3VSZA

Crystal structure of ct1,3gal43a in complex with galactan
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 131
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vszA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vszA01
3IIRA 3OM4A 1RG8A 4L4HA 5D62A 2DS0A 1WBCA 2OXBA 2Z48A 3LDRA 2HWAA 3C7FA 3AJ5A 3OBRA 4PC4A 3AZVA 3UD8A 1UV4A 1RY7A 4U6DA 4HA2A 1G82A 3VSFA 3D5YA 4YOLA 3R4UA 4IHZA 1RZOB 3WPUA 2XQRA 4QO3A 1FQ9A 3HSMA 3KMVA 2QN4A 3PG0A 3K1XA 3N7JA 4G9MA 4JKQA 2M49A 1BLDA 2ADDA 1Y4WA 5HPZA 3UJ4A 4EKXB 3WMYA 4JQ0A 1Z0HA 4GP0A 5B6TA 1Z4SA 5AYDA 1FMMS 3CA1A 3LTQA 1AF9A 21BIA 3CA4A 4OEEA 4ZKTB 2AFGA 3LIHA 2KI6B 2AEYA 1IHKA 2J3PA 2NZ9A 5G00A 2DRZA 2GO2A 3AH4A 4X38A 4KC8A 1D0HA 4OW4A 5D63A 3BAQA 3PIGA 3NBDA 1JLYA 4OEGA 3P53A 3WO4A 3CQAA 5BXPA 2ADEA 3U14A 2Y9XE 4ZOTA 3BYLA 2F8XC 4ISQA 3FGMA 1JLXA 3BADA 5FMCA 2D24A 2X8FA 2F2FC 3WO3A 1HCEA 3BA7A 2LIQA 1TWEA 5FMDA 1NZKA 1PZZA 3BRDA 4UDGA 3CA6A 1HCDA 4JPZA 2X8SA 2NYYA 1G9CA 2B4WA 1TIEA 3A23A 1V6VA 3VSRA 3V79C 2ET2A 3FJAA 1OYGA 1EPWA 4OEFA 4IZXA 4AN7B 2YFRA 4KC7A 4I37A 4EFRA 4NOVA 3V0BB 1SZ6B 2X8TA 4Z9WB 3C2UA 3FJ8A 4F34A 4D8HA 3R4SA 1Q03A 1S0CA 3K1UA 3ZC9A 2F2FA 1BFCA 1DFQA 3V0BA 2P39A 5AYEA 2BEAA 2Y9FA 4XKIA 3BTAA 3OGGA 3VEQA 1M16A 2NM1A 1J0SA 4I4OA 3E8LC 5JOXA 4GAIA 1KNMA 1HWPB 2KI4A 1DZDA 1YBIA 1P63A 2I1BA 2WRYA 3H6SE 4KCAA 3LFIA 1PUMB 3WINA 1DIWA 4P0JA 1GYDB 1FWUA 1I1BA 4DCKC 1MC9A 2YUGA 3S8JA 5GLNA 3OGFA 1MD6A 3CRHA 2EXHA 1ILR1 2RSTA 3Q7WA 1ISYA 4JAWA 1QQKA 3O3QA 4XFUA 3WMUA 4J2XA 4ZGRB 1BASA 3O5WB 3NBNA 1WL7A 1FV3A 2P23A 3BAHA 4OWJA 3T8SA 3WA1A 1BARA 3QC2A 3NQHA 1DQOA 4KEKA 1R8NA 4FVVA 1ISZA 4AK7A 1PC8B 3QR5A 3OJ2A 4LO2C 5BXTA 1UYPA 5FK8A 4KC3A 5DVHA 4A7KA 1JT4A 3RWKX 4EFQA 5DUYA 3P2NA 4KMIA 1JY0A 2D1ZA 3LLPA 1PT2A 2D22A 3PIJA 3SNVA 3VWCA 5JOZA 1UPSA 3BYNA 3PHZA 4G6JA 4O8OA 3OBTA 1L2HA 4LO0C 3ZXDA 4EEEB 3LIGA 1YTOA 3TC2A 3JUTA 4GOVA 1N4KA 4IZEA 4IONA 1FV2A 4Q9PA 1S0EA 1ISXA 4I96A 5EC5A 2ERMA 5I1BA 2KLLA 5GLOA 1BFBA 2ZR1B 1F31A 3D5ZA 4I1EA 3C7GA 3WPYA 5F8WA 4I4UA 2MIBA 3ZXLA 4JRAA 1SR4A 3VSSA 4ZFYB 4ZBVB 1AVWB 5BQUA 3QEEA 4I6IA 4LO0A 5AYCA 5C0PA 5JLVA 2QQWA 3CA0A 3FFZA 4FFFA 3WATA 1Y9MA 3IM7A 1EV2A 1NUNA 4P0LA 4COTA 1TWMA 1WBAA 2EXJA 3NJ5A 3MPPG 4LO1C 5FZUA 4WBCA 3IAGC 3IM5A 4O8PA 2Y9GA 5DZUA 1BFGA 4L4IA 1S0GA 3WPZA 2NTDA 1IRPA 7I1BA 1HWMB 1YXWA 4XFSA 1IRAX 1W3AA 3AKHA 3N7MA 1AXMA 3HALA 3BYKA 3O4DA 1Y7BA 1TOOA 8I1BA 1JQZA 4Z8SB 2HZ9A 3CU1B 4A7YA 1E0OA 1XZZA 3R67A 4QKRA 1S0FA 3OM7A 4D47A 2UUSA 1FMZA 3BRGC 3BRFA 2MC2A 2DREA 1FN0A 2HW9A 3OJVA 2YFSA 1BLAA 1AFCA 1BA7A 2HWMA 4I4QA 2X2SA 3HOMA 4LO1A 2E4MC 3ZC8A 5A8CA 3LV4A 4R6UB 3RTIB 3Q7XA 4LO7C 4PVIA 1HWOB 1YIFA 3CA3A 3C7HA 1JT7A 1V6UA 3F1RA 4FFIA 3OM6A 2QQUA 2RG9B 3UGHA 3FJFA 1GGPB 3A07A 4FFHA 4MLGA 2AAIB 3AKGA 5FIXA 4JP0A 3FJBA 3CU9A 4XFTA 3BAOA 5B6SA 3BX1C 1BFFA 2FFUA 4IY9A 2Y9WC 2QYIB 3WN1A 3CAHA 1RMLA 2D44A 4X37A 1IOBA 1HWNB 3ZX7A 3RMXA 2R9KB 4J23B 1HKNA 2VUAA 5FNXA 4I4RA 3P6IA 5BP5C 1GYEB 3EF2A 3FJEA 2NP0A 3N7LA 1W18A 3N0KA 1I1EA 2NVHA 4U6BA 3TAWA 4KEJA 5E24E 4I4PA 1WD4A 1S0BA 4CJMA 4F83A 3KF5A 1ISWA 1AVAC 4A7ZA 4GOYA 1W2TA 4G1RA 1QXMA 2GZBA 4I0YA 2VU9A 4N4BA 1ONKB 3W9TA 1G9AA 4I4SA 2EXIA 2AC1A 4I4XA 3LEMA 3BA4A 5EG6C 4ZLBB 2XOAA 4HJJA 2VLCA 3QEFA 1V6XA 5BP5A 1JT5A 2FFVA 3RSJA 1JTCA 3O4CA 4GAFA 3A22A 4X39A 1YI7A 4QKSA 3NBCA 5DSSB 3RMYA 2BFHA 3D7WB 31BIA 5FKCA 1JT3A 1DZCA 1OQLB 2DRYA 1IJTA 3AKFA 4QBCA 3JRRA 2VDTA 3WPVA 3U75A 3O44A 3POKA 5GAQA 5BOWA 3PMEA 3OM5A 2QQVA 4Q9GA 3O4OA 2Z49A 5GLLA 4EB2B 1ITBA 3I2XA 4FFGA 4IY8A 3OJMA 4PVAA 4LO2A 3UGFA 3FJCA 5JOYA 1W3FA 3ZXJA 4I3NA 3UD9A 2KKIA 1AVUA 3VSZA 1DFCA 2VSEA 3C9ZA 2IHOA 1XG6A 1K5UA 3IM6A 4USOA 4FGFA 5BXSA 2X2TA 1YRZA 2ESUA 3FJJA 4UDJA 3VUOA 3QYDA 3FJIA 4AK5A 1VKDA 1Q1UA 1YF8B 3O4AA 3ILAA 2AXMA 3BA5A 3OM2A 3HBWA 4ZFUB 4II0A 1IT0A 5BVPI 4Q91A 3C7EA 1W3GA 2D20A 4KCBA 4N2RA 1DJSB 4EFPA 3D60A 3WAUA 1K5VA 4QBVA 2K43A 2K4AB 3AH1A 4GP3A 2D7RA 5JMCA 2D43A 4LO3C 5AY9A 1V6WA 5FZZA 1TFMB 4HR6C 2AEZA 1PUUB 2YFTA 4D0TA 1Q04A 4IYBA 3F62B 5F8YA 3ZXKA 3P6JA 3WN0A 4G9NA 2KH2A 41BIA 2LIEA 5GLQA 1HIBA 5GLPA 3R4ZA 4QQSA 3O4BA 4I7IA 5A7VB 3O49A 2IWTB 2FGFA 4X3AA 3H6RB 3FJ9A 3BAUA 5FNWA 4IQPA 4QC4A 1II4A 2VXRA 2ZQNA 3R4YA 4N2ZA 1M2TB 5A7VA 3QZ4A 1AVXB 3WMVA 1T9FA 4QALA 3H6RA 4LO3A 3UDAA 4JKXB 1GYHA 4I1BA 5FLWA 3HMYA 4UDIA 4O8NA 2VSAA 1G9BA 1TTUA 4OWLA 3KSTA 3BB2A 2FO1A 3LF7A 2VXTI 4DENA 3BYJA 4LO7B 3BAGA 3WN2A 3H6QA 4ZFWB 3CRGA 5GLMA 5F90A 1Y9GA 5FK7A 1YYNA 2ZQOA 3WINC 2Q9XA 5D61A 2E4MA 4G6MA 3V0AB 1R8OA 4OWKA 3B9UA 2Q3NB 1TP0A 5EHAA 3AJ6A 4OUJA 5F8SA 1PWAA 3RTJB 3V0AA 1ISVA 1T4QA 1S0DA 1DQGA 3FJDA 2BEBA 3HN1A 4ISRA 3SC7X 3AH2A 3I29B 3UGGA 4AK6A 4N1IA 1S0LA 3VT2A 2D7IA 3VT0A 1EVTA 3FUQA 4USPA 3UD7A 4LO8B 3Q7YA 4H04A 3S8KA 4UDKE 4EQVA 4UDKA 3N7KA 3AZWA 3ZXGA 9ILBA 4H9WA 2FDBM 4J2KA 3WASA 2D23A 3VT1A 3LDKA 4I4YA 3BAVA 1G9DA 4ONZA 1IILA 3A21A 3AKIA 4J2YA 5GLKA 1ABRB 4I8MA 5A8DA 1CVSA 5FMBA 1XYFA 1DLLA 4J2SA 1VCLA 4AN6A 2AQZA 1FWVA 1ST8A 4DEPA 3FJKA 3PUBA 3C7OA 4I2SA 4QD2C 3NBEA 4P6AA 3CRIA 1EYLA 3FJHA 5FKBA 3UJ0A 3WO2A 4P0KA 3I2AA 4TLPA 3D61A 5B2HA 1Z2VA 3FUOA 3KF3A 6I1BA 2EXKA 5BXRA 1A8DA 2K8RA 3MALA 1FGAA 1QQLA 1SR4C 4ZA3B 4I4VA 4KBBA 5FZYA 5ANNA 5GLRA 1XHBA 2L5XA 5BQUC 1WD3A 2WBCA 5JOWA 4QD2B 3CA5A 4KEIA 4D0ZA 3WMZA 4ENDA 1CE7B 3QEDA 2RQ9A 2MLLB
