WASA 1TWMA 1W3AA 4MLGA 1R8OA 3WPYA 4KEJA 2X8TA 5BVPI 3IM5A 3LTQA 1IILA 4G9NA 3VSFA 3C7FA 5DZUA 4ZFYB 1V6XA 3VT1A 3D5ZA 4EB2B 4PVIA 4GAFA 4AK7A 5EG6C 5GAQA 5FNWA 5AYCA 4PVAA 2IWTB 3CAHA 4R6UB 3I2XA 2AEZA 2RQ9A 3FJKA 1V6VA 1EYLA 3OBTA 4H75A 4LO7B 5AY9A 4OEFA 1JLXA 3UD7A 5HPZA 1DZDA 1ISXA 1ILR1 5JOYA 1L2HA 3R4UA 4JKQA 1VCLA 1S0EA 2IHOA 4XFTA 3AKGA 5BXRA 4FFHA 4J2YA 4D0ZA 3WINA 1I1BA 1WD4A 4X38A 5DVHA 3CU9A 3FFZA 5F8WA 2D7IA 3O4DA 3MPPG 3HMYA 2OXBA 2FFVA 1YXWA 4ZFWB 2LIQA 3PUBA 4TLPA 2K4AB 2X2TA 4I1EA 5F8SA 3VEQA 8I1BA 4G6MA 2FO1A 2P39A 5ANNA 4JKXB 4ONZA 1YBIA 3FJHA 2I1BA 1EVTA 3RSJA 1AF9A 2RG9B 2ADDA 4N1IA 3HN1A 3I2AA 4UDGA 5I1BA 3BAHA 3VWCA 1V6WA 3O4BA 1SZ6B 3NJ5A 2F2FA 3HSMA 2KKIA 1IHKA 1TTUA 4I4OA 3OM6A 2L5XA 3Q7XA 1XZZA 3WINC 1P63A 3AH4A 3WPZA 4OEGA 4ZFUB 3CA6A 4OUJA 2EXJA 1G82A 3FJIA 2Q3NB 1FQ9A 3V0AB 3R67A 2KI4A 3AJ6A 3O44A 4JAWA 3VSZA 4EFQA 2VU9A 2B4WA 1JTCA 3WMZA 4AK6A 4I4QA 4LO7C 2NP0A 1JY0A 1HCDA 3KF3A 3LLPA 5FKCA 2F2FC 3CA1A 3BRDA 1BASA 3HBWA 3WPVA 1G9AA 4P6AA 1G9DA 4UDKE 3IIRA 4LO0C 5BP5A 1N4KA 2XQRA 1DQGA 2BFHA 4J23B 3BRGC 5BXPA 1XG6A 3CRGA 4GOVA 3V0AA 3BB2A 1TP0A 1UYPA 5G00A 3UGFA 2DRZA 4IY8A 1HWMB 1YYNA 4A7KA 3FJFA 3UGHA 4HJJA 1IJTA 2EXHA 4KCAA 4NOVA 2KI6B 3FUQA 1A8DA 9ILBA 4GP3A 4P0LA 4N2RA 3V79C 1G9BA 1FV3A 21BIA 1TL2A 1HWPB 1V6UA 3LDRA 3RWKX 4I4VA 4II0A 1NZKA 4A7ZA 3WMVA 5BP5C 3CRIA 1EPWA 4CJMA 2ZQNA 2ESUA 5B6SA 5FMCA 4I1BA 4QD2B 3D61A 1QQLA 3ZXLA 3C7EA 5GLLA 4P0JA 4EQVA 2J3PA 4I7IA 4F34A 4USOA 3ILAA 1FN0A 3UD8A 3B9UA 4QBCA 4A7YA 3WPUA 1TIEA 3E8LC 4IYBA 4JPZA 3N0KA 4N4BA 5GLRA 4O8OA 1SR4A 4G1RA 3TAWA 3LIHA 3KF5A 5D62A 5GLPA 5A8CA 2ERMA 1YF8B 1GYHA 4KCBA 3CA0A 3FJDA 1F31A 2GO2A 2M49A 2Y9FA 4FGFA 2EXKA 3H6QA 1OQLB 1CE7B 3NBDA 3C7GA 3OM7A 5EC5A 4LO2A 1Q04A 4FFIA 5JMCA 4QQSA 3LFIA 2YFTA 3NBNA 3F62B 3BYJA 5A7VA 2RSTA 1S0CA 1YTOA 2D22A 3QR5A 3N7MA 3WO3A 1PT2A 5FK7A 3RTIB 4X37A 4Z8SB 1Y7BA 2Y9XE 2VXTI 4OWLA 3WATA 1SR4C 3AZWA 2NVHA 3ZXGA 5JOWA 2DRYA 4UY4A 3BA5A 2D44A 2E4MA 5JLVA 3A21A 4ZA3B 1UV4A 3WN0A 4KBBA 4I2SA 1Z2VA 3A23A 4OW4A 1PUUB 2NTDA 4QD2C 5E24E 4LO2C 1JQZA 3H6RA 3D5YA 2D24A 2MLLB 4ZLBB 2EXIA 4YOLA 3VT2A 1G9CA 3R4YA 4WBCA 4J2XA 6I1BA 1D0HA 1FMMS 1TFMB 4KEKA 1BARA 3OJVA 4ZBVB 3KMVA 1DFQA 1YIFA 3NQHA 3CA5A 4ZKTB 1BFGA 3P6JA 2ZQOA 3RMYA 3CQAA 4QALA 4Q9GA 3WMUA 5FLWA 2E4MC 3AZVA 3Q7WA 3D7WB 1S0GA 3OM5A 5AYDA 3BYLA 4U6BA 3FJ9A 1NUNA 3PIGA 4QC4A 1Q03A 3IM6A 5FZZA 3A22A 1RG8A 1DLLA 3IM7A 2VUAA 5DUYA 3T8SA 3LV4A 1JLYA 1K5VA 1S0DA 3QEEA 2D1ZA 2LIEA 4COTA 4MZHA 4Q9PA 3OBRA 3QZ4A 1DIWA 3O49A 1IT0A 1EV2A 2KH2A 3OM2A 1WL7A 1R8NA 5GLKA 1HWNB 3NBEA 2YFRA 3SNVA 3FGMA 3UD9A 1DFCA 4OWJA 5FZUA 2FGFA 2AQZA 1AVUA 2VSEA 4P0KA 3TC2A 1Y9MA 4HR6C 1PWAA 2F8XC 2FFUA 1T9FA 4I37A 5F8YA 1VKDA 4FVVA 1JT7A 2Y9GA 1GGPB 2VLCA 4JP0A 3ZC8A 4I4YA 3Q7YA 3P6IA 3U14A 1FGAA 3PIJA 1WBCA 4AN6A 4I96A 4D47A 4I4XA 2DS0A 3FJ8A 1M16A 1GYEB 2FDBM 3K1UA 3O4OA 3FJEA 3AKFA 4XFSA 4EEEB 3O3QA 1ISYA 3WA1A 3U75A 1J0SA 4ENDA 2AAIB 1AXMA 1KNMA 2MIBA 4USPA 2QQWA 4O8PA 3F1RA 3R4ZA 2D43A 3K1XA 4AN7B 3KSTA 2AFGA 5A8DA 3AH2A 2NYYA 2X8SA 4ISQA 1Z0HA 4EFRA 1QXMA
chains in the Genus database with same CATH topology
1AFCA 4QKRA 3C7OA 3A07A 2ZR1B 5B6TA 5C0PA 1TOOA 1PC8B 3PG0A 1TWEA 1S0FA 3MALA 1DJSB 3BTAA 4PC4A 1MC9A 3D60A 5A7VB 4IZEA 1AVAC 3UGGA 5D63A 1IOBA 41BIA 5BXSA 1FWUA 4KMIA 4GOYA 4ZOTA 4MZFB 5F90A 1AVWB 4H04A 3AKIA 1T4QA 1I1EA 3BAOA 1Y4WA 1HCEA 2YFSA 3UDAA 4XFUA 2VXRA 5FIXA 3BA7A 3OJMA 4ISRA 3LDKA 3FJAA 3FJBA 3FJCA 4UDIA 1QQKA 3IAGC 1HKNA 3AH1A 3RMXA 3R4SA 4KEIA 3LF7A 3CRHA 1M2TB 2QN4A 4G9MA 1W3FA 3OJ2A 4QO3A 4JRAA 3WAUA 3H6RB 3N7JA 3N7KA 2HW9A 4I8MA 5GLNA 2D23A 2D7RA 4D0TA 1K5UA 2R9KB 2NM1A 4IZXA 3AKHA 1BFCA 3ZXJA 3FJJA 3ZXDA 4XKIA 1WBAA 3V0BA 1OYGA 2K8RA 1PZZA 3C9ZA 1ISWA 2QYIB 4G6JA 4I4UA 1W18A 5JOZA 3BAVA 2ET2A 2HWMA 2BEAA 1FWVA 3WO4A 5DSSB 3WN2A 1DZCA 3CA3A 3O5WB 4KC3A 5BOWA 1IRPA 1HIBA 4DEPA 4U6DA 3BADA 4LO3A 2KLLA 