3VT0A

Crystal structure of ct1,3gal43a in complex with lactose
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 131
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt0A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt0A01
5GLNA 4N1IA 2F2FA 3PIGA 5FNXA 4EKXB 1S0FA 2ADDA 2NP0A 4J2XA 5AYCA 1AVUA 5F90A 3UJ0A 3WN1A 1FQ9A 1K5VA 4GOYA 4JAWA 5A7VB 4GP0A 2MIBA 3F1RA 2ESUA 3O49A 2Q9XA 2K43A 2VSAA 3WN0A 2NZ9A 2AQZA 3BYNA 1IOBA 2ET2A 2MLLB 1PT2A 2Y9GA 4KEKA 5BXTA 3OM4A 3V0BB 4USOA 4I1BA 5GLMA 1IT0A 3FJAA 3TC2A 2XQRA 1V6XA 3T8SA 2GZBA 3ZXKA 5FZUA 1NUNA 1Q04A 2P23A 4EFRA 3R4SA 3RMYA 3RTIB 4H04A 3BRGC 1YXWA 2X2TA 4EFPA 3ZC8A 1T9FA 1TWEA 2YFTA 3U14A 4I4UA 4JP0A 2AFGA 4A7ZA 1V6VA 3QYDA 3V0AB 5DVHA 4OEEA 1G9CA 1FMMS 1YIFA 5FKCA 1HIBA 4AN6A 1P63A 3EF2A 1Y4WA 1DQGA 3LIGA 3WINA 3B9UA 5AY9A 3CRIA 2VXTI 3D7WB 4O8PA 1TIEA 3V79C 4KCBA 5B6TA 3ZC9A 4I96A 2BFHA 5FMCA 5GLQA 3QEFA 5F8WA 1AVWB 3RSJA 5BP5C 2AEYA 1IILA 4TLPA 2F2FC 2ADEA 1TP0A 2EXIA 1A8DA 2D1ZA 3FJ8A 3WATA 1XYFA 1HCDA 3HOMA 3R67A 1JQZA 3H6QA 3KF5A 1ST8A 3CU1B 2AAIB 3LFIA 3LF7A 1OYGA 5D61A 4I4PA 6I1BA 3VSRA 1YTOA 3POKA 4I6IA 3WO2A 3QEDA 3R4YA 1AVXB 2AC1A 3P6JA 1TWMA 4ZKTB 2QQWA 3VWCA 3IAGC 1HWOB 1D0HA 3BYKA 4YOLA 1BA7A 4X3AA 3W9TA 3FUOA 3BYJA 4OEFA 3WPZA 4OWLA 3UJ4A 3HSMA 2DRZA 2AXMA 4USPA 1KNMA 1DLLA 1XG6A 3BAHA 2D7IA 5F8YA 3S8KA 3PMEA 5FIXA 4I37A 5EG6C 1MC9A 4Q9GA 2GO2A 3CA0A 4ZGRB 4QC4A 3WPVA 3FJEA 4ZOTA 1II4A 3C7EA 1RG8A 4GAIA 1PZZA 3FJCA 5G00A 2VSEA 1YI7A 9ILBA 2FFUA 1I1EA 1VKDA 3U75A 2D23A 1S0LA 5AYDA 5JOWA 5FK8A 5FZYA 2QN4A 41BIA 4D47A 4QKSA 1PC8B 3BAUA 3MPPG 1Z2VA 2UUSA 4X38A 4DCKC 4I4SA 4O8NA 2X8FA 4G6MA 1UV4A 5I1BA 3BAVA 4AK7A 3LIHA 4J2YA 4I8MA 1WBAA 4I0YA 3IM5A 3NJ5A 4Z9WB 4IZEA 3KSTA 1AF9A 3WAUA 2YFRA 4U6DA 1CVSA 5BP5A 4COTA 5HPZA 2Z48A 3LDRA 4P0KA 1ITBA 5BOWA 2R9KB 2FDBM 3AH1A 3UD8A 3WA1A 1YBIA 3HMYA 4QO3A 2X8TA 4ONZA 4GP3A 4IHZA 4KEIA 3UGHA 2FO1A 3CU9A 4FFHA 3CA5A 3FJHA 3LLPA 3ZXJA 5JOYA 3BYLA 4NOVA 