chains in the Genus database with same CATH superfamily
3IIRA 3OM4A 1RG8A 4L4HA 5D62A 2DS0A 1WBCA 2OXBA 2Z48A 3LDRA 2HWAA 3C7FA 3AJ5A 3OBRA 4PC4A 3AZVA 3UD8A 1UV4A 1RY7A 4U6DA 4HA2A 1G82A 3VSFA 3D5YA 4YOLA 3R4UA 4IHZA 1RZOB 3WPUA 2XQRA 4QO3A 1FQ9A 3HSMA 3KMVA 2QN4A 3PG0A 3K1XA 3N7JA 4G9MA 4JKQA 2M49A 1BLDA 2ADDA 1Y4WA 5HPZA 3UJ4A 4EKXB 3WMYA 4JQ0A 1Z0HA 4GP0A 5B6TA 1Z4SA 5AYDA 1FMMS 3CA1A 3LTQA 1AF9A 21BIA 3CA4A 4OEEA 4ZKTB 2AFGA 3LIHA 2KI6B 2AEYA 1IHKA 2J3PA 2NZ9A 5G00A 2DRZA 2GO2A 3AH4A 4X38A 4KC8A 1D0HA 4OW4A 5D63A 3BAQA 3PIGA 4H75A 3NBDA 1JLYA 4OEGA 3P53A 3WO4A 3CQAA 5BXPA 2ADEA 3U14A 2Y9XE 4ZOTA 3BYLA 2F8XC 4ISQA 3FGMA 1JLXA 4MZHA 3BADA 5FMCA 2D24A 2X8FA 2F2FC 3WO3A 1HCEA 3BA7A 2LIQA 1TWEA 5FMDA 1NZKA 1PZZA 3BRDA 4UDGA 3CA6A 1HCDA 4JPZA 2X8SA 2NYYA 1G9CA 2B4WA 1TIEA 3A23A 1V6VA 3VSRA 3V79C 2ET2A 3FJAA 1OYGA 1EPWA 4OEFA 4IZXA 4AN7B 2YFRA 4KC7A 4I37A 4EFRA 4NOVA 3V0BB 1SZ6B 2X8TA 4Z9WB 3C2UA 3FJ8A 4F34A 4D8HA 3R4SA 1Q03A 1S0CA 3K1UA 3ZC9A 2F2FA 1BFCA 1DFQA 3V0BA 2P39A 5AYEA 2BEAA 2Y9FA 4XKIA 3BTAA 3OGGA 3VEQA 1M16A 2NM1A 1J0SA 4I4OA 3E8LC 5JOXA 4GAIA 1KNMA 1HWPB 2KI4A 1DZDA 1YBIA 1P63A 2I1BA 2WRYA 3H6SE 4KCAA 3LFIA 1PUMB 3WINA 1DIWA 4P0JA 1GYDB 1FWUA 1I1BA 4DCKC 1MC9A 2YUGA 3S8JA 5GLNA 3OGFA 1MD6A 3CRHA 2EXHA 1ILR1 2RSTA 3Q7WA 1ISYA 4JAWA 1QQKA 3O3QA 4XFUA 3WMUA 4J2XA 4ZGRB 1BASA 3O5WB 3NBNA 1WL7A 1FV3A 2P23A 3BAHA 4OWJA 3T8SA 3WA1A 1BARA 3QC2A 3NQHA 1DQOA 4KEKA 1R8NA 4FVVA 1ISZA 4AK7A 1PC8B 3QR5A 3OJ2A 4LO2C 5BXTA 1UYPA 5FK8A 4KC3A 5DVHA 4A7KA 1JT4A 3RWKX 4EFQA 5DUYA 3P2NA 4KMIA 1JY0A 2D1ZA 3LLPA 1PT2A 2D22A 3PIJA 4MZFB 3SNVA 3VWCA 5JOZA 1UPSA 3BYNA 3PHZA 4G6JA 4O8OA 3OBTA 1L2HA 4LO0C 3ZXDA 4EEEB 3LIGA 1YTOA 3TC2A 3JUTA 4GOVA 1N4KA 4IZEA 4IONA 1FV2A 4Q9PA 1S0EA 1ISXA 4I96A 5EC5A 2ERMA 5I1BA 2KLLA 5GLOA 1BFBA 2ZR1B 1F31A 3D5ZA 4I1EA 3C7GA 3WPYA 5F8WA 4I4UA 2MIBA 3ZXLA 4JRAA 1SR4A 3VSSA 2NS2A 4ZFYB 4ZBVB 1AVWB 5BQUA 3QEEA 4I6IA 4LO0A 5AYCA 5C0PA 5JLVA 2QQWA 3CA0A 3FFZA 4FFFA 3WATA 1Y9MA 3IM7A 1EV2A 1NUNA 4P0LA 4COTA 1TWMA 1WBAA 2EXJA 3NJ5A 3MPPG 4LO1C 5FZUA 4WBCA 3IAGC 3IM5A 4O8PA 2Y9GA 5DZUA 1BFGA 4L4IA 1S0GA 3WPZA 2NTDA 1IRPA 7I1BA 1HWMB 1YXWA 4XFSA 1IRAX 1W3AA 3AKHA 3N7MA 1AXMA 3HALA 3BYKA 3O4DA 1Y7BA 1TOOA 8I1BA 1JQZA 4Z8SB 2HZ9A 3CU1B 4A7YA 1E0OA 1XZZA 3R67A 4QKRA 1S0FA 3OM7A 4D47A 2UUSA 1FMZA 3BRGC 3BRFA 2MC2A 2DREA 1FN0A 2HW9A 3OJVA 1TL2A 2YFSA 1BLAA 1AFCA 1BA7A 2HWMA 4I4QA 2X2SA 3HOMA 4LO1A 2E4MC 3ZC8A 5A8CA 3LV4A 4R6UB 3RTIB 3Q7XA 4LO7C 4PVIA 1HWOB 1YIFA 3CA3A 3C7HA 1JT7A 1V6UA 3F1RA 4FFIA 3OM6A 2QQUA 2RG9B 3UGHA 3FJFA 1GGPB 3A07A 4FFHA 4MLGA 2AAIB 3AKGA 5FIXA 4JP0A 3FJBA 3CU9A 4XFTA 3BAOA 5B6SA 3BX1C 1BFFA 2FFUA 4IY9A 2Y9WC 2QYIB 3WN1A 3CAHA 1RMLA 2D44A 4X37A 1IOBA 1HWNB 3ZX7A 3RMXA 2R9KB 4J23B 1HKNA 2VUAA 5FNXA 4I4RA 3P6IA 4UY4A 5BP5C 1GYEB 3EF2A 3FJEA 2NP0A 3N7LA 1W18A 3N0KA 1I1EA 2NVHA 4U6BA 3TAWA 4KEJA 5E24E 4I4PA 1WD4A 1S0BA 4CJMA 4F83A 3KF5A 1ISWA 1AVAC 4A7ZA 4GOYA 1W2TA 4G1RA 1QXMA 2GZBA 4I0YA 2VU9A 4N4BA 1ONKB 3W9TA 1G9AA 4I4SA 2EXIA 2AC1A 4I4XA 3LEMA 3BA4A 5EG6C 4ZLBB 2XOAA 4HJJA 2VLCA 3QEFA 1V6XA 5BP5A 1JT5A 2FFVA 3RSJA 1JTCA 3O4CA 4GAFA 3A22A 4X39A 1YI7A 4QKSA 3NBCA 5DSSB 3RMYA 2BFHA 3D7WB 31BIA 5FKCA 1JT3A 1DZCA 1OQLB 2DRYA 1IJTA 3AKFA 4QBCA 3JRRA 2VDTA 3WPVA 3U75A 3O44A 3POKA 5GAQA 5BOWA 3PMEA 3OM5A 2QQVA 4Q9GA 3O4OA 2Z49A 5GLLA 4EB2B 1ITBA 3I2XA 4FFGA 4IY8A 3OJMA 4PVAA 4LO2A 3UGFA 3FJCA 5JOYA 1W3FA 3ZXJA 4I3NA 3UD9A 2KKIA 1AVUA 3VSZA 1DFCA 2VSEA 3C9ZA 2IHOA 1XG6A 1K5UA 3IM6A 4USOA 4FGFA 5BXSA 2X2TA 1YRZA 2ESUA 3FJJA 4UDJA 3VUOA 3QYDA 3FJIA 4AK5A 1VKDA 1Q1UA 1YF8B 3O4AA 3ILAA 2AXMA 3BA5A 3OM2A 3HBWA 4ZFUB 4II0A 1IT0A 5BVPI 4Q91A 3C7EA 1W3GA 2D20A 4KCBA 4N2RA 4MZGB 1DJSB 4EFPA 3D60A 3WAUA 1K5VA 4QBVA 2K43A 2K4AB 3AH1A 4GP3A 2D7RA 5JMCA 2D43A 4LO3C 5AY9A 1V6WA 5FZZA 1TFMB 4HR6C 2AEZA 1PUUB 2YFTA 4D0TA 1Q04A 4IYBA 3F62B 5F8YA 3ZXKA 3P6JA 3WN0A 4G9NA 2KH2A 41BIA 2LIEA 5GLQA 1HIBA 5GLPA 3R4ZA 4QQSA 3O4BA 4I7IA 5A7VB 3O49A 2IWTB 2FGFA 4X3AA 3H6RB 3FJ9A 3BAUA 5FNWA 4IQPA 4QC4A 1II4A 2VXRA 2ZQNA 3R4YA 4N2ZA 1M2TB 5A7VA 3QZ4A 1AVXB 3WMVA 1T9FA 4QALA 3H6RA 4LO3A 3UDAA 4JKXB 1GYHA 4I1BA 5FLWA 3HMYA 4UDIA 4O8NA 2VSAA 1G9BA 1TTUA 4OWLA 3KSTA 3BB2A 2FO1A 3LF7A 2VXTI 4DENA 3BYJA 4LO7B 3BAGA 3WN2A 3H6QA 4ZFWB 3CRGA 5GLMA 5F90A 1Y9GA 5FK7A 1YYNA 2ZQOA 3WINC 2Q9XA 5D61A 2E4MA 4G6MA 3V0AB 1R8OA 4OWKA 