4N2ZA 1S0LA 2D20A 3O4AA 4GAIA 1BLAA 4FFGA 3VT0A 1BFFA 1ISZA 4KC8A 1JT5A 3QEDA 2AXMA 4Z9WB 2VDTA 1JT4A 3WN1A 3CU1B 1BA7A 1MD6A 2WBCA 1WD3A 3VSSA 5B2HA 2AEYA 3ZX7A 3FUOA 2DREA 3ZC9A 3W9TA 4QBVA 1W2TA 4Q91A 4IY9A 3EF2A 3P53A 1JT3A 3BX1C 3BRFA 1HWOB 2VSAA 2WRYA 4EKXB 3JUTA 5BXTA 3H6SE 3N7LA 3RTJB 3BYKA 4L4IA 2Z48A 4O8NA 3PMEA 3CA4A 4KC7A 4L4HA 4I4PA 3S8KA 3OGGA 3NBCA 4LO3C 3OGFA 4LO0A 4OEEA 4D8HA 4UDJA 5FK8A 3ZXKA 2NS2A 4JQ0A 1UPSA 4I0YA 2UUSA 4AK5A 4F83A 2P23A 4UDKA 2HZ9A 1GYDB 2BEBA 2Z49A 1II4A 1RMLA 5JOXA 3QEFA 1ONKB 3S8JA 2QQUA 4I3NA 4QKSA 3P2NA 3BAQA 31BIA 1Y9GA 5EHAA 1E0OA 2X8FA 3BYNA 4FFFA 3HOMA 1IRAX 2MC2A 5GLOA 1FV2A 3LEMA 1ABRB 2NZ9A 5AYEA 4OWKA 1W3GA 4IHZA 4ZGRB 3BAGA 1YRZA 4GP0A 2GZBA 7I1BA 2XOAA 1Z4SA 4LO1A 2YUGA 1CVSA 1DQOA 4J2SA 1AVXB 2ADEA 4I6IA 1RY7A 1ITBA 1S0BA 4X3AA 2Y9WC 3O4CA 4IQPA 5FMDA 1ISVA 4I4SA 4H9WA 5BQUA 5FMBA 3WO2A 3PHZA 1YI7A 2HWAA 1XYFA 3WMYA 2K43A 1BFBA 4J2KA 3QC2A 4I4RA 4LO8B 2Q9XA 4X39A 3UJ0A 3I29B 1FMZA 3AJ5A 3JRRA 3POKA 4HA2A 3C2UA 1XHBA 3V0BB 4LO1C 3VUOA 1ST8A 4DENA 1BLDA 3SC7X 1PUMB 5FZYA 3QYDA 3C7HA 3BAUA 4IONA 4MZGB 5FNXA 5FKBA 4DCKC 2X2SA 1RZOB 4EFPA 3LIGA 3BA4A 3UJ4A 5D61A 2QQVA 5GLMA 3VSRA 2AC1A 3OM4A 5GLQA 1Q1UA 3HALA 5BQUC 3WASA 1TWMA 1W3AA 4MLGA 1R8OA 3WPYA 4KEJA 2X8TA 5BVPI 3IM5A 3LTQA 1IILA 4G9NA 3VSFA 3C7FA 5DZUA 4ZFYB 1V6XA 3VT1A 3D5ZA 4EB2B 4PVIA 4GAFA 4AK7A 5EG6C 5GAQA 5FNWA 5AYCA 4PVAA 2IWTB 3CAHA 4R6UB 3I2XA 2AEZA 2RQ9A 3FJKA 1V6VA 1EYLA 3OBTA 4H75A 4LO7B 5AY9A 4OEFA 1JLXA 3UD7A 5HPZA 1DZDA 1ISXA 1ILR1 5JOYA 1L2HA 3R4UA 4JKQA 1VCLA 1S0EA 2IHOA 4XFTA 3AKGA 5BXRA 4FFHA 4J2YA 4D0ZA 3WINA 1I1BA 1WD4A 4X38A 5DVHA 3CU9A 3FFZA 5F8WA 2D7IA 3O4DA 3MPPG 3HMYA 2OXBA 2FFVA 1YXWA 4ZFWB 2LIQA 3PUBA 4TLPA 2K4AB 2X2TA 4I1EA 5F8SA 3VEQA 8I1BA 4G6MA 2FO1A 2P39A 5ANNA 4JKXB 4ONZA 1YBIA 3FJHA 2I1BA 1EVTA 3RSJA 1AF9A 2RG9B 2ADDA 4N1IA 3HN1A 3I2AA 4UDGA 5I1BA 3BAHA 3VWCA 1V6WA 3O4BA 1SZ6B 3NJ5A 2F2FA 3HSMA 2KKIA 1IHKA 1TTUA 4I4OA 3OM6A 2L5XA 3Q7XA 1XZZA 3WINC 1P63A 3AH4A 3WPZA 4OEGA 4ZFUB 3CA6A 4OUJA 2EXJA 1G82A 3FJIA 2Q3NB 1FQ9A 3V0AB 3R67A 2KI4A 3AJ6A 3O44A 4JAWA 3VSZA 4EFQA 2VU9A 2B4WA 1JTCA 3WMZA 4AK6A 4I4QA 4LO7C 2NP0A 1JY0A 1HCDA 3KF3A 3LLPA 5FKCA 2F2FC 3CA1A 3BRDA 1BASA 3HBWA 3WPVA 1G9AA 4P6AA 1G9DA 4UDKE 3IIRA 4LO0C 5BP5A 1N4KA 2XQRA 1DQGA 2BFHA 4J23B 3BRGC 5BXPA 1XG6A 3CRGA 4GOVA 3V0AA 3BB2A 1TP0A 1UYPA 5G00A 3UGFA 2DRZA 4IY8A 1HWMB 1YYNA 4A7KA 3FJFA 3UGHA 4HJJA 1IJTA 2EXHA 4KCAA 4NOVA 2KI6B 3FUQA 1A8DA 9ILBA 4GP3A 4P0LA 4N2RA 3V79C 1G9BA 1FV3A 21BIA 3LDRA 1HWPB 1V6UA 3RWKX 4I4VA 4II0A 1NZKA 4A7ZA 3WMVA 5BP5C 3CRIA 1EPWA 4CJMA 2ZQNA 2ESUA 5B6SA 5FMCA 4I1BA 4QD2B 3D61A 1QQLA 3ZXLA 3C7EA 5GLLA 4P0JA 4EQVA 2J3PA 4I7IA 4F34A 4USOA 3ILAA 1FN0A 3UD8A 3B9UA 4QBCA 4A7YA 3WPUA 1TIEA 3E8LC 4IYBA 4JPZA 3N0KA 4N4BA 5GLRA 4O8OA 1SR4A 4G1RA 3TAWA 3LIHA 3KF5A 5D62A 5GLPA 5A8CA 2ERMA 1YF8B 1GYHA 4KCBA 3CA0A 3FJDA 1F31A 2GO2A 2M49A 2Y9FA 4FGFA 2EXKA 3H6QA 1OQLB 1CE7B 3NBDA 3C7GA 3OM7A 5EC5A 4LO2A 1Q04A 4FFIA 5JMCA 4QQSA 3LFIA 2YFTA 3NBNA 3F62B 3BYJA 5A7VA 2RSTA 1S0CA 1YTOA 2D22A 3QR5A 3N7MA 3WO3A 1PT2A 5FK7A 3RTIB 4X37A 4Z8SB 1Y7BA 2Y9XE 2VXTI 4OWLA 3WATA 1SR4C 3AZWA 2NVHA 3ZXGA 5JOWA 2DRYA 4UY4A 3BA5A 2D44A 2E4MA 5JLVA 3A21A 4ZA3B 1UV4A 3WN0A 4KBBA 4I2SA 1Z2VA 3A23A 4OW4A 1PUUB 2NTDA 4QD2C 5E24E 4LO2C 1JQZA 3H6RA 3D5YA 2D24A 2MLLB 4ZLBB 2EXIA 4YOLA 3VT2A 1G9CA 3R4YA 4WBCA 4J2XA 6I1BA 1D0HA 1FMMS 1TFMB 4KEKA 1BARA 3OJVA 4ZBVB 3KMVA 1DFQA 1YIFA 3NQHA 3CA5A 4ZKTB 1BFGA 3P6JA 2ZQOA 3RMYA 3CQAA 4QALA 4Q9GA 3WMUA 5FLWA 2E4MC 3AZVA 3Q7WA 3D7WB 1S0GA 3OM5A 5AYDA 3BYLA 4U6BA 3FJ9A 1NUNA 3PIGA 4QC4A 1Q03A 3IM6A 5FZZA 3A22A 1RG8A 1DLLA 3IM7A 2VUAA 5DUYA 3T8SA 3LV4A 1JLYA 1K5VA 1S0DA 3QEEA 2D1ZA 2LIEA 4COTA 4MZHA 4Q9PA 3OBRA 3QZ4A 1DIWA 3O49A 1IT0A 1EV2A 2KH2A 3OM2A 1WL7A 1R8NA 5GLKA 1HWNB 3NBEA 2YFRA 3SNVA 3FGMA 3UD9A 1DFCA 4OWJA 5FZUA 2FGFA 2AQZA 1AVUA 2VSEA 4P0KA 3TC2A 