1EV2A 1W3AA 1TFMB 1WBCA 1V6WA 1G9DA 3C7HA 2HW9A 2NTDA 4I4YA 2OXBA 3OJ2A 4I4OA 3C7GA 1IJTA 3VT1A 3C7OA 3UDAA 1HWPB 4H9WA 3ILAA 2LIEA 1DZDA 4FVVA 1BFBA 1AVAC 1WL7A 1PUUB 1S0BA 3CAHA 4FGFA 1RMLA 1N4KA 4IZXA 4A7YA 1ISXA 4I4QA 4KCAA 4FFIA 1GYDB 3BA5A 3N7KA 1J0SA 2DREA 3OJVA 2IWTB 2X8SA 5FKBA 5FMDA 2D7RA 2FGFA 3NBEA 1BFGA 1RZOB 4UDKA 1DQOA 2QYIB 1FGAA 1QQKA 3OM7A 3SC7X 3C9ZA 3VT2A 3FJ9A 4I4RA 3BAGA 2BEBA 2ZQNA 2NYYA 4OEGA 4QQSA 4R6UB 1Q1UA 3Q7WA 4OW4A 3O4CA 3AJ6A 4WBCA 4IY8A 2K8RA 5EC5A 4G9MA 2VUAA 1QQLA 2BEAA 4J2SA 3N7MA 1IHKA 3LV4A 2I1BA 2QQUA 2HWAA 4ENDA 3IM6A 4ISRA 5BXRA 3PUBA 5BXSA 1YRZA 4N2RA 3UD9A 4JRAA 3CRHA 4G1RA 1ISVA 4A7KA 1ISZA 1JLXA 3H6RA 4O8OA 3FFZA 3FJIA 2Y9FA 7I1BA 2Y9XE 3JRRA 4ZLBB 4ZA3B 4PVIA 4ZFUB 3O3QA 5BXPA 2Z49A 4I7IA 1W3GA 2F8XC 2KI6B 5GLOA 3IM7A 1Y7BA 4JKQA 3WASA 4HR6C 2YFSA 3I29B 1JT5A 4UDGA 1UYPA 1PUMB 3UGGA 4DENA 3K1XA 3O4OA 1UPSA 1JY0A 1M2TB 4GAFA 1IRAX 3SNVA 3BTAA 1YF8B 5JOZA 5D63A 4AN7B 4I4XA 2RSTA 3WPYA 1EVTA 3WMYA 2NM1A 3N0KA 3AZVA 4IQPA 4LO0C 3Q7XA 4G9NA 5AYEA 2VU9A 2YUGA 5FK7A 3BRFA 3AKIA 5FLWA 4ZFYB 5EHAA 1WD3A 3N7JA 3CRGA 3IIRA 2IHOA 1GYEB 4IONA 4L4HA 3OBRA 5DUYA 3ZXGA 2EXHA 1M16A 4FFFA 5DSSB 4L4IA 1F31A 1G82A 1SZ6B 1R8NA 4P0JA 3WMZA 4LO3C 3VUOA 3WN2A 4I2SA 2E4MA 2AEZA 5E24E 4AK5A 5A8CA 3NBNA 4XFTA 3FGMA 1ISWA 3WMUA 5B6SA 1T4QA 1XZZA 3PG0A 4QD2C 1MD6A 3D5ZA 3PIJA 4ZFWB 3CQAA 4KEJA 3P2NA 3QR5A 2EXKA 4U6BA 3KMVA 2DS0A 1BFFA 5BQUC 3I2XA 4KC8A 5GLKA 3FUQA 3R4UA 4JPZA 3WMVA 4KMIA 3CA3A 4KC7A 2D20A 2FFVA 3LDKA 1W18A 4XKIA 1OQLB 1Z0HA 4QALA 2X2SA 1JTCA 4LO7C 4OWKA 3V0AA 4KC3A 1GYHA 1HKNA 3WO4A 1HCEA 1BLDA 4F83A 1G9BA 3E8LC 3HALA 4QKRA 3VEQA 1S0GA 1SR4C 4CJMA 1Q03A 1R8OA 4I1EA 2XOAA 5GAQA 5BVPI 3R4ZA 3AJ5A 2EXJA 4ZBVB 4EQVA 4G6JA 4D0TA 1BFCA 3VSSA 5FNWA 2Q3NB 4LO0A 1Y9MA 4EEEB 1YYNA 2VLCA 3NQHA 1CE7B 3D61A 1TOOA 1WD4A 3S8JA 1HWNB 3AZWA 1BARA 1EPWA 1NZKA 3A22A 5JLVA 3RWKX 3VSFA 3O5WB 2KH2A 3FJKA 3HN1A 3AH4A 5FMBA 1DFQA 1FV2A 3NBCA 4QBCA 3VT0A 