3B9UA 2Q3NB 1TP0A 5EHAA 3AJ6A 4OUJA 5F8SA 1PWAA 3RTJB 3V0AA 1ISVA 1T4QA 1S0DA 1DQGA 3FJDA 2BEBA 3HN1A 4ISRA 3SC7X 3AH2A 3I29B 3UGGA 4AK6A 4N1IA 1S0LA 3VT2A 2D7IA 3VT0A 1EVTA 3FUQA 4USPA 3UD7A 4LO8B 3Q7YA 4H04A 3S8KA 4UDKE 4EQVA 4UDKA 3N7KA 3AZWA 3ZXGA 9ILBA 4H9WA 2FDBM 4J2KA 3WASA 2D23A 3VT1A 3LDKA 4I4YA 3BAVA 1G9DA 4ONZA 1IILA 3A21A 3AKIA 4J2YA 5GLKA 1ABRB 4I8MA 5A8DA 1CVSA 5FMBA 1XYFA 1DLLA 4J2SA 1VCLA 4AN6A 2AQZA 1FWVA 1ST8A 4DEPA 3FJKA 3PUBA 3C7OA 4I2SA 5C2MA 4QD2C 3NBEA 4P6AA 3CRIA 1EYLA 3FJHA 5FKBA 3UJ0A 3WO2A 4P0KA 3I2AA 4TLPA 3D61A 5B2HA 1Z2VA 3FUOA 3KF3A 6I1BA 2EXKA 5BXRA 1A8DA 2K8RA 3MALA 1FGAA 1QQLA 1SR4C 4ZA3B 4I4VA 4KBBA 5FZYA 5ANNA 5GLRA 1XHBA 2L5XA 5BQUC 1WD3A 2WBCA 5JOWA 4QD2B 3CA5A 4KEIA 4D0ZA 3WMZA 4ENDA 1CE7B 3QEDA 2RQ9A 2MLLB
chains in the Genus database with same CATH topology
3IIRA 3OM4A 1RG8A 4L4HA 5D62A 2DS0A 1WBCA 2OXBA 2Z48A 3LDRA 2HWAA 3C7FA 3AJ5A 3OBRA 4PC4A 3AZVA 3UD8A 1UV4A 1RY7A 4U6DA 4HA2A 1G82A 3VSFA 3D5YA 4YOLA 3R4UA 4IHZA 1RZOB 3WPUA 2XQRA 4QO3A 1FQ9A 3HSMA 3KMVA 2QN4A 3PG0A 3K1XA 3N7JA 4G9MA 4JKQA 2M49A 1BLDA 2ADDA 1Y4WA 5HPZA 3UJ4A 4EKXB 3WMYA 4JQ0A 1Z0HA 4GP0A 5B6TA 1Z4SA 5AYDA 1FMMS 3CA1A 3LTQA 1AF9A 21BIA 3CA4A 4OEEA 4ZKTB 2AFGA 3LIHA 2KI6B 2AEYA 1IHKA 2J3PA 2NZ9A 5G00A 2DRZA 2GO2A 3AH4A 4X38A 4KC8A 1D0HA 4OW4A 5D63A 3BAQA 3PIGA 4H75A 3NBDA 1JLYA 4OEGA 3P53A 3WO4A 3CQAA 5BXPA 2ADEA 3U14A 2Y9XE 4ZOTA 3BYLA 2F8XC 4ISQA 3FGMA 1JLXA 4MZHA 3BADA 5FMCA 2D24A 2X8FA 2F2FC 3WO3A 1HCEA 3BA7A 2LIQA 1TWEA 5FMDA 1NZKA 1PZZA 3BRDA 4UDGA 3CA6A 1HCDA 4JPZA 2X8SA 2NYYA 1G9CA 2B4WA 1TIEA 3A23A 1V6VA 3VSRA 3V79C 2ET2A 3FJAA 1OYGA 1EPWA 4OEFA 4IZXA 4AN7B 2YFRA 4KC7A 4I37A 4EFRA 4NOVA 3V0BB 1SZ6B 2X8TA 4Z9WB 3C2UA 3FJ8A 4F34A 4D8HA 3R4SA 1Q03A 1S0CA 3K1UA 3ZC9A 2F2FA 1BFCA 1DFQA 3V0BA 2P39A 5AYEA 2BEAA 2Y9FA 4XKIA 3BTAA 3OGGA 3VEQA 1M16A 2NM1A 1J0SA 4I4OA 3E8LC 5JOXA 4GAIA 1KNMA 1HWPB 2KI4A 1DZDA 1YBIA 1P63A 2I1BA 2WRYA 3H6SE 4KCAA 3LFIA 1PUMB 3WINA 1DIWA 4P0JA 1GYDB 1FWUA 1I1BA 4DCKC 1MC9A 2YUGA 3S8JA 5GLNA 3OGFA 1MD6A 3CRHA 2EXHA 1ILR1 2RSTA 3Q7WA 1ISYA 4JAWA 1QQKA 3O3QA 4XFUA 3WMUA 4J2XA 4ZGRB 1BASA 3O5WB 3NBNA 1WL7A 1FV3A 2P23A 3BAHA 4OWJA 3T8SA 3WA1A 1BARA 3QC2A 3NQHA 1DQOA 4KEKA 1R8NA 4FVVA 1ISZA 4AK7A 1PC8B 3QR5A 3OJ2A 4LO2C 5BXTA 1UYPA 5FK8A 4KC3A 5DVHA 4A7KA 1JT4A 3RWKX 4EFQA 5DUYA 3P2NA 4KMIA 1JY0A 2D1ZA 3LLPA 1PT2A 2D22A 3PIJA 4MZFB 3SNVA 3VWCA 5JOZA 1UPSA 3BYNA 3PHZA 4G6JA 4O8OA 3OBTA 1L2HA 4LO0C 3ZXDA 4EEEB 3LIGA 1YTOA 3TC2A 3JUTA 4GOVA 1N4KA 4IZEA 4IONA 1FV2A 4Q9PA 1S0EA 1ISXA 4I96A 5EC5A 2ERMA 5I1BA 2KLLA 5GLOA 1BFBA 2ZR1B 1F31A 3D5ZA 4I1EA 3C7GA 3WPYA 5F8WA 4I4UA 2MIBA 3ZXLA 4JRAA 1SR4A 3VSSA 2NS2A 4ZFYB 4ZBVB 1AVWB 5BQUA 3QEEA 4I6IA 4LO0A 5AYCA 5C0PA 5JLVA 2QQWA 3CA0A 3FFZA 4FFFA 3WATA 1Y9MA 3IM7A 1EV2A 1NUNA 4P0LA 4COTA 1TWMA 1WBAA 2EXJA 3NJ5A 3MPPG 4LO1C 5FZUA 4WBCA 3IAGC 3IM5A 4O8PA 2Y9GA 5DZUA 1BFGA 4L4IA 1S0GA 3WPZA 2NTDA 1IRPA 7I1BA 1HWMB 1YXWA 4XFSA 1IRAX 1W3AA 3AKHA 3N7MA 1AXMA 3HALA 3BYKA 3O4DA 1Y7BA 1TOOA 8I1BA 1JQZA 4Z8SB 2HZ9A 3CU1B 4A7YA 1E0OA 1XZZA 3R67A 4QKRA 1S0FA 3OM7A 4D47A 2UUSA 1FMZA 3BRGC 3BRFA 2MC2A 2DREA 1FN0A 2HW9A 3OJVA 2YFSA 1BLAA 1AFCA 1BA7A 2HWMA 4I4QA 2X2SA 3HOMA 4LO1A 2E4MC 3ZC8A 5A8CA 3LV4A 4R6UB 3RTIB 3Q7XA 4LO7C 4PVIA 1HWOB 1YIFA 3CA3A 3C7HA 1JT7A 1V6UA 3F1RA 4FFIA 3OM6A 2QQUA 2RG9B 3UGHA 3FJFA 1GGPB 3A07A 4FFHA 4MLGA 2AAIB 3AKGA 5FIXA 4JP0A 3FJBA 3CU9A 4XFTA 3BAOA 5B6SA 3BX1C 1BFFA 2FFUA 4IY9A 2Y9WC 2QYIB 3WN1A 3CAHA 1RMLA 2D44A 4X37A 1IOBA 1HWNB 3ZX7A 3RMXA 2R9KB 4J23B 1HKNA 2VUAA 5FNXA 4I4RA 3P6IA 4UY4A 5BP5C 1GYEB 3EF2A 3FJEA 2NP0A 3N7LA 1W18A 3N0KA 1I1EA 2NVHA 4U6BA 3TAWA 4KEJA 5E24E 4I4PA 1WD4A 1S0BA 4CJMA 4F83A 3KF5A 1ISWA 1AVAC 4A7ZA 4GOYA 1W2TA 4G1RA 1QXMA 2GZBA 4I0YA 2VU9A 4N4BA 1ONKB 3W9TA 1G9AA 4I4SA 2EXIA 2AC1A 4I4XA 3LEMA 3BA4A 5EG6C 4ZLBB 2XOAA 4HJJA 2VLCA 3QEFA 1V6XA 5BP5A 1JT5A 2FFVA 3RSJA 1JTCA 3O4CA 4GAFA 3A22A 4X39A 1YI7A 4QKSA 3NBCA 5DSSB 3RMYA 2BFHA 3D7WB 31BIA 5FKCA 1JT3A 1DZCA 1OQLB 2DRYA 1IJTA 3AKFA 4QBCA 3JRRA 2VDTA 3WPVA 3U75A 3O44A 3POKA 5GAQA 5BOWA 3PMEA 3OM5A 2QQVA 4Q9GA 3O4OA 2Z49A 5GLLA 4EB2B 1ITBA 3I2XA 4FFGA 4IY8A 3OJMA 4PVAA 4LO2A 3UGFA 3FJCA 5JOYA 1W3FA 3ZXJA 4I3NA 3UD9A 2KKIA 1AVUA 3VSZA 1DFCA 2VSEA 3C9ZA 2IHOA 1XG6A 1K5UA 3IM6A 4USOA 4FGFA 5BXSA 2X2TA 1YRZA 2ESUA 3FJJA 4UDJA 3VUOA 3QYDA 3FJIA 4AK5A 1VKDA 1Q1UA 1YF8B 3O4AA 3ILAA 2AXMA 3BA5A 3OM2A 3HBWA 4ZFUB 4II0A 1IT0A 5BVPI 4Q91A 3C7EA 1W3GA 2D20A 4KCBA 4N2RA 4MZGB 1DJSB 4EFPA 3D60A 3WAUA 1K5VA 4QBVA 2K43A 2K4AB 3AH1A 4GP3A 2D7RA 5JMCA 2D43A 4LO3C 5AY9A 1V6WA 5FZZA 1TFMB 4HR6C 2AEZA 1PUUB 2YFTA 4D0TA 1Q04A 4IYBA 3F62B 5F8YA 3ZXKA 3P6JA 3WN0A 4G9NA 2KH2A 41BIA 2LIEA 5GLQA 1HIBA 5GLPA 3R4ZA 4QQSA 3O4BA 4I7IA 5A7VB 3O49A 2IWTB 2FGFA 4X3AA 3H6RB 3FJ9A 3BAUA 5FNWA 4IQPA 4QC4A 1II4A 2VXRA 2ZQNA 