1Y9MA 4HR6C 1PWAA 2F8XC 2FFUA 1T9FA 4I37A 5F8YA 1VKDA 4FVVA 1JT7A 2Y9GA 1GGPB 2VLCA 4JP0A 3ZC8A 4I4YA 3Q7YA 3P6IA 3U14A 1FGAA 3PIJA 1WBCA 4AN6A 4I96A 4D47A 4I4XA 2DS0A 3FJ8A 1M16A 1GYEB 2FDBM 3K1UA 3O4OA 3FJEA 3AKFA 4XFSA 4EEEB 3O3QA 1ISYA 3WA1A 3U75A 1J0SA 4ENDA 2AAIB 1AXMA 1KNMA 2MIBA 4USPA 2QQWA 4O8PA 3F1RA 3R4ZA 2D43A 3K1XA 4AN7B 3KSTA 2AFGA 5A8DA 3AH2A 2NYYA 2X8SA 4ISQA 1Z0HA 4EFRA 1QXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFC A;  4QKR A;  3C7O A;  3A07 A;  2ZR1 B;  5B6T A;  5C0P A;  1TOO A;  1PC8 B;  3PG0 A;  1TWE A;  1S0F A;  3MAL A;  1DJS B;  3BTA A;  4PC4 A;  1MC9 A;  3D60 A;  5A7V B;  4IZE A;  1AVA C;  3UGG A;  5D63 A;  1IOB A;  41BI A;  5BXS A;  1FWU A;  4KMI A;  4GOY A;  4ZOT A;  5F90 A;  1AVW B;  4H04 A;  3AKI A;  1T4Q A;  1I1E A;  3BAO A;  1Y4W A;  1HCE A;  2YFS A;  3UDA A;  4XFU A;  2VXR A;  5FIX A;  3BA7 A;  3OJM A;  4ISR A;  3LDK A;  3FJA A;  3FJB A;  3FJC A;  4UDI A;  1QQK A;  3IAG C;  1HKN A;  3AH1 A;  3RMX A;  3R4S A;  4KEI A;  3LF7 A;  3CRH A;  1M2T B;  2QN4 A;  4G9M A;  1W3F A;  3OJ2 A;  4QO3 A;  4JRA A;  3WAU A;  3H6R B;  3N7J A;  3N7K A;  2HW9 A;  4I8M A;  5GLN A;  2D23 A;  2D7R A;  4D0T A;  1K5U A;  2R9K B;  2NM1 A;  4IZX A;  3AKH A;  1BFC A;  3ZXJ A;  3FJJ A;  3ZXD A;  4XKI A;  1WBA A;  3V0B A;  1OYG A;  2K8R A;  1PZZ A;  3C9Z A;  1ISW A;  2QYI B;  4G6J A;  4I4U A;  1W18 A;  5JOZ A;  3BAV A;  2ET2 A;  2HWM A;  2BEA A;  1FWV A;  3WO4 A;  5DSS B;  3WN2 A;  1DZC A;  3CA3 A;  3O5W B;  4KC3 A;  5BOW A;  1IRP A;  1HIB A;  4DEP A;  4U6D A;  3BAD A;  4LO3 A;  2KLL A;  4N2Z A;  1S0L A;  2D20 A;  3O4A A;  4GAI A;  1BLA A;  4FFG A;  3VT0 A;  1BFF A;  1ISZ A;  4KC8 A;  1JT5 A;  3QED A;  2AXM A;  4Z9W B;  2VDT A;  1JT4 A;  3WN1 A;  3CU1 B;  1BA7 A;  1MD6 A;  2WBC A;  1WD3 A;  3VSS A;  5B2H A;  2AEY A;  3ZX7 A;  3FUO A;  2DRE A;  3ZC9 A;  3W9T A;  4QBV A;  1W2T A;  4Q91 A;  4IY9 A;  3EF2 A;  3P53 A;  1JT3 A;  3BX1 C;  3BRF A;  1HWO B;  2VSA A;  2WRY A;  4EKX B;  3JUT A;  5BXT A;  3H6S E;  3N7L A;  3RTJ B;  3BYK A;  4L4I A;  2Z48 A;  4O8N A;  3PME A;  3CA4 A;  4KC7 A;  4L4H A;  4I4P A;  3S8K A;  3OGG A;  3NBC A;  4LO3 C;  3OGF A;  4LO0 A;  4OEE A;  4D8H A;  4UDJ A;  5FK8 A;  3ZXK A;  4JQ0 A;  1UPS A;  4I0Y A;  2UUS A;  4AK5 A;  4F83 A;  2P23 A;  4UDK A;  2HZ9 A;  1GYD B;  2BEB A;  2Z49 A;  1II4 A;  1RML A;  5JOX A;  3QEF A;  1ONK B;  3S8J A;  2QQU A;  4I3N A;  4QKS A;  3P2N A;  3BAQ A;  31BI A;  1Y9G A;  5EHA A;  1E0O A;  2X8F A;  3BYN A;  4FFF A;  3HOM A;  1IRA X;  2MC2 A;  5GLO A;  1FV2 A;  3LEM A;  1ABR B;  2NZ9 A;  5AYE A;  4OWK A;  1W3G A;  4IHZ A;  4ZGR B;  3BAG A;  1YRZ A;  4GP0 A;  2GZB A;  7I1B A;  2XOA A;  1Z4S A;  4LO1 A;  2YUG A;  1CVS A;  1DQO A;  4J2S A;  1AVX B;  2ADE A;  4I6I A;  1RY7 A;  1ITB A;  1S0B A;  4X3A A;  2Y9W C;  3O4C A;  4IQP A;  5FMD A;  1ISV A;  4I4S A;  4H9W A;  5BQU A;  5FMB A;  3WO2 A;  3PHZ A;  1YI7 A;  2HWA A;  1XYF A;  3WMY A;  2K43 A;  1BFB A;  4J2K A;  3QC2 A;  4I4R A;  4LO8 B;  2Q9X A;  4X39 A;  3UJ0 A;  3I29 B;  1FMZ A;  3AJ5 A;  3JRR A;  3POK A;  4HA2 A;  3C2U A;  1XHB A;  3V0B B;  4LO1 C;  3VUO A;  1ST8 A;  4DEN A;  1BLD A;  3SC7 X;  1PUM B;  5FZY A;  3QYD A;  3C7H A;  3BAU A;  4ION A;  5FNX A;  5FKB A;  4DCK C;  2X2S A;  1RZO B;  4EFP A;  3LIG A;  3BA4 A;  3UJ4 A;  5D61 A;  2QQV A;  5GLM A;  3VSR A;  2AC1 A;  3OM4 A;  5GLQ A;  1Q1U A;  3HAL A;  5BQU C;  3WAS A;  1TWM A;  1W3A A;  4MLG A;  1R8O A;  3WPY A;  4KEJ A;  2X8T A;  5BVP I;  3IM5 A;  3LTQ A;  1IIL A;  4G9N A;  3VSF A;  3C7F A;  5DZU A;  4ZFY B;  1V6X A;  3VT1 A;  3D5Z A;  4EB2 B;  4PVI A;  4GAF A;  4AK7 A;  5EG6 C;  5GAQ A;  5FNW A;  5AYC A;  4PVA A;  2IWT B;  3CAH A;  4R6U B;  3I2X A;  2AEZ A;  2RQ9 A;  3FJK A;  1V6V A;  1EYL A;  3OBT A;  4LO7 B;  5AY9 A;  4OEF A;  1JLX A;  3UD7 A;  5HPZ A;  1DZD A;  1ISX A;  1ILR 1;  5JOY A;  1L2H A;  3R4U A;  4JKQ A;  