4EFQA 3C7FA 2D44A 3PHZA 4N4BA 1I1BA 3OJMA 5C0PA 1Z4SA 3Q7YA 4IY9A 3CA1A 2ZQOA 1TTUA 2WBCA 2WRYA 3HBWA 3LTQA 1PWAA 1QXMA 3P6IA 3P53A 3RMXA 1FN0A 3BAOA 4LO3A 5DZUA 4LO1A 1JT4A 2KKIA 4LO2C 4OUJA 2E4MC 21BIA 4FFGA 1BASA 3FJFA 1JLYA 1FWUA 2B4WA 1XHBA 3O44A 4Q9PA 31BIA 5GLLA 3H6SE 1JT3A 5GLRA 5FZZA 4DEPA 2P39A 4II0A 2LIQA 4F34A 3NBDA 3AKFA 4UDJA 1DIWA 2DRYA 4XFSA 2D22A 4X39A 4P6AA 3JUTA 5BQUA 2MC2A 3D5YA 1JT7A 4OWJA 4QBVA 4XFUA 3ZXDA 5GLPA 2ZR1B 3OBTA 2Y9WC 3BAQA 3FJDA 4J2KA 3LEMA 1DZCA 4X37A 1E0OA 4AK6A 3A07A 4IYBA 5A8DA 1AFCA 1BLAA 3I2AA 3MALA 4HA2A 2VDTA 1AXMA 1S0CA 3ZXLA 3BA4A 3OM5A 1FWVA 3O4DA 1SR4A 4MLGA 4I4VA 1ABRB 3ZX7A 3BRDA 4PVAA 1HWMB 8I1BA 4P0LA 3AKGA 1FV3A 4JQ0A 5ANNA 2M49A 5JOXA 3AH2A 3CA6A 1L2HA 3OGFA 4ISQA 1G9AA 4UDIA 1IRPA 5D62A 3BB2A 3QZ4A 1V6UA 1ISYA 2RG9B 3RTJB 3FJBA 4EB2B 4KBBA 1S0EA 5B2HA 4D0ZA 3C2UA 3BA7A 4D8HA 3OM6A 2HWMA 3BX1C 5F8SA 3QC2A 1DJSB 2HZ9A 3O4BA 4QD2B 3UD7A 3OGGA 3H6RB 2QQVA 2D43A 1EYLA 2J3PA 2RQ9A 3F62B 5A7VA 3A23A 4Z8SB 2VXRA 4HJJA 2NVHA 3K1UA 3O4AA 2L5XA 3WPUA 4LO2A 4LO1C 3N7LA 3KF3A 1VCLA 4PC4A 3WO3A 3VSZA 4JKXB 3TAWA 3D60A 3A21A 4N2ZA 4LO7B 1S0DA 3BADA 1RY7A 2K4AB 2KLLA 4GOVA 4UDKE 4I3NA 3V0BA 2KI4A 4LO8B 2ERMA 5JMCA 3WINC 4Q91A 1ONKB 1W3FA 1ILR1 1Y9GA 3CA4A 4J23B 1W2TA 3QEEA 3FJJA 1K5UA 1FMZA 2D24A 3OM2A 1DFCA 3AKHA 3UGFA 1GGPB
chains in the Genus database with same CATH superfamily
5GLNA 4N1IA 2F2FA 3PIGA 5FNXA 4EKXB 1S0FA 2ADDA 2NP0A 4J2XA 5AYCA 1AVUA 5F90A 3UJ0A 3WN1A 1FQ9A 1K5VA 4GOYA 4JAWA 5A7VB 4GP0A 2MIBA 3F1RA 2ESUA 3O49A 2Q9XA 2K43A 2VSAA 3WN0A 2NS2A 2NZ9A 2AQZA 3BYNA 1IOBA 2ET2A 2MLLB 1PT2A 2Y9GA 4KEKA 5BXTA 3OM4A 3V0BB 4USOA 4I1BA 5GLMA 1IT0A 3FJAA 3TC2A 2XQRA 1V6XA 4H75A 3T8SA 2GZBA 3ZXKA 5FZUA 1NUNA 1Q04A 2P23A 4EFRA 3R4SA 3RMYA 3RTIB 4H04A 3BRGC 1YXWA 2X2TA 4EFPA 3ZC8A 1T9FA 1TWEA 2YFTA 3U14A 4I4UA 4JP0A 2AFGA 4A7ZA 1V6VA 3QYDA 3V0AB 5DVHA 4OEEA 1G9CA 1FMMS 1YIFA 5FKCA 1HIBA 4AN6A 1P63A 3EF2A 1Y4WA 1DQGA 3LIGA 