3R4YA 4N2ZA 1M2TB 5A7VA 3QZ4A 1AVXB 3WMVA 1T9FA 4QALA 3H6RA 4LO3A 3UDAA 4JKXB 1GYHA 4I1BA 5FLWA 3HMYA 4UDIA 4O8NA 2VSAA 1G9BA 1TTUA 4OWLA 3KSTA 3BB2A 2FO1A 3LF7A 2VXTI 4DENA 3BYJA 4LO7B 3BAGA 3WN2A 3H6QA 4ZFWB 3CRGA 5GLMA 5F90A 1Y9GA 5FK7A 1YYNA 2ZQOA 3WINC 2Q9XA 5D61A 2E4MA 4G6MA 3V0AB 1R8OA 4OWKA 3B9UA 2Q3NB 1TP0A 5EHAA 3AJ6A 4OUJA 5F8SA 1PWAA 3RTJB 3V0AA 1ISVA 1T4QA 1S0DA 1DQGA 3FJDA 2BEBA 3HN1A 4ISRA 3SC7X 3AH2A 3I29B 3UGGA 4AK6A 4N1IA 1S0LA 3VT2A 2D7IA 3VT0A 1EVTA 3FUQA 4USPA 3UD7A 4LO8B 3Q7YA 4H04A 3S8KA 4UDKE 4EQVA 4UDKA 3N7KA 3AZWA 3ZXGA 9ILBA 4H9WA 2FDBM 4J2KA 3WASA 2D23A 3VT1A 3LDKA 4I4YA 3BAVA 1G9DA 4ONZA 1IILA 3A21A 3AKIA 4J2YA 5GLKA 1ABRB 4I8MA 5A8DA 1CVSA 5FMBA 1XYFA 1DLLA 4J2SA 1VCLA 4AN6A 2AQZA 1FWVA 1ST8A 4DEPA 3FJKA 3PUBA 3C7OA 4I2SA 4QD2C 3NBEA 4P6AA 3CRIA 1EYLA 3FJHA 5FKBA 3UJ0A 3WO2A 4P0KA 3I2AA 4TLPA 3D61A 5B2HA 1Z2VA 3FUOA 3KF3A 6I1BA 2EXKA 5BXRA 1A8DA 2K8RA 3MALA 1FGAA 1QQLA 1SR4C 4ZA3B 4I4VA 4KBBA 5FZYA 5ANNA 5GLRA 1XHBA 2L5XA 5BQUC 1WD3A 2WBCA 5JOWA 4QD2B 3CA5A 4KEIA 4D0ZA 3WMZA 4ENDA 1CE7B 3QEDA 2RQ9A 2MLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIR A;  3OM4 A;  1RG8 A;  4L4H A;  5D62 A;  2DS0 A;  1WBC A;  2OXB A;  2Z48 A;  3LDR A;  2HWA A;  3C7F A;  3AJ5 A;  3OBR A;  4PC4 A;  3AZV A;  3UD8 A;  1UV4 A;  1RY7 A;  4U6D A;  4HA2 A;  1G82 A;  3VSF A;  3D5Y A;  4YOL A;  3R4U A;  4IHZ A;  1RZO B;  3WPU A;  2XQR A;  4QO3 A;  1FQ9 A;  3HSM A;  3KMV A;  2QN4 A;  3PG0 A;  3K1X A;  3N7J A;  4G9M A;  4JKQ A;  2M49 A;  1BLD A;  2ADD A;  1Y4W A;  5HPZ A;  3UJ4 A;  4EKX B;  3WMY A;  4JQ0 A;  1Z0H A;  4GP0 A;  5B6T A;  1Z4S A;  5AYD A;  1FMM S;  3CA1 A;  3LTQ A;  1AF9 A;  21BI A;  3CA4 A;  4OEE A;  4ZKT B;  2AFG A;  3LIH A;  2KI6 B;  2AEY A;  1IHK A;  2J3P A;  2NZ9 A;  5G00 A;  2DRZ A;  2GO2 A;  3AH4 A;  4X38 A;  4KC8 A;  1D0H A;  4OW4 A;  5D63 A;  3BAQ A;  3PIG A;  3NBD A;  1JLY A;  4OEG A;  3P53 A;  3WO4 A;  3CQA A;  5BXP A;  2ADE A;  3U14 A;  2Y9X E;  4ZOT A;  3BYL A;  2F8X C;  4ISQ A;  3FGM A;  1JLX A;  3BAD A;  5FMC A;  2D24 A;  2X8F A;  2F2F C;  3WO3 A;  1HCE A;  3BA7 A;  2LIQ A;  1TWE A;  5FMD A;  1NZK A;  1PZZ A;  3BRD A;  4UDG A;  3CA6 A;  1HCD A;  4JPZ A;  2X8S A;  2NYY A;  1G9C A;  2B4W A;  1TIE A;  3A23 A;  1V6V A;  3VSR A;  3V79 C;  2ET2 A;  3FJA A;  1OYG A;  1EPW A;  4OEF A;  4IZX A;  4AN7 B;  2YFR A;  4KC7 A;  4I37 A;  4EFR A;  4NOV A;  3V0B B;  1SZ6 B;  2X8T A;  4Z9W B;  3C2U A;  3FJ8 A;  4F34 A;  4D8H A;  3R4S A;  1Q03 A;  1S0C A;  3K1U A;  3ZC9 A;  2F2F A;  1BFC A;  1DFQ A;  3V0B A;  2P39 A;  5AYE A;  2BEA A;  2Y9F A;  4XKI A;  3BTA A;  3OGG A;  3VEQ A;  1M16 A;  2NM1 A;  1J0S A;  4I4O A;  3E8L C;  5JOX A;  4GAI A;  1KNM A;  1HWP B;  2KI4 A;  1DZD A;  1YBI A;  1P63 A;  2I1B A;  2WRY A;  3H6S E;  4KCA A;  3LFI A;  1PUM B;  3WIN A;  1DIW A;  4P0J A;  1GYD B;  1FWU A;  1I1B A;  4DCK C;  1MC9 A;  2YUG A;  3S8J A;  5GLN A;  3OGF A;  1MD6 A;  3CRH A;  2EXH A;  1ILR 1;  2RST A;  3Q7W A;  1ISY A;  4JAW A;  1QQK A;  3O3Q A;  4XFU A;  3WMU A;  4J2X A;  4ZGR B;  1BAS A;  3O5W B;  3NBN A;  1WL7 A;  1FV3 A;  2P23 A;  3BAH A;  4OWJ A;  3T8S A;  3WA1 A;  1BAR A;  3QC2 A;  3NQH A;  1DQO A;  4KEK A;  1R8N A;  4FVV A;  1ISZ A;  4AK7 A;  1PC8 B;  3QR5 A;  3OJ2 A;  4LO2 C;  5BXT A;  1UYP A;  5FK8 A;  4KC3 A;  5DVH A;  4A7K A;  1JT4 A;  3RWK X;  4EFQ A;  5DUY A;  3P2N A;  4KMI A;  1JY0 A;  2D1Z A;  3LLP A;  1PT2 A;  2D22 A;  3PIJ A;  3SNV A;  3VWC A;  5JOZ A;  1UPS A;  3BYN A;  3PHZ A;  4G6J A;  4O8O A;  3OBT A;  1L2H A;  4LO0 C;  3ZXD A;  4EEE B;  3LIG A;  1YTO A;  3TC2 A;  3JUT A;  4GOV A;  1N4K A;  4IZE A;  4ION A;  1FV2 A;  4Q9P A;  1S0E A;  1ISX A;  4I96 A;  5EC5 A;  2ERM A;  5I1B A;  2KLL A;  5GLO A;  1BFB A;  2ZR1 B;  1F31 A;  3D5Z A;  4I1E A;  3C7G A;  3WPY A;  5F8W A;  4I4U A;  2MIB A;  3ZXL A;  4JRA A;  1SR4 A;  3VSS A;  4ZFY B;  4ZBV B;  1AVW B;  5BQU A;  3QEE A;  4I6I A;  4LO0 A;  5AYC A;  5C0P A;  5JLV A;  2QQW A;  3CA0 A;  3FFZ A;  4FFF A;  3WAT A;  1Y9M A;  3IM7 A;  1EV2 A;  1NUN A;  4P0L A;  4COT A;  1TWM A;  1WBA A;  2EXJ A;  3NJ5 A;  3MPP G;  4LO1 C;  5FZU A;  4WBC A;  3IAG C;  3IM5 A;  4O8P A;  2Y9G A;  5DZU A;  1BFG A;  4L4I A;  1S0G A;  3WPZ A;  2NTD A;  1IRP A;  7I1B A;  1HWM B;  1YXW A;  4XFS A;  1IRA X;  1W3A A;  3AKH A;  3N7M A;  1AXM A;  3HAL A;  3BYK A;  3O4D A;  1Y7B A;  1TOO A;  8I1B A;  1JQZ A;  4Z8S B;  2HZ9 A;  3CU1 B;  4A7Y A;  1E0O A;  1XZZ A;  3R67 A;  4QKR A;  1S0F A;  3OM7 A;  4D47 A;  2UUS A;  1FMZ A;  3BRG C;  3BRF A;  2MC2 A;  2DRE A;  1FN0 A;  2HW9 A;  3OJV A;  2YFS A;  1BLA A;  1AFC A;  1BA7 A;  2HWM A;  4I4Q A;  2X2S A;  3HOM A;  4LO1 A;  2E4M C;  3ZC8 A;  5A8C A;  3LV4 A;  4R6U B;  3RTI B;  3Q7X A;  4LO7 C;  4PVI A;  1HWO B;  1YIF A;  3CA3 A;  3C7H A;  1JT7 A;  1V6U A;  3F1R A;  