1VCL A;  1S0E A;  2IHO A;  4XFT A;  3AKG A;  5BXR A;  4FFH A;  4J2Y A;  4D0Z A;  3WIN A;  1I1B A;  1WD4 A;  4X38 A;  5DVH A;  3CU9 A;  3FFZ A;  5F8W A;  2D7I A;  3O4D A;  3MPP G;  3HMY A;  2OXB A;  2FFV A;  1YXW A;  4ZFW B;  2LIQ A;  3PUB A;  4TLP A;  2K4A B;  2X2T A;  4I1E A;  5F8S A;  3VEQ A;  8I1B A;  4G6M A;  2FO1 A;  2P39 A;  5ANN A;  4JKX B;  4ONZ A;  1YBI A;  3FJH A;  2I1B A;  1EVT A;  3RSJ A;  1AF9 A;  2RG9 B;  2ADD A;  4N1I A;  3HN1 A;  3I2A A;  4UDG A;  5I1B A;  3BAH A;  3VWC A;  1V6W A;  3O4B A;  1SZ6 B;  3NJ5 A;  2F2F A;  3HSM A;  2KKI A;  1IHK A;  1TTU A;  4I4O A;  3OM6 A;  2L5X A;  3Q7X A;  1XZZ A;  3WIN C;  1P63 A;  3AH4 A;  3WPZ A;  4OEG A;  4ZFU B;  3CA6 A;  4OUJ A;  2EXJ A;  1G82 A;  3FJI A;  2Q3N B;  1FQ9 A;  3V0A B;  3R67 A;  2KI4 A;  3AJ6 A;  3O44 A;  4JAW A;  3VSZ A;  4EFQ A;  2VU9 A;  2B4W A;  1JTC A;  3WMZ A;  4AK6 A;  4I4Q A;  4LO7 C;  2NP0 A;  1JY0 A;  1HCD A;  3KF3 A;  3LLP A;  5FKC A;  2F2F C;  3CA1 A;  3BRD A;  1BAS A;  3HBW A;  3WPV A;  1G9A A;  4P6A A;  1G9D A;  4UDK E;  3IIR A;  4LO0 C;  5BP5 A;  1N4K A;  2XQR A;  1DQG A;  2BFH A;  4J23 B;  3BRG C;  5BXP A;  1XG6 A;  3CRG A;  4GOV A;  3V0A A;  3BB2 A;  1TP0 A;  1UYP A;  5G00 A;  3UGF A;  2DRZ A;  4IY8 A;  1HWM B;  1YYN A;  4A7K A;  3FJF A;  3UGH A;  4HJJ A;  1IJT A;  2EXH A;  4KCA A;  4NOV A;  2KI6 B;  3FUQ A;  1A8D A;  9ILB A;  4GP3 A;  4P0L A;  4N2R A;  3V79 C;  1G9B A;  1FV3 A;  21BI A;  3LDR A;  1HWP B;  1V6U A;  3RWK X;  4I4V A;  4II0 A;  1NZK A;  4A7Z A;  3WMV A;  5BP5 C;  3CRI A;  1EPW A;  4CJM A;  2ZQN A;  2ESU A;  5B6S A;  5FMC A;  4I1B A;  4QD2 B;  3D61 A;  1QQL A;  3ZXL A;  3C7E A;  5GLL A;  4P0J A;  4EQV A;  2J3P A;  4I7I A;  4F34 A;  4USO A;  3ILA A;  1FN0 A;  3UD8 A;  3B9U A;  4QBC A;  4A7Y A;  3WPU A;  1TIE A;  3E8L C;  4IYB A;  4JPZ A;  3N0K A;  4N4B A;  5GLR A;  4O8O A;  1SR4 A;  4G1R A;  3TAW A;  3LIH A;  3KF5 A;  5D62 A;  5GLP A;  5A8C A;  2ERM A;  1YF8 B;  1GYH A;  4KCB A;  3CA0 A;  3FJD A;  1F31 A;  2GO2 A;  2M49 A;  2Y9F A;  4FGF A;  2EXK A;  3H6Q A;  1OQL B;  1CE7 B;  3NBD A;  3C7G A;  3OM7 A;  5EC5 A;  4LO2 A;  1Q04 A;  4FFI A;  5JMC A;  4QQS A;  3LFI A;  2YFT A;  3NBN A;  3F62 B;  3BYJ A;  5A7V A;  2RST A;  1S0C A;  1YTO A;  2D22 A;  3QR5 A;  3N7M A;  3WO3 A;  1PT2 A;  5FK7 A;  3RTI B;  4X37 A;  4Z8S B;  1Y7B A;  2Y9X E;  2VXT I;  4OWL A;  3WAT A;  1SR4 C;  3AZW A;  2NVH A;  3ZXG A;  5JOW A;  2DRY A;  3BA5 A;  2D44 A;  2E4M A;  5JLV A;  3A21 A;  4ZA3 B;  1UV4 A;  3WN0 A;  4KBB A;  4I2S A;  1Z2V A;  3A23 A;  4OW4 A;  1PUU B;  2NTD A;  4QD2 C;  5E24 E;  4LO2 C;  1JQZ A;  3H6R A;  3D5Y A;  2D24 A;  2MLL B;  4ZLB B;  2EXI A;  4YOL A;  3VT2 A;  1G9C A;  3R4Y A;  4WBC A;  4J2X A;  6I1B A;  1D0H A;  1FMM S;  1TFM B;  4KEK A;  1BAR A;  3OJV A;  4ZBV B;  3KMV A;  1DFQ A;  1YIF A;  3NQH A;  3CA5 A;  4ZKT B;  1BFG A;  3P6J A;  2ZQO A;  3RMY A;  3CQA A;  4QAL A;  4Q9G A;  3WMU A;  5FLW A;  2E4M C;  3AZV A;  3Q7W A;  3D7W B;  1S0G A;  3OM5 A;  5AYD A;  3BYL A;  4U6B A;  3FJ9 A;  1NUN A;  3PIG A;  4QC4 A;  1Q03 A;  3IM6 A;  5FZZ A;  3A22 A;  1RG8 A;  1DLL A;  3IM7 A;  2VUA A;  5DUY A;  3T8S A;  3LV4 A;  1JLY A;  1K5V A;  1S0D A;  3QEE A;  2D1Z A;  2LIE A;  4COT A;  4Q9P A;  3OBR A;  3QZ4 A;  1DIW A;  3O49 A;  1IT0 A;  1EV2 A;  2KH2 A;  3OM2 A;  1WL7 A;  1R8N A;  5GLK A;  1HWN B;  3NBE A;  2YFR A;  3SNV A;  3FGM A;  3UD9 A;  1DFC A;  4OWJ A;  5FZU A;  2FGF A;  2AQZ A;  1AVU A;  2VSE A;  4P0K A;  3TC2 A;  1Y9M A;  4HR6 C;  1PWA A;  2F8X C;  2FFU A;  1T9F A;  4I37 A;  5F8Y A;  1VKD A;  4FVV A;  1JT7 A;  2Y9G A;  1GGP B;  2VLC A;  4JP0 A;  3ZC8 A;  4I4Y A;  3Q7Y A;  3P6I A;  3U14 A;  1FGA A;  3PIJ A;  1WBC A;  4AN6 A;  4I96 A;  4D47 A;  4I4X A;  2DS0 A;  3FJ8 A;  1M16 A;  1GYE B;  2FDB M;  3K1U A;  3O4O A;  3FJE A;  3AKF A;  4XFS A;  4EEE B;  3O3Q A;  1ISY A;  3WA1 A;  3U75 A;  1J0S A;  4END A;  2AAI B;  1AXM A;  1KNM A;  2MIB A;  4USP A;  2QQW A;  4O8P A;  3F1R A;  3R4Z A;  2D43 A;  3K1X A;  4AN7 B;  3KST A;  2AFG A;  5A8D A;  3AH2 A;  2NYY A;  2X8S A;  4ISQ A;  1Z0H A;  4EFR A;  1QXM A; 
#chains in the Genus database with same CATH topology
 1AFC A;  4QKR A;  3C7O A;  3A07 A;  2ZR1 B;  5B6T A;  5C0P A;  1TOO A;  1PC8 B;  3PG0 A;  1TWE A;  1S0F A;  3MAL A;  1DJS B;  3BTA A;  4PC4 A;  1MC9 A;  3D60 A;  5A7V B;  4IZE A;  1AVA C;  3UGG A;  5D63 A;  1IOB A;  41BI A;  5BXS A;  1FWU A;  4KMI A;  4GOY A;  4ZOT A;  4MZF B;  5F90 A;  1AVW B;  4H04 A;  3AKI A;  1T4Q A;  1I1E A;  3BAO A;  1Y4W A;  1HCE A;  2YFS A;  3UDA A;  4XFU A;  2VXR A;  5FIX A;  3BA7 A;  3OJM A;  4ISR A;  3LDK A;  3FJA A;  3FJB A;  3FJC A;  4UDI A;  1QQK A;  3IAG C;  1HKN A;  3AH1 A;  3RMX A;  3R4S A;  4KEI A;  3LF7 A;  3CRH A;  1M2T B;  2QN4 A;  4G9M A;  1W3F A;  3OJ2 A;  4QO3 A;  4JRA A;  3WAU A;  3H6R B;  3N7J A;  3N7K A;  2HW9 A;  4I8M A;  5GLN A;  2D23 A;  2D7R A;  4D0T A;  1K5U A;  2R9K B;  2NM1 A;  4IZX A;  3AKH A;  1BFC A;  3ZXJ A;  3FJJ A;  3ZXD A;  4XKI A;  1WBA A;  3V0B A;  1OYG A;  2K8R A;  1PZZ A;  3C9Z A;  1ISW A;  2QYI B;  4G6J A;  4I4U A;  1W18 A;  5JOZ A;  3BAV A;  2ET2 A;  2HWM A;  2BEA A;  1FWV A;  3WO4 A;  5DSS B;  3WN2 A;  1DZC A;  3CA3 A;  3O5W B;  4KC3 A;  5BOW A;  1IRP A;  1HIB A;  4DEP A;  4U6D A;  3BAD A;  4LO3 A;  2KLL A;  4N2Z A;  1S0L A;  2D20 A;  3O4A A;  4GAI A;  1BLA A;  4FFG A;  5C2M A;  3VT0 A;  1BFF A;  1ISZ A;  4KC8 A;  1JT5 A;  3QED A;  2AXM A;  4Z9W B;  2VDT A;  1JT4 A;  3WN1 A;  3CU1 B;  1BA7 A;  1MD6 A;  2WBC A;  1WD3 A;  3VSS A;  5B2H A;  2AEY A;  3ZX7 A;  3FUO A;  2DRE A;  3ZC9 A;  3W9T A;  4QBV A;  1W2T A;  4Q91 A;  4IY9 A;  3EF2 A;  3P53 A;  1JT3 A;  3BX1 C;  3BRF A;  1HWO B;  2VSA A;  2WRY A;  4EKX B;  3JUT A;  5BXT A;  3H6S E;  3N7L A;  3RTJ B;  3BYK A;  4L4I A;  2Z48 A;  4O8N A;  3PME A;  3CA4 A;  4KC7 A;  4L4H A;  4I4P A;  3S8K A;  3OGG A;  3NBC A;  4LO3 C;  3OGF A;  4LO0 A;  4OEE A;  4D8H A;  4UDJ A;  5FK8 A;  3ZXK A;  2NS2 A;  4JQ0 A;  1UPS A;  4I0Y A;  2UUS A;  4AK5 A;  4F83 A;  2P23 A;  4UDK A;  2HZ9 A;  1GYD B;  2BEB A;  2Z49 A;  1II4 A;  1RML A;  5JOX A;  3QEF A;  1ONK B;  3S8J A;  2QQU A;  4I3N A;  4QKS A;  3P2N A;  3BAQ A;  31BI A;  1Y9G A;  5EHA A;  1E0O A;  2X8F A;  3BYN A;  4FFF A;  3HOM A;  1IRA X;  2MC2 A;  5GLO A;  1FV2 A;  3LEM A;  1ABR B;  2NZ9 A;  5AYE A;  4OWK A;  1W3G A;  4IHZ A;  4ZGR B;  3BAG A;  1YRZ A;  4GP0 A;  2GZB A;  7I1B A;  2XOA A;  1Z4S A;  4LO1 A;  2YUG A;  1CVS A;  1DQO A;  4J2S A;  1AVX B;  2ADE A;  4I6I A;  1RY7 A;  1ITB A;  1S0B A;  4X3A A;  2Y9W C;  3O4C A;  4IQP A;  5FMD A;  1ISV A;  4I4S A;  4H9W A;  5BQU A;  5FMB A;  3WO2 A;  3PHZ A;  1YI7 A;  2HWA A;  1XYF A;  3WMY A;  2K43 A;  1BFB A;  4J2K A;  3QC2 A;  4I4R A;  4LO8 B;  2Q9X A;  4X39 A;  3UJ0 A;  3I29 B;  1FMZ A;  3AJ5 A;  3JRR A;  3POK A;  4HA2 A;  3C2U A;  1XHB A;  3V0B B;  4LO1 C;  3VUO A;  1ST8 A;  4DEN A;  1BLD A;  3SC7 X;  1PUM B;  5FZY A;  3QYD A;  3C7H A;  3BAU A;  4ION A;  4MZG B;  5FNX A;  5FKB A;  4DCK C;  2X2S A;  1RZO B;  4EFP A;  3LIG A;  3BA4 A;  3UJ4 A;  5D61 A;  2QQV A;  5GLM A;  3VSR A;  2AC1 A;  3OM4 A;  5GLQ A;  1Q1U A;  3HAL A;  5BQU C;  3WAS A;  1TWM A;  1W3A A;  4MLG A;  1R8O A;  3WPY A;  4KEJ A;  2X8T A;  5BVP I;  3IM5 A;  3LTQ A;  1IIL A;  4G9N A;  3VSF A;  3C7F A;  5DZU A;  4ZFY B;  1V6X A;  3VT1 A;  3D5Z A;  4EB2 B;  4PVI A;  4GAF A;  4AK7 A;  5EG6 C;  5GAQ A;  5FNW A;  5AYC A;  4PVA A;  2IWT B;  3CAH A;  4R6U B;  3I2X A;  2AEZ A;  2RQ9 A;  3FJK A;  1V6V A;  1EYL A;  3OBT A;  4H75 A;  4LO7 B;  5AY9 A;  4OEF A;  1JLX A;  3UD7 A;  5HPZ A;  1DZD A;  1ISX A;  1ILR 1;  5JOY A;  1L2H A;  3R4U A;  4JKQ A;  1VCL A;  1S0E A;  2IHO A;  4XFT A;  3AKG A;  5BXR A;  4FFH A;  4J2Y A;  4D0Z A;  3WIN A;  1I1B A;  1WD4 A;  4X38 A;  5DVH A;  3CU9 A;  3FFZ A;  