4FFI A;  3OM6 A;  2QQU A;  2RG9 B;  3UGH A;  3FJF A;  1GGP B;  3A07 A;  4FFH A;  4MLG A;  2AAI B;  3AKG A;  5FIX A;  4JP0 A;  3FJB A;  3CU9 A;  4XFT A;  3BAO A;  5B6S A;  3BX1 C;  1BFF A;  2FFU A;  4IY9 A;  2Y9W C;  2QYI B;  3WN1 A;  3CAH A;  1RML A;  2D44 A;  4X37 A;  1IOB A;  1HWN B;  3ZX7 A;  3RMX A;  2R9K B;  4J23 B;  1HKN A;  2VUA A;  5FNX A;  4I4R A;  3P6I A;  5BP5 C;  1GYE B;  3EF2 A;  3FJE A;  2NP0 A;  3N7L A;  1W18 A;  3N0K A;  1I1E A;  2NVH A;  4U6B A;  3TAW A;  4KEJ A;  5E24 E;  4I4P A;  1WD4 A;  1S0B A;  4CJM A;  4F83 A;  3KF5 A;  1ISW A;  1AVA C;  4A7Z A;  4GOY A;  1W2T A;  4G1R A;  1QXM A;  2GZB A;  4I0Y A;  2VU9 A;  4N4B A;  1ONK B;  3W9T A;  1G9A A;  4I4S A;  2EXI A;  2AC1 A;  4I4X A;  3LEM A;  3BA4 A;  5EG6 C;  4ZLB B;  2XOA A;  4HJJ A;  2VLC A;  3QEF A;  1V6X A;  5BP5 A;  1JT5 A;  2FFV A;  3RSJ A;  1JTC A;  3O4C A;  4GAF A;  3A22 A;  4X39 A;  1YI7 A;  4QKS A;  3NBC A;  5DSS B;  3RMY A;  2BFH A;  3D7W B;  31BI A;  5FKC A;  1JT3 A;  1DZC A;  1OQL B;  2DRY A;  1IJT A;  3AKF A;  4QBC A;  3JRR A;  2VDT A;  3WPV A;  3U75 A;  3O44 A;  3POK A;  5GAQ A;  5BOW A;  3PME A;  3OM5 A;  2QQV A;  4Q9G A;  3O4O A;  2Z49 A;  5GLL A;  4EB2 B;  1ITB A;  3I2X A;  4FFG A;  4IY8 A;  3OJM A;  4PVA A;  4LO2 A;  3UGF A;  3FJC A;  5JOY A;  1W3F A;  3ZXJ A;  4I3N A;  3UD9 A;  2KKI A;  1AVU A;  3VSZ A;  1DFC A;  2VSE A;  3C9Z A;  2IHO A;  1XG6 A;  1K5U A;  3IM6 A;  4USO A;  4FGF A;  5BXS A;  2X2T A;  1YRZ A;  2ESU A;  3FJJ A;  4UDJ A;  3VUO A;  3QYD A;  3FJI A;  4AK5 A;  1VKD A;  1Q1U A;  1YF8 B;  3O4A A;  3ILA A;  2AXM A;  3BA5 A;  3OM2 A;  3HBW A;  4ZFU B;  4II0 A;  1IT0 A;  5BVP I;  4Q91 A;  3C7E A;  1W3G A;  2D20 A;  4KCB A;  4N2R A;  1DJS B;  4EFP A;  3D60 A;  3WAU A;  1K5V A;  4QBV A;  2K43 A;  2K4A B;  3AH1 A;  4GP3 A;  2D7R A;  5JMC A;  2D43 A;  4LO3 C;  5AY9 A;  1V6W A;  5FZZ A;  1TFM B;  4HR6 C;  2AEZ A;  1PUU B;  2YFT A;  4D0T A;  1Q04 A;  4IYB A;  3F62 B;  5F8Y A;  3ZXK A;  3P6J A;  3WN0 A;  4G9N A;  2KH2 A;  41BI A;  2LIE A;  5GLQ A;  1HIB A;  5GLP A;  3R4Z A;  4QQS A;  3O4B A;  4I7I A;  5A7V B;  3O49 A;  2IWT B;  2FGF A;  4X3A A;  3H6R B;  3FJ9 A;  3BAU A;  5FNW A;  4IQP A;  4QC4 A;  1II4 A;  2VXR A;  2ZQN A;  3R4Y A;  4N2Z A;  1M2T B;  5A7V A;  3QZ4 A;  1AVX B;  3WMV A;  1T9F A;  4QAL A;  3H6R A;  4LO3 A;  3UDA A;  4JKX B;  1GYH A;  4I1B A;  5FLW A;  3HMY A;  4UDI A;  4O8N A;  2VSA A;  1G9B A;  1TTU A;  4OWL A;  3KST A;  3BB2 A;  2FO1 A;  3LF7 A;  2VXT I;  4DEN A;  3BYJ A;  4LO7 B;  3BAG A;  3WN2 A;  3H6Q A;  4ZFW B;  3CRG A;  5GLM A;  5F90 A;  1Y9G A;  5FK7 A;  1YYN A;  2ZQO A;  3WIN C;  2Q9X A;  5D61 A;  2E4M A;  4G6M A;  3V0A B;  1R8O A;  4OWK A;  3B9U A;  2Q3N B;  1TP0 A;  5EHA A;  3AJ6 A;  4OUJ A;  5F8S A;  1PWA A;  3RTJ B;  3V0A A;  1ISV A;  1T4Q A;  1S0D A;  1DQG A;  3FJD A;  2BEB A;  3HN1 A;  4ISR A;  3SC7 X;  3AH2 A;  3I29 B;  3UGG A;  4AK6 A;  4N1I A;  1S0L A;  3VT2 A;  2D7I A;  3VT0 A;  1EVT A;  3FUQ A;  4USP A;  3UD7 A;  4LO8 B;  3Q7Y A;  4H04 A;  3S8K A;  4UDK E;  4EQV A;  4UDK A;  3N7K A;  3AZW A;  3ZXG A;  9ILB A;  4H9W A;  2FDB M;  4J2K A;  3WAS A;  2D23 A;  3VT1 A;  3LDK A;  4I4Y A;  3BAV A;  1G9D A;  4ONZ A;  1IIL A;  3A21 A;  3AKI A;  4J2Y A;  5GLK A;  1ABR B;  4I8M A;  5A8D A;  1CVS A;  5FMB A;  1XYF A;  1DLL A;  4J2S A;  1VCL A;  4AN6 A;  2AQZ A;  1FWV A;  1ST8 A;  4DEP A;  3FJK A;  3PUB A;  3C7O A;  4I2S A;  4QD2 C;  3NBE A;  4P6A A;  3CRI A;  1EYL A;  3FJH A;  5FKB A;  3UJ0 A;  3WO2 A;  4P0K A;  3I2A A;  4TLP A;  3D61 A;  5B2H A;  1Z2V A;  3FUO A;  3KF3 A;  6I1B A;  2EXK A;  5BXR A;  1A8D A;  2K8R A;  3MAL A;  1FGA A;  1QQL A;  1SR4 C;  4ZA3 B;  4I4V A;  4KBB A;  5FZY A;  5ANN A;  5GLR A;  1XHB A;  2L5X A;  5BQU C;  1WD3 A;  2WBC A;  5JOW A;  4QD2 B;  3CA5 A;  4KEI A;  4D0Z A;  3WMZ A;  4END A;  1CE7 B;  3QED A;  2RQ9 A;  2MLL B; 
#chains in the Genus database with same CATH topology
 3IIR A;  3OM4 A;  1RG8 A;  4L4H A;  5D62 A;  2DS0 A;  1WBC A;  2OXB A;  2Z48 A;  3LDR A;  2HWA A;  3C7F A;  3AJ5 A;  3OBR A;  4PC4 A;  3AZV A;  3UD8 A;  1UV4 A;  1RY7 A;  4U6D A;  4HA2 A;  1G82 A;  3VSF A;  3D5Y A;  4YOL A;  3R4U A;  4IHZ A;  1RZO B;  3WPU A;  2XQR A;  4QO3 A;  1FQ9 A;  3HSM A;  3KMV A;  2QN4 A;  3PG0 A;  3K1X A;  3N7J A;  4G9M A;  4JKQ A;  2M49 A;  1BLD A;  2ADD A;  1Y4W A;  5HPZ A;  3UJ4 A;  4EKX B;  3WMY A;  4JQ0 A;  1Z0H A;  4GP0 A;  5B6T A;  1Z4S A;  5AYD A;  1FMM S;  3CA1 A;  3LTQ A;  1AF9 A;  21BI A;  3CA4 A;  4OEE A;  4ZKT B;  2AFG A;  3LIH A;  2KI6 B;  2AEY A;  1IHK A;  2J3P A;  2NZ9 A;  5G00 A;  2DRZ A;  2GO2 A;  3AH4 A;  4X38 A;  4KC8 A;  1D0H A;  4OW4 A;  5D63 A;  3BAQ A;  3PIG A;  4H75 A;  3NBD A;  1JLY A;  4OEG A;  3P53 A;  3WO4 A;  3CQA A;  5BXP A;  2ADE A;  3U14 A;  2Y9X E;  4ZOT A;  3BYL A;  2F8X C;  4ISQ A;  3FGM A;  1JLX A;  4MZH A;  3BAD A;  5FMC A;  2D24 A;  2X8F A;  2F2F C;  3WO3 A;  1HCE A;  3BA7 A;  2LIQ A;  1TWE A;  5FMD A;  1NZK A;  1PZZ A;  3BRD A;  4UDG A;  3CA6 A;  1HCD A;  4JPZ A;  2X8S A;  2NYY A;  1G9C A;  2B4W A;  1TIE A;  3A23 A;  1V6V A;  3VSR A;  3V79 C;  2ET2 A;  3FJA A;  1OYG A;  1EPW A;  4OEF A;  4IZX A;  4AN7 B;  2YFR A;  4KC7 A;  4I37 A;  4EFR A;  4NOV A;  3V0B B;  1SZ6 B;  2X8T A;  4Z9W B;  3C2U A;  3FJ8 A;  4F34 A;  4D8H A;  3R4S A;  1Q03 A;  1S0C A;  3K1U A;  3ZC9 A;  2F2F A;  1BFC A;  1DFQ A;  3V0B A;  2P39 A;  5AYE A;  2BEA A;  2Y9F A;  4XKI A;  3BTA A;  3OGG A;  3VEQ A;  1M16 A;  2NM1 A;  1J0S A;  4I4O A;  3E8L C;  5JOX A;  4GAI A;  1KNM A;  1HWP B;  2KI4 A;  1DZD A;  1YBI A;  1P63 A;  2I1B A;  2WRY A;  3H6S E;  4KCA A;  3LFI A;  1PUM B;  3WIN A;  1DIW A;  4P0J A;  1GYD B;  1FWU A;  1I1B A;  4DCK C;  1MC9 A;  2YUG A;  3S8J A;  5GLN A;  3OGF A;  1MD6 A;  3CRH A;  2EXH A;  1ILR 1;  2RST A;  3Q7W A;  1ISY A;  4JAW A;  1QQK A;  3O3Q A;  4XFU A;  3WMU A;  4J2X A;  4ZGR B;  1BAS A;  3O5W B;  3NBN A;  1WL7 A;  1FV3 A;  2P23 A;  3BAH A;  4OWJ A;  3T8S A;  3WA1 A;  1BAR A;  3QC2 A;  3NQH A;  1DQO A;  4KEK A;  1R8N A;  4FVV A;  1ISZ A;  4AK7 A;  1PC8 B;  3QR5 A;  3OJ2 A;  4LO2 C;  5BXT A;  1UYP A;  5FK8 A;  4KC3 A;  5DVH A;  4A7K A;  1JT4 A;  3RWK X;  4EFQ A;  5DUY A;  3P2N A;  4KMI A;  1JY0 A;  2D1Z A;  3LLP A;  1PT2 A;  2D22 A;  3PIJ A;  4MZF B;  3SNV A;  3VWC A;  5JOZ A;  1UPS A;  3BYN A;  3PHZ A;  4G6J A;  4O8O A;  3OBT A;  1L2H A;  4LO0 C;  3ZXD A;  4EEE B;  3LIG A;  1YTO A;  3TC2 A;  3JUT A;  4GOV A;  1N4K A;  4IZE A;  4ION A;  1FV2 A;  4Q9P A;  1S0E A;  1ISX A;  4I96 A;  5EC5 A;  2ERM A;  5I1B A;  2KLL A;  5GLO A;  1BFB A;  2ZR1 B;  1F31 A;  3D5Z A;  4I1E A;  3C7G A;  3WPY A;  5F8W A;  4I4U A;  2MIB A;  3ZXL A;  4JRA A;  1SR4 A;  3VSS A;  2NS2 A;  4ZFY B;  4ZBV B;  1AVW B;  5BQU A;  3QEE A;  4I6I A;  4LO0 A;  5AYC A;  5C0P A;  5JLV A;  2QQW A;  3CA0 A;  3FFZ A;  4FFF A;  3WAT A;  1Y9M A;  3IM7 A;  1EV2 A;  1NUN A;  4P0L A;  4COT A;  1TWM A;  1WBA A;  2EXJ A;  3NJ5 A;  3MPP G;  4LO1 C;  5FZU A;  4WBC A;  3IAG C;  3IM5 A;  4O8P A;  2Y9G A;  5DZU A;  1BFG A;  4L4I A;  1S0G A;  3WPZ A;  2NTD A;  1IRP A;  7I1B A;  1HWM B;  1YXW A;  4XFS A;  1IRA X;  1W3A A;  3AKH A;  3N7M A;  1AXM A;  3HAL A;  3BYK A;  3O4D A;  1Y7B A;  1TOO A;  8I1B A;  1JQZ A;  4Z8S B;  2HZ9 A;  3CU1 B;  4A7Y A;  1E0O A;  1XZZ A;  3R67 A;  4QKR A;  1S0F A;  3OM7 A;  4D47 A;  2UUS A;  1FMZ A;  3BRG C;  3BRF A;  2MC2 A;  2DRE A;  1FN0 A;  2HW9 A;  3OJV A;  1TL2 A;  2YFS A;  1BLA A;  1AFC A;  1BA7 A;  2HWM A;  4I4Q A;  2X2S A;  3HOM A;  4LO1 A;  2E4M C;  3ZC8 A;  5A8C A;  3LV4 A;  4R6U B;  3RTI B;  3Q7X A;  4LO7 C;  4PVI A;  1HWO B;  1YIF A;  3CA3 A;  3C7H A;  1JT7 A;  1V6U A;  3F1R A;  4FFI A;  3OM6 A;  2QQU A;  2RG9 B;  3UGH A;  3FJF A;  1GGP B;  3A07 A;  4FFH A;  4MLG A;  2AAI B;  3AKG A;  5FIX A;  4JP0 A;  3FJB A;  3CU9 A;  4XFT A;  3BAO A;  5B6S A;  3BX1 C;  1BFF A;  2FFU A;  4IY9 A;  2Y9W C;  2QYI B;  3WN1 A;  3CAH A;  1RML A;  2D44 A;  4X37 A;  1IOB A;  1HWN B;  3ZX7 A;  3RMX A;  2R9K B;  4J23 B;  1HKN A;  2VUA A;  5FNX A;  4I4R A;  3P6I A;  4UY4 A;  5BP5 C;  1GYE B;  3EF2 A;  3FJE A;  2NP0 A;  3N7L A;  1W18 A;  3N0K A;  1I1E A;  2NVH A;  4U6B A;  3TAW A;  4KEJ A;  5E24 E;  4I4P A;  1WD4 A;  1S0B A;  4CJM A;  4F83 A;  3KF5 A;  1ISW A;  1AVA C;  4A7Z A;  4GOY A;  1W2T A;  4G1R A;  1QXM A;  2GZB A;  4I0Y A;  2VU9 A;  4N4B A;  1ONK B;  3W9T A;  1G9A A;  4I4S A;  2EXI A;  2AC1 A;  4I4X A;  3LEM A;  3BA4 A;  5EG6 C;  4ZLB B;  2XOA A;  4HJJ A;  2VLC A;  3QEF A;  1V6X A;  5BP5 A;  1JT5 A;  2FFV A;  3RSJ A;  1JTC A;  3O4C A;  4GAF A;  3A22 A;  4X39 A;  1YI7 A;  4QKS A;  3NBC A;  5DSS B;  3RMY A;  2BFH A;  3D7W B;  31BI A;  5FKC A;  1JT3 A;  1DZC A;  1OQL B;  2DRY A;  1IJT A;  3AKF A;  4QBC A;  3JRR A;  2VDT A;  3WPV A;  3U75 A;  3O44 A;  3POK A;  5GAQ A;  5BOW A;  3PME A;  3OM5 A;  2QQV A;  4Q9G A;  3O4O A;  2Z49 A;  5GLL A;  4EB2 B;  1ITB A;  3I2X A;  4FFG A;  4IY8 A;  3OJM A;  4PVA A;  4LO2 A;  3UGF A;  3FJC A;  5JOY A;  1W3F A;  3ZXJ A;  4I3N A;  3UD9 A;  2KKI A;  1AVU A;  3VSZ A;  1DFC A;  2VSE A;  3C9Z A;  2IHO A;  1XG6 A;  1K5U A;  3IM6 A;  4USO A;  4FGF A;  5BXS A;  2X2T A;  1YRZ A;  2ESU A;  3FJJ A;  4UDJ A;  3VUO A;  3QYD A;  3FJI A;  4AK5 A;  1VKD A;  1Q1U A;  1YF8 B;  3O4A A;  3ILA A;  2AXM A;  3BA5 A;  3OM2 A;  3HBW A;  4ZFU B;  4II0 A;  1IT0 A;  5BVP I;  4Q91 A;  3C7E A;  1W3G A;  2D20 A;  4KCB A;  4N2R A;  4MZG B;  1DJS B;  4EFP A;  3D60 A;  3WAU A;  1K5V A;  4QBV A;  2K43 A;  2K4A B;  3AH1 A;  4GP3 A;  2D7R A;  5JMC A;  2D43 A;  4LO3 C;  5AY9 A;  1V6W A;  5FZZ A;  1TFM B;  4HR6 C;  2AEZ A;  1PUU B;  2YFT A;  4D0T A;  1Q04 A;  4IYB A;  3F62 B;  5F8Y A;  3ZXK A;  3P6J A;  3WN0 A;  4G9N A;  2KH2 A;  41BI A;  2LIE A;  5GLQ A;  1HIB A;  5GLP A;  3R4Z A;  4QQS A;  3O4B A;  4I7I A;  5A7V B;  3O49 A;  2IWT B;  2FGF A;  4X3A A;  3H6R B;  3FJ9 A;  3BAU A;  5FNW A;  4IQP A;  4QC4 A;  1II4 A;  2VXR A;  2ZQN A;  3R4Y A;  4N2Z A;  1M2T B;  5A7V A;  3QZ4 A;  1AVX B;  3WMV A;  1T9F A;  4QAL A;  3H6R A;  4LO3 A;  3UDA A;  4JKX B;  1GYH A;  4I1B A;  5FLW A;  3HMY A;  4UDI A;  4O8N A;  2VSA A;  1G9B A;  1TTU A;  4OWL A;  3KST A;  3BB2 A;  2FO1 A;  3LF7 A;  2VXT I;  4DEN A;  3BYJ A;  4LO7 B;  3BAG A;  3WN2 A;  3H6Q A;  4ZFW B;  3CRG A;  5GLM A;  5F90 A;  1Y9G A;  5FK7 A;  1YYN A;  2ZQO A;  3WIN C;  2Q9X A;  5D61 A;  2E4M A;  4G6M A;  3V0A B;  1R8O A;  4OWK A;  3B9U A;  2Q3N B;  1TP0 A;  5EHA A;  3AJ6 A;  4OUJ A;  5F8S A;  1PWA A;  3RTJ B;  3V0A A;  1ISV A;  1T4Q A;  1S0D A;  1DQG A;  3FJD A;  2BEB A;  3HN1 A;  4ISR A;  3SC7 X;  3AH2 A;  3I29 B;  3UGG A;  4AK6 A;  4N1I A;  1S0L A;  3VT2 A;  2D7I A;  3VT0 A;  1EVT A;  3FUQ A;  4USP A;  3UD7 A;  4LO8 B;  3Q7Y A;  4H04 A;  3S8K A;  4UDK E;  4EQV A;  4UDK A;  3N7K A;  3AZW A;  3ZXG A;  9ILB A;  4H9W A;  2FDB M;  4J2K A;  3WAS A;  2D23 A;  3VT1 A;  3LDK A;  4I4Y A;  3BAV A;  1G9D A;  4ONZ A;  1IIL A;  3A21 A;  3AKI A;  4J2Y A;  5GLK A;  1ABR B;  4I8M A;  5A8D A;  1CVS A;  5FMB A;  1XYF A;  1DLL A;  4J2S A;  1VCL A;  4AN6 A;  2AQZ A;  1FWV A;  1ST8 A;  4DEP A;  3FJK A;  3PUB A;  3C7O A;  4I2S A;  5C2M A;  4QD2 C;  3NBE A;  4P6A A;  3CRI A;  1EYL A;  3FJH A;  5FKB A;  3UJ0 A;  3WO2 A;  4P0K A;  3I2A A;  4TLP A;  3D61 A;  5B2H A;  1Z2V A;  3FUO A;  3KF3 A;  6I1B A;  2EXK A;  5BXR A;  1A8D A;  2K8R A;  3MAL A;  1FGA A;  1QQL A;  1SR4 C;  4ZA3 B;  4I4V A;  4KBB A;  5FZY A;  5ANN A;  5GLR A;  1XHB A;  2L5X A;  5BQU C;  1WD3 A;  2WBC A;  5JOW A;  4QD2 B;  3CA5 A;  4KEI A;  4D0Z A;  3WMZ A;  4END A;  1CE7 B;  3QED A;  2RQ9 A;  2MLL B; 
#chains in the Genus database with same CATH homology
 3IIR A;  3OM4 A;  1RG8 A;  4L4H A;  5D62 A;  2DS0 A;  1WBC A;  2OXB A;  2Z48 A;  3LDR A;  2HWA A;  3C7F A;  3AJ5 A;  3OBR A;  4PC4 A;  3AZV A;  3UD8 A;  1UV4 A;  1RY7 A;  4U6D A;  4HA2 A;  1G82 A;  3VSF A;  3D5Y A;  4YOL A;  3R4U A;  4IHZ A;  1RZO B;  3WPU A;  2XQR A;  4QO3 A;  1FQ9 A;  3HSM A;  3KMV A;  2QN4 A;  3PG0 A;  3K1X A;  3N7J A;  4G9M A;  4JKQ A;  2M49 A;  1BLD A;  2ADD A;  1Y4W A;  5HPZ A;  3UJ4 A;  4EKX B;  3WMY A;  4JQ0 A;  1Z0H A;  4GP0 A;  5B6T A;  1Z4S A;  5AYD A;  1FMM S;  3CA1 A;  3LTQ A;  1AF9 A;  21BI A;  3CA4 A;  4OEE A;  4ZKT B;  2AFG A;  3LIH A;  2KI6 B;  2AEY A;  1IHK A;  2J3P A;  2NZ9 A;  5G00 A;  2DRZ A;  2GO2 A;  3AH4 A;  4X38 A;  4KC8 A;  1D0H A;  4OW4 A;  5D63 A;  3BAQ A;  3PIG A;  4H75 A;  3NBD A;  1JLY A;  4OEG A;  3P53 A;  3WO4 A;  3CQA A;  5BXP A;  2ADE A;  3U14 A;  2Y9X E;  4ZOT A;  3BYL A;  2F8X C;  4ISQ A;  3FGM A;  1JLX A;  4MZH A;  3BAD A;  5FMC A;  2D24 A;  2X8F A;  2F2F C;  3WO3 A;  1HCE A;  3BA7 A;  2LIQ A;  1TWE A;  5FMD A;  1NZK A;  1PZZ A;  3BRD A;  4UDG A;  3CA6 A;  1HCD A;  4JPZ A;  2X8S A;  2NYY A;  1G9C A;  2B4W A;  1TIE A;  3A23 A;  1V6V A;  3VSR A;  3V79 C;  2ET2 A;  3FJA A;  1OYG A;  1EPW A;  4OEF A;  4IZX A;  4AN7 B;  2YFR A;  4KC7 A;  4I37 A;  4EFR A;  4NOV A;  3V0B B;  1SZ6 B;  2X8T A;  4Z9W B;  3C2U A;  3FJ8 A;  4F34 A;  4D8H A;  3R4S A;  1Q03 A;  1S0C A;  3K1U A;  3ZC9 A;  2F2F A;  1BFC A;  1DFQ A;  3V0B A;  2P39 A;  5AYE A;  2BEA A;  2Y9F A;  4XKI A;  3BTA A;  3OGG A;  3VEQ A;  1M16 A;  2NM1 A;  1J0S A;  4I4O A;  3E8L C;  5JOX A;  4GAI A;  1KNM A;  1HWP B;  2KI4 A;  1DZD A;  1YBI A;  1P63 A;  2I1B A;  2WRY A;  3H6S E;  4KCA A;  3LFI A;  1PUM B;  3WIN A;  1DIW A;  4P0J A;  1GYD B;  1FWU A;  1I1B A;  4DCK C;  1MC9 A;  2YUG A;  3S8J A;  5GLN A;  3OGF A;  1MD6 A;  3CRH A;  2EXH A;  1ILR 1;  2RST A;  3Q7W A;  1ISY A;  4JAW A;  1QQK A;  3O3Q A;  4XFU A;  3WMU A;  4J2X A;  4ZGR B;  1BAS A;  3O5W B;  3NBN A;  1WL7 A;  1FV3 A;  2P23 A;  3BAH A;  4OWJ A;  3T8S A;  3WA1 A;  1BAR A;  3QC2 A;  3NQH A;  1DQO A;  4KEK A;  1R8N A;  4FVV A;  1ISZ A;  4AK7 A;  1PC8 B;  3QR5 A;  3OJ2 A;  4LO2 C;  5BXT A;  1UYP A;  5FK8 A;  4KC3 A;  5DVH A;  4A7K A;  1JT4 A;  3RWK X;  4EFQ A;  5DUY A;  3P2N A;  4KMI A;  1JY0 A;  2D1Z A;  3LLP A;  1PT2 A;  2D22 A;  3PIJ A;  4MZF B;  3SNV A;  3VWC A;  5JOZ A;  1UPS A;  3BYN A;  3PHZ A;  4G6J A;  4O8O A;  3OBT A;  1L2H A;  4LO0 C;  3ZXD A;  4EEE B;  3LIG A;  1YTO A;  3TC2 A;  3JUT A;  4GOV A;  1N4K A;  4IZE A;  4ION A;  1FV2 A;  4Q9P A;  1S0E A;  1ISX A;  4I96 A;  5EC5 A;  2ERM A;  5I1B A;  2KLL A;  5GLO A;  1BFB A;  2ZR1 B;  1F31 A;  3D5Z A;  4I1E A;  3C7G A;  3WPY A;  5F8W A;  4I4U A;  2MIB A;  3ZXL A;  4JRA A;  1SR4 A;  3VSS A;  2NS2 A;  4ZFY B;  4ZBV B;  1AVW B;  5BQU A;  3QEE A;  4I6I A;  4LO0 A;  5AYC A;  