5F8W A;  2D7I A;  3O4D A;  3MPP G;  3HMY A;  2OXB A;  2FFV A;  1YXW A;  4ZFW B;  2LIQ A;  3PUB A;  4TLP A;  2K4A B;  2X2T A;  4I1E A;  5F8S A;  3VEQ A;  8I1B A;  4G6M A;  2FO1 A;  2P39 A;  5ANN A;  4JKX B;  4ONZ A;  1YBI A;  3FJH A;  2I1B A;  1EVT A;  3RSJ A;  1AF9 A;  2RG9 B;  2ADD A;  4N1I A;  3HN1 A;  3I2A A;  4UDG A;  5I1B A;  3BAH A;  3VWC A;  1V6W A;  3O4B A;  1SZ6 B;  3NJ5 A;  2F2F A;  3HSM A;  2KKI A;  1IHK A;  1TTU A;  4I4O A;  3OM6 A;  2L5X A;  3Q7X A;  1XZZ A;  3WIN C;  1P63 A;  3AH4 A;  3WPZ A;  4OEG A;  4ZFU B;  3CA6 A;  4OUJ A;  2EXJ A;  1G82 A;  3FJI A;  2Q3N B;  1FQ9 A;  3V0A B;  3R67 A;  2KI4 A;  3AJ6 A;  3O44 A;  4JAW A;  3VSZ A;  4EFQ A;  2VU9 A;  2B4W A;  1JTC A;  3WMZ A;  4AK6 A;  4I4Q A;  4LO7 C;  2NP0 A;  1JY0 A;  1HCD A;  3KF3 A;  3LLP A;  5FKC A;  2F2F C;  3CA1 A;  3BRD A;  1BAS A;  3HBW A;  3WPV A;  1G9A A;  4P6A A;  1G9D A;  4UDK E;  3IIR A;  4LO0 C;  5BP5 A;  1N4K A;  2XQR A;  1DQG A;  2BFH A;  4J23 B;  3BRG C;  5BXP A;  1XG6 A;  3CRG A;  4GOV A;  3V0A A;  3BB2 A;  1TP0 A;  1UYP A;  5G00 A;  3UGF A;  2DRZ A;  4IY8 A;  1HWM B;  1YYN A;  4A7K A;  3FJF A;  3UGH A;  4HJJ A;  1IJT A;  2EXH A;  4KCA A;  4NOV A;  2KI6 B;  3FUQ A;  1A8D A;  9ILB A;  4GP3 A;  4P0L A;  4N2R A;  3V79 C;  1G9B A;  1FV3 A;  21BI A;  1TL2 A;  1HWP B;  1V6U A;  3LDR A;  3RWK X;  4I4V A;  4II0 A;  1NZK A;  4A7Z A;  3WMV A;  5BP5 C;  3CRI A;  1EPW A;  4CJM A;  2ZQN A;  2ESU A;  5B6S A;  5FMC A;  4I1B A;  4QD2 B;  3D61 A;  1QQL A;  3ZXL A;  3C7E A;  5GLL A;  4P0J A;  4EQV A;  2J3P A;  4I7I A;  4F34 A;  4USO A;  3ILA A;  1FN0 A;  3UD8 A;  3B9U A;  4QBC A;  4A7Y A;  3WPU A;  1TIE A;  3E8L C;  4IYB A;  4JPZ A;  3N0K A;  4N4B A;  5GLR A;  4O8O A;  1SR4 A;  4G1R A;  3TAW A;  3LIH A;  3KF5 A;  5D62 A;  5GLP A;  5A8C A;  2ERM A;  1YF8 B;  1GYH A;  4KCB A;  3CA0 A;  3FJD A;  1F31 A;  2GO2 A;  2M49 A;  2Y9F A;  4FGF A;  2EXK A;  3H6Q A;  1OQL B;  1CE7 B;  3NBD A;  3C7G A;  3OM7 A;  5EC5 A;  4LO2 A;  1Q04 A;  4FFI A;  5JMC A;  4QQS A;  3LFI A;  2YFT A;  3NBN A;  3F62 B;  3BYJ A;  5A7V A;  2RST A;  1S0C A;  1YTO A;  2D22 A;  3QR5 A;  3N7M A;  3WO3 A;  1PT2 A;  5FK7 A;  3RTI B;  4X37 A;  4Z8S B;  1Y7B A;  2Y9X E;  2VXT I;  4OWL A;  3WAT A;  1SR4 C;  3AZW A;  2NVH A;  3ZXG A;  5JOW A;  2DRY A;  4UY4 A;  3BA5 A;  2D44 A;  2E4M A;  5JLV A;  3A21 A;  4ZA3 B;  1UV4 A;  3WN0 A;  4KBB A;  4I2S A;  1Z2V A;  3A23 A;  4OW4 A;  1PUU B;  2NTD A;  4QD2 C;  5E24 E;  4LO2 C;  1JQZ A;  3H6R A;  3D5Y A;  2D24 A;  2MLL B;  4ZLB B;  2EXI A;  4YOL A;  3VT2 A;  1G9C A;  3R4Y A;  4WBC A;  4J2X A;  6I1B A;  1D0H A;  1FMM S;  1TFM B;  4KEK A;  1BAR A;  3OJV A;  4ZBV B;  3KMV A;  1DFQ A;  1YIF A;  3NQH A;  3CA5 A;  4ZKT B;  1BFG A;  3P6J A;  2ZQO A;  3RMY A;  3CQA A;  4QAL A;  4Q9G A;  3WMU A;  5FLW A;  2E4M C;  3AZV A;  3Q7W A;  3D7W B;  1S0G A;  3OM5 A;  5AYD A;  3BYL A;  4U6B A;  3FJ9 A;  1NUN A;  3PIG A;  4QC4 A;  1Q03 A;  3IM6 A;  5FZZ A;  3A22 A;  1RG8 A;  1DLL A;  3IM7 A;  2VUA A;  5DUY A;  3T8S A;  3LV4 A;  1JLY A;  1K5V A;  1S0D A;  3QEE A;  2D1Z A;  2LIE A;  4COT A;  4MZH A;  4Q9P A;  3OBR A;  3QZ4 A;  1DIW A;  3O49 A;  1IT0 A;  1EV2 A;  2KH2 A;  3OM2 A;  1WL7 A;  1R8N A;  5GLK A;  1HWN B;  3NBE A;  2YFR A;  3SNV A;  3FGM A;  3UD9 A;  1DFC A;  4OWJ A;  5FZU A;  2FGF A;  2AQZ A;  1AVU A;  2VSE A;  4P0K A;  3TC2 A;  1Y9M A;  4HR6 C;  1PWA A;  2F8X C;  2FFU A;  1T9F A;  4I37 A;  5F8Y A;  1VKD A;  4FVV A;  1JT7 A;  2Y9G A;  1GGP B;  2VLC A;  4JP0 A;  3ZC8 A;  4I4Y A;  3Q7Y A;  3P6I A;  3U14 A;  1FGA A;  3PIJ A;  1WBC A;  4AN6 A;  4I96 A;  4D47 A;  4I4X A;  2DS0 A;  3FJ8 A;  1M16 A;  1GYE B;  2FDB M;  3K1U A;  3O4O A;  3FJE A;  3AKF A;  4XFS A;  4EEE B;  3O3Q A;  1ISY A;  3WA1 A;  3U75 A;  1J0S A;  4END A;  2AAI B;  1AXM A;  1KNM A;  2MIB A;  4USP A;  2QQW A;  4O8P A;  3F1R A;  3R4Z A;  2D43 A;  3K1X A;  4AN7 B;  3KST A;  2AFG A;  5A8D A;  3AH2 A;  2NYY A;  2X8S A;  4ISQ A;  1Z0H A;  4EFR A;  1QXM A; 
#chains in the Genus database with same CATH homology
 1AFC A;  4QKR A;  3C7O A;  3A07 A;  2ZR1 B;  5B6T A;  5C0P A;  1TOO A;  1PC8 B;  3PG0 A;  1TWE A;  1S0F A;  3MAL A;  1DJS B;  3BTA A;  4PC4 A;  1MC9 A;  3D60 A;  5A7V B;  4IZE A;  1AVA C;  3UGG A;  5D63 A;  1IOB A;  41BI A;  5BXS A;  1FWU A;  4KMI A;  4GOY A;  4ZOT A;  4MZF B;  5F90 A;  1AVW B;  4H04 A;  3AKI A;  1T4Q A;  1I1E A;  3BAO A;  1Y4W A;  1HCE A;  2YFS A;  3UDA A;  4XFU A;  2VXR A;  5FIX A;  3BA7 A;  3OJM A;  4ISR A;  3LDK A;  3FJA A;  3FJB A;  3FJC A;  4UDI A;  1QQK A;  3IAG C;  1HKN A;  3AH1 A;  3RMX A;  3R4S A;  4KEI A;  3LF7 A;  3CRH A;  1M2T B;  2QN4 A;  4G9M A;  1W3F A;  3OJ2 A;  4QO3 A;  4JRA A;  3WAU A;  3H6R B;  3N7J A;  3N7K A;  2HW9 A;  4I8M A;  5GLN A;  2D23 A;  2D7R A;  4D0T A;  1K5U A;  2R9K B;  2NM1 A;  4IZX A;  3AKH A;  1BFC A;  3ZXJ A;  3FJJ A;  3ZXD A;  4XKI A;  1WBA A;  3V0B A;  1OYG A;  2K8R A;  1PZZ A;  3C9Z A;  1ISW A;  2QYI B;  4G6J A;  4I4U A;  1W18 A;  5JOZ A;  3BAV A;  2ET2 A;  2HWM A;  2BEA A;  1FWV A;  3WO4 A;  5DSS B;  3WN2 A;  1DZC A;  3CA3 A;  3O5W B;  4KC3 A;  5BOW A;  1IRP A;  1HIB A;  4DEP A;  4U6D A;  3BAD A;  4LO3 A;  2KLL A;  4N2Z A;  1S0L A;  2D20 A;  3O4A A;  4GAI A;  1BLA A;  4FFG A;  3VT0 A;  1BFF A;  1ISZ A;  4KC8 A;  1JT5 A;  3QED A;  2AXM A;  4Z9W B;  2VDT A;  1JT4 A;  3WN1 A;  3CU1 B;  1BA7 A;  1MD6 A;  2WBC A;  1WD3 A;  3VSS A;  5B2H A;  2AEY A;  3ZX7 A;  3FUO A;  2DRE A;  3ZC9 A;  3W9T A;  4QBV A;  1W2T A;  4Q91 A;  4IY9 A;  3EF2 A;  3P53 A;  1JT3 A;  3BX1 C;  3BRF A;  1HWO B;  2VSA A;  2WRY A;  4EKX B;  3JUT A;  5BXT A;  3H6S E;  3N7L A;  3RTJ B;  3BYK A;  4L4I A;  2Z48 A;  4O8N A;  3PME A;  3CA4 A;  4KC7 A;  4L4H A;  4I4P A;  3S8K A;  3OGG A;  3NBC A;  4LO3 C;  3OGF A;  4LO0 A;  4OEE A;  4D8H A;  4UDJ A;  5FK8 A;  3ZXK A;  2NS2 A;  4JQ0 A;  1UPS A;  4I0Y A;  2UUS A;  4AK5 A;  4F83 A;  2P23 A;  4UDK A;  2HZ9 A;  1GYD B;  2BEB A;  2Z49 A;  1II4 A;  1RML A;  5JOX A;  3QEF A;  1ONK B;  3S8J A;  2QQU A;  4I3N A;  4QKS A;  3P2N A;  3BAQ A;  31BI A;  1Y9G A;  5EHA A;  1E0O A;  2X8F A;  3BYN A;  4FFF A;  3HOM A;  1IRA X;  2MC2 A;  5GLO A;  1FV2 A;  3LEM A;  1ABR B;  2NZ9 A;  5AYE A;  4OWK A;  1W3G A;  4IHZ A;  4ZGR B;  3BAG A;  1YRZ A;  4GP0 A;  2GZB A;  7I1B A;  2XOA A;  1Z4S A;  4LO1 A;  2YUG A;  1CVS A;  1DQO A;  4J2S A;  1AVX B;  2ADE A;  4I6I A;  1RY7 A;  1ITB A;  1S0B A;  4X3A A;  2Y9W C;  3O4C A;  4IQP A;  5FMD A;  1ISV A;  4I4S A;  4H9W A;  5BQU A;  5FMB A;  3WO2 A;  3PHZ A;  1YI7 A;  2HWA A;  1XYF A;  3WMY A;  2K43 A;  1BFB A;  4J2K A;  3QC2 A;  4I4R A;  4LO8 B;  2Q9X A;  4X39 A;  3UJ0 A;  3I29 B;  1FMZ A;  3AJ5 A;  3JRR A;  3POK A;  4HA2 A;  3C2U A;  1XHB A;  3V0B B;  4LO1 C;  3VUO A;  1ST8 A;  4DEN A;  1BLD A;  3SC7 X;  1PUM B;  5FZY A;  3QYD A;  3C7H A;  3BAU A;  4ION A;  4MZG B;  5FNX A;  5FKB A;  4DCK C;  2X2S A;  1RZO B;  4EFP A;  3LIG A;  3BA4 A;  3UJ4 A;  5D61 A;  2QQV A;  5GLM A;  3VSR A;  2AC1 A;  3OM4 A;  5GLQ A;  1Q1U A;  3HAL A;  5BQU C;  3WAS A;  1TWM A;  1W3A A;  4MLG A;  1R8O A;  3WPY A;  4KEJ A;  2X8T A;  5BVP I;  3IM5 A;  3LTQ A;  1IIL A;  4G9N A;  3VSF A;  3C7F A;  5DZU A;  4ZFY B;  1V6X A;  3VT1 A;  3D5Z A;  4EB2 B;  4PVI A;  4GAF A;  4AK7 A;  5EG6 C;  5GAQ A;  5FNW A;  5AYC A;  4PVA A;  2IWT B;  3CAH A;  4R6U B;  3I2X A;  2AEZ A;  2RQ9 A;  3FJK A;  1V6V A;  1EYL A;  3OBT A;  4H75 A;  4LO7 B;  5AY9 A;  4OEF A;  1JLX A;  3UD7 A;  5HPZ A;  1DZD A;  1ISX A;  1ILR 1;  5JOY A;  1L2H A;  3R4U A;  4JKQ A;  1VCL A;  1S0E A;  2IHO A;  4XFT A;  3AKG A;  5BXR A;  4FFH A;  4J2Y A;  4D0Z A;  3WIN A;  1I1B A;  1WD4 A;  4X38 A;  5DVH A;  3CU9 A;  3FFZ A;  5F8W A;  2D7I A;  3O4D A;  3MPP G;  3HMY A;  2OXB A;  2FFV A;  1YXW A;  4ZFW B;  2LIQ A;  3PUB A;  4TLP A;  2K4A B;  2X2T A;  