5C0P A;  5JLV A;  2QQW A;  3CA0 A;  3FFZ A;  4FFF A;  3WAT A;  1Y9M A;  3IM7 A;  1EV2 A;  1NUN A;  4P0L A;  4COT A;  1TWM A;  1WBA A;  2EXJ A;  3NJ5 A;  3MPP G;  4LO1 C;  5FZU A;  4WBC A;  3IAG C;  3IM5 A;  4O8P A;  2Y9G A;  5DZU A;  1BFG A;  4L4I A;  1S0G A;  3WPZ A;  2NTD A;  1IRP A;  7I1B A;  1HWM B;  1YXW A;  4XFS A;  1IRA X;  1W3A A;  3AKH A;  3N7M A;  1AXM A;  3HAL A;  3BYK A;  3O4D A;  1Y7B A;  1TOO A;  8I1B A;  1JQZ A;  4Z8S B;  2HZ9 A;  3CU1 B;  4A7Y A;  1E0O A;  1XZZ A;  3R67 A;  4QKR A;  1S0F A;  3OM7 A;  4D47 A;  2UUS A;  1FMZ A;  3BRG C;  3BRF A;  2MC2 A;  2DRE A;  1FN0 A;  2HW9 A;  3OJV A;  2YFS A;  1BLA A;  1AFC A;  1BA7 A;  2HWM A;  4I4Q A;  2X2S A;  3HOM A;  4LO1 A;  2E4M C;  3ZC8 A;  5A8C A;  3LV4 A;  4R6U B;  3RTI B;  3Q7X A;  4LO7 C;  4PVI A;  1HWO B;  1YIF A;  3CA3 A;  3C7H A;  1JT7 A;  1V6U A;  3F1R A;  4FFI A;  3OM6 A;  2QQU A;  2RG9 B;  3UGH A;  3FJF A;  1GGP B;  3A07 A;  4FFH A;  4MLG A;  2AAI B;  3AKG A;  5FIX A;  4JP0 A;  3FJB A;  3CU9 A;  4XFT A;  3BAO A;  5B6S A;  3BX1 C;  1BFF A;  2FFU A;  4IY9 A;  2Y9W C;  2QYI B;  3WN1 A;  3CAH A;  1RML A;  2D44 A;  4X37 A;  1IOB A;  1HWN B;  3ZX7 A;  3RMX A;  2R9K B;  4J23 B;  1HKN A;  2VUA A;  5FNX A;  4I4R A;  3P6I A;  4UY4 A;  5BP5 C;  1GYE B;  3EF2 A;  3FJE A;  2NP0 A;  3N7L A;  1W18 A;  3N0K A;  1I1E A;  2NVH A;  4U6B A;  3TAW A;  4KEJ A;  5E24 E;  4I4P A;  1WD4 A;  1S0B A;  4CJM A;  4F83 A;  3KF5 A;  1ISW A;  1AVA C;  4A7Z A;  4GOY A;  1W2T A;  4G1R A;  1QXM A;  2GZB A;  4I0Y A;  2VU9 A;  4N4B A;  1ONK B;  3W9T A;  1G9A A;  4I4S A;  2EXI A;  2AC1 A;  4I4X A;  3LEM A;  3BA4 A;  5EG6 C;  4ZLB B;  2XOA A;  4HJJ A;  2VLC A;  3QEF A;  1V6X A;  5BP5 A;  1JT5 A;  2FFV A;  3RSJ A;  1JTC A;  3O4C A;  4GAF A;  3A22 A;  4X39 A;  1YI7 A;  4QKS A;  3NBC A;  5DSS B;  3RMY A;  2BFH A;  3D7W B;  31BI A;  5FKC A;  1JT3 A;  1DZC A;  1OQL B;  2DRY A;  1IJT A;  3AKF A;  4QBC A;  3JRR A;  2VDT A;  3WPV A;  3U75 A;  3O44 A;  3POK A;  5GAQ A;  5BOW A;  3PME A;  3OM5 A;  2QQV A;  4Q9G A;  3O4O A;  2Z49 A;  5GLL A;  4EB2 B;  1ITB A;  3I2X A;  4FFG A;  4IY8 A;  3OJM A;  4PVA A;  4LO2 A;  3UGF A;  3FJC A;  5JOY A;  1W3F A;  3ZXJ A;  4I3N A;  3UD9 A;  2KKI A;  1AVU A;  3VSZ A;  1DFC A;  2VSE A;  3C9Z A;  2IHO A;  1XG6 A;  1K5U A;  3IM6 A;  4USO A;  4FGF A;  5BXS A;  2X2T A;  1YRZ A;  2ESU A;  3FJJ A;  4UDJ A;  3VUO A;  3QYD A;  3FJI A;  4AK5 A;  1VKD A;  1Q1U A;  1YF8 B;  3O4A A;  3ILA A;  2AXM A;  3BA5 A;  3OM2 A;  3HBW A;  4ZFU B;  4II0 A;  1IT0 A;  5BVP I;  4Q91 A;  3C7E A;  1W3G A;  2D20 A;  4KCB A;  4N2R A;  4MZG B;  1DJS B;  4EFP A;  3D60 A;  3WAU A;  1K5V A;  4QBV A;  2K43 A;  2K4A B;  3AH1 A;  4GP3 A;  2D7R A;  5JMC A;  2D43 A;  4LO3 C;  5AY9 A;  1V6W A;  5FZZ A;  1TFM B;  4HR6 C;  2AEZ A;  1PUU B;  2YFT A;  4D0T A;  1Q04 A;  4IYB A;  3F62 B;  5F8Y A;  3ZXK A;  3P6J A;  3WN0 A;  4G9N A;  2KH2 A;  41BI A;  2LIE A;  5GLQ A;  1HIB A;  5GLP A;  3R4Z A;  4QQS A;  3O4B A;  4I7I A;  5A7V B;  3O49 A;  2IWT B;  2FGF A;  4X3A A;  3H6R B;  3FJ9 A;  3BAU A;  5FNW A;  4IQP A;  4QC4 A;  1II4 A;  2VXR A;  2ZQN A;  3R4Y A;  4N2Z A;  1M2T B;  5A7V A;  3QZ4 A;  1AVX B;  3WMV A;  1T9F A;  4QAL A;  3H6R A;  4LO3 A;  3UDA A;  4JKX B;  1GYH A;  4I1B A;  5FLW A;  3HMY A;  4UDI A;  4O8N A;  2VSA A;  1G9B A;  1TTU A;  4OWL A;  3KST A;  3BB2 A;  2FO1 A;  3LF7 A;  2VXT I;  4DEN A;  3BYJ A;  4LO7 B;  3BAG A;  3WN2 A;  3H6Q A;  4ZFW B;  3CRG A;  5GLM A;  5F90 A;  1Y9G A;  5FK7 A;  1YYN A;  2ZQO A;  3WIN C;  2Q9X A;  5D61 A;  2E4M A;  4G6M A;  3V0A B;  1R8O A;  4OWK A;  3B9U A;  2Q3N B;  1TP0 A;  5EHA A;  3AJ6 A;  4OUJ A;  5F8S A;  1PWA A;  3RTJ B;  3V0A A;  1ISV A;  1T4Q A;  1S0D A;  1DQG A;  3FJD A;  2BEB A;  3HN1 A;  4ISR A;  3SC7 X;  3AH2 A;  3I29 B;  3UGG A;  4AK6 A;  4N1I A;  1S0L A;  3VT2 A;  2D7I A;  3VT0 A;  1EVT A;  3FUQ A;  4USP A;  3UD7 A;  4LO8 B;  3Q7Y A;  4H04 A;  3S8K A;  4UDK E;  4EQV A;  4UDK A;  3N7K A;  3AZW A;  3ZXG A;  9ILB A;  4H9W A;  2FDB M;  4J2K A;  3WAS A;  2D23 A;  3VT1 A;  3LDK A;  4I4Y A;  3BAV A;  1G9D A;  4ONZ A;  1IIL A;  3A21 A;  3AKI A;  4J2Y A;  5GLK A;  1ABR B;  4I8M A;  5A8D A;  1CVS A;  5FMB A;  1XYF A;  1DLL A;  4J2S A;  1VCL A;  4AN6 A;  2AQZ A;  1FWV A;  1ST8 A;  4DEP A;  3FJK A;  3PUB A;  3C7O A;  4I2S A;  4QD2 C;  3NBE A;  4P6A A;  3CRI A;  1EYL A;  3FJH A;  5FKB A;  3UJ0 A;  3WO2 A;  4P0K A;  3I2A A;  4TLP A;  3D61 A;  5B2H A;  1Z2V A;  3FUO A;  3KF3 A;  6I1B A;  2EXK A;  5BXR A;  1A8D A;  2K8R A;  3MAL A;  1FGA A;  1QQL A;  1SR4 C;  4ZA3 B;  4I4V A;  4KBB A;  5FZY A;  5ANN A;  5GLR A;  1XHB A;  2L5X A;  5BQU C;  1WD3 A;  2WBC A;  5JOW A;  4QD2 B;  3CA5 A;  4KEI A;  4D0Z A;  3WMZ A;  4END A;  1CE7 B;  3QED A;  2RQ9 A;  2MLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...