4I1E A;  5F8S A;  3VEQ A;  8I1B A;  4G6M A;  2FO1 A;  2P39 A;  5ANN A;  4JKX B;  4ONZ A;  1YBI A;  3FJH A;  2I1B A;  1EVT A;  3RSJ A;  1AF9 A;  2RG9 B;  2ADD A;  4N1I A;  3HN1 A;  3I2A A;  4UDG A;  5I1B A;  3BAH A;  3VWC A;  1V6W A;  3O4B A;  1SZ6 B;  3NJ5 A;  2F2F A;  3HSM A;  2KKI A;  1IHK A;  1TTU A;  4I4O A;  3OM6 A;  2L5X A;  3Q7X A;  1XZZ A;  3WIN C;  1P63 A;  3AH4 A;  3WPZ A;  4OEG A;  4ZFU B;  3CA6 A;  4OUJ A;  2EXJ A;  1G82 A;  3FJI A;  2Q3N B;  1FQ9 A;  3V0A B;  3R67 A;  2KI4 A;  3AJ6 A;  3O44 A;  4JAW A;  3VSZ A;  4EFQ A;  2VU9 A;  2B4W A;  1JTC A;  3WMZ A;  4AK6 A;  4I4Q A;  4LO7 C;  2NP0 A;  1JY0 A;  1HCD A;  3KF3 A;  3LLP A;  5FKC A;  2F2F C;  3CA1 A;  3BRD A;  1BAS A;  3HBW A;  3WPV A;  1G9A A;  4P6A A;  1G9D A;  4UDK E;  3IIR A;  4LO0 C;  5BP5 A;  1N4K A;  2XQR A;  1DQG A;  2BFH A;  4J23 B;  3BRG C;  5BXP A;  1XG6 A;  3CRG A;  4GOV A;  3V0A A;  3BB2 A;  1TP0 A;  1UYP A;  5G00 A;  3UGF A;  2DRZ A;  4IY8 A;  1HWM B;  1YYN A;  4A7K A;  3FJF A;  3UGH A;  4HJJ A;  1IJT A;  2EXH A;  4KCA A;  4NOV A;  2KI6 B;  3FUQ A;  1A8D A;  9ILB A;  4GP3 A;  4P0L A;  4N2R A;  3V79 C;  1G9B A;  1FV3 A;  21BI A;  3LDR A;  1HWP B;  1V6U A;  3RWK X;  4I4V A;  4II0 A;  1NZK A;  4A7Z A;  3WMV A;  5BP5 C;  3CRI A;  1EPW A;  4CJM A;  2ZQN A;  2ESU A;  5B6S A;  5FMC A;  4I1B A;  4QD2 B;  3D61 A;  1QQL A;  3ZXL A;  3C7E A;  5GLL A;  4P0J A;  4EQV A;  2J3P A;  4I7I A;  4F34 A;  4USO A;  3ILA A;  1FN0 A;  3UD8 A;  3B9U A;  4QBC A;  4A7Y A;  3WPU A;  1TIE A;  3E8L C;  4IYB A;  4JPZ A;  3N0K A;  4N4B A;  5GLR A;  4O8O A;  1SR4 A;  4G1R A;  3TAW A;  3LIH A;  3KF5 A;  5D62 A;  5GLP A;  5A8C A;  2ERM A;  1YF8 B;  1GYH A;  4KCB A;  3CA0 A;  3FJD A;  1F31 A;  2GO2 A;  2M49 A;  2Y9F A;  4FGF A;  2EXK A;  3H6Q A;  1OQL B;  1CE7 B;  3NBD A;  3C7G A;  3OM7 A;  5EC5 A;  4LO2 A;  1Q04 A;  4FFI A;  5JMC A;  4QQS A;  3LFI A;  2YFT A;  3NBN A;  3F62 B;  3BYJ A;  5A7V A;  2RST A;  1S0C A;  1YTO A;  2D22 A;  3QR5 A;  3N7M A;  3WO3 A;  1PT2 A;  5FK7 A;  3RTI B;  4X37 A;  4Z8S B;  1Y7B A;  2Y9X E;  2VXT I;  4OWL A;  3WAT A;  1SR4 C;  3AZW A;  2NVH A;  3ZXG A;  5JOW A;  2DRY A;  4UY4 A;  3BA5 A;  2D44 A;  2E4M A;  5JLV A;  3A21 A;  4ZA3 B;  1UV4 A;  3WN0 A;  4KBB A;  4I2S A;  1Z2V A;  3A23 A;  4OW4 A;  1PUU B;  2NTD A;  4QD2 C;  5E24 E;  4LO2 C;  1JQZ A;  3H6R A;  3D5Y A;  2D24 A;  2MLL B;  4ZLB B;  2EXI A;  4YOL A;  3VT2 A;  1G9C A;  3R4Y A;  4WBC A;  4J2X A;  6I1B A;  1D0H A;  1FMM S;  1TFM B;  4KEK A;  1BAR A;  3OJV A;  4ZBV B;  3KMV A;  1DFQ A;  1YIF A;  3NQH A;  3CA5 A;  4ZKT B;  1BFG A;  3P6J A;  2ZQO A;  3RMY A;  3CQA A;  4QAL A;  4Q9G A;  3WMU A;  5FLW A;  2E4M C;  3AZV A;  3Q7W A;  3D7W B;  1S0G A;  3OM5 A;  5AYD A;  3BYL A;  4U6B A;  3FJ9 A;  1NUN A;  3PIG A;  4QC4 A;  1Q03 A;  3IM6 A;  5FZZ A;  3A22 A;  1RG8 A;  1DLL A;  3IM7 A;  2VUA A;  5DUY A;  3T8S A;  3LV4 A;  1JLY A;  1K5V A;  1S0D A;  3QEE A;  2D1Z A;  2LIE A;  4COT A;  4MZH A;  4Q9P A;  3OBR A;  3QZ4 A;  1DIW A;  3O49 A;  1IT0 A;  1EV2 A;  2KH2 A;  3OM2 A;  1WL7 A;  1R8N A;  5GLK A;  1HWN B;  3NBE A;  2YFR A;  3SNV A;  3FGM A;  3UD9 A;  1DFC A;  4OWJ A;  5FZU A;  2FGF A;  2AQZ A;  1AVU A;  2VSE A;  4P0K A;  3TC2 A;  1Y9M A;  4HR6 C;  1PWA A;  2F8X C;  2FFU A;  1T9F A;  4I37 A;  5F8Y A;  1VKD A;  4FVV A;  1JT7 A;  2Y9G A;  1GGP B;  2VLC A;  4JP0 A;  3ZC8 A;  4I4Y A;  3Q7Y A;  3P6I A;  3U14 A;  1FGA A;  3PIJ A;  1WBC A;  4AN6 A;  4I96 A;  4D47 A;  4I4X A;  2DS0 A;  3FJ8 A;  1M16 A;  1GYE B;  2FDB M;  3K1U A;  3O4O A;  3FJE A;  3AKF A;  4XFS A;  4EEE B;  3O3Q A;  1ISY A;  3WA1 A;  3U75 A;  1J0S A;  4END A;  2AAI B;  1AXM A;  1KNM A;  2MIB A;  4USP A;  2QQW A;  4O8P A;  3F1R A;  3R4Z A;  2D43 A;  3K1X A;  4AN7 B;  3KST A;  2AFG A;  5A8D A;  3AH2 A;  2NYY A;  2X8S A;  4ISQ A;  1Z0H A;  4EFR A;  1QXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...