3WINA 3B9UA 5AY9A 3CRIA 2VXTI 3D7WB 4O8PA 1TIEA 3V79C 4KCBA 5B6TA 3ZC9A 4I96A 2BFHA 5FMCA 5GLQA 3QEFA 5F8WA 1AVWB 3RSJA 5BP5C 2AEYA 1IILA 4TLPA 2F2FC 2ADEA 1TP0A 2EXIA 1A8DA 2D1ZA 3FJ8A 3WATA 1XYFA 1HCDA 3HOMA 3R67A 1JQZA 3H6QA 3KF5A 1ST8A 3CU1B 2AAIB 3LFIA 3LF7A 1OYGA 5D61A 4I4PA 6I1BA 3VSRA 1YTOA 3POKA 4I6IA 3WO2A 3QEDA 3R4YA 1AVXB 2AC1A 3P6JA 1TWMA 4ZKTB 2QQWA 3VWCA 3IAGC 1HWOB 1D0HA 3BYKA 4YOLA 1BA7A 4X3AA 3W9TA 3FUOA 3BYJA 4OEFA 3WPZA 4OWLA 3UJ4A 3HSMA 2DRZA 2AXMA 4USPA 1KNMA 1DLLA 1XG6A 3BAHA 2D7IA 5F8YA 3S8KA 3PMEA 5FIXA 4I37A 5EG6C 1MC9A 4Q9GA 2GO2A 3CA0A 4ZGRB 4QC4A 3WPVA 3FJEA 4ZOTA 1II4A 3C7EA 1RG8A 4GAIA 1PZZA 3FJCA 5G00A 2VSEA 1YI7A 9ILBA 2FFUA 1I1EA 1VKDA 3U75A 2D23A 1S0LA 5AYDA 5JOWA 5FK8A 5FZYA 2QN4A 41BIA 4D47A 4QKSA 1PC8B 3BAUA 3MPPG 1Z2VA 2UUSA 4X38A 4DCKC 4I4SA 4O8NA 2X8FA 4G6MA 1UV4A 5I1BA 3BAVA 4AK7A 3LIHA 4J2YA 4I8MA 1WBAA 4I0YA 3IM5A 3NJ5A 4Z9WB 4IZEA 3KSTA 1AF9A 3WAUA 2YFRA 4U6DA 1CVSA 5BP5A 4COTA 5HPZA 2Z48A 3LDRA 4P0KA 1ITBA 5BOWA 2R9KB 2FDBM 3AH1A 3UD8A 3WA1A 1YBIA 3HMYA 4QO3A 2X8TA 4ONZA 4GP3A 4IHZA 4KEIA 3UGHA 2FO1A 3CU9A 4FFHA 3CA5A 3FJHA 3LLPA 3ZXJA 5JOYA 3BYLA 4NOVA 1EV2A 1W3AA 1TFMB 1WBCA 4MZGB 1V6WA 1G9DA 3C7HA 2HW9A 2NTDA 4I4YA 2OXBA 3OJ2A 4I4OA 3C7GA 1IJTA 3VT1A 3C7OA 3UDAA 1HWPB 4H9WA 3ILAA 2LIEA 1DZDA 4FVVA 1BFBA 1AVAC 1WL7A 1PUUB 5C2MA 1S0BA 3CAHA 4FGFA 1RMLA 1N4KA 4IZXA 4A7YA 1ISXA 4I4QA 4KCAA 4FFIA 1GYDB 3BA5A 3N7KA 1J0SA 2DREA 3OJVA 2IWTB 2X8SA 5FKBA 5FMDA 2D7RA 2FGFA 3NBEA 1BFGA 1RZOB 4UDKA 1DQOA 2QYIB 1FGAA 1QQKA 3OM7A 3SC7X 3C9ZA 3VT2A 3FJ9A 4I4RA 3BAGA 2BEBA 2ZQNA 2NYYA 4OEGA 4QQSA 4R6UB 1Q1UA 3Q7WA 4OW4A 3O4CA 3AJ6A 4WBCA 4IY8A 2K8RA 5EC5A 4G9MA 2VUAA 1QQLA 2BEAA 4J2SA 3N7MA 1IHKA 3LV4A 2I1BA 2QQUA 2HWAA 4ENDA 3IM6A 4ISRA 5BXRA 3PUBA 5BXSA 1YRZA 4N2RA 3UD9A 4JRAA 3CRHA 4G1RA 1ISVA 4A7KA 1ISZA 1JLXA 3H6RA 4O8OA 1TL2A 3FFZA 3FJIA 2Y9FA 7I1BA 2Y9XE 3JRRA 4ZLBB 4ZA3B 4PVIA 4ZFUB 3O3QA 5BXPA 2Z49A 4I7IA 1W3GA 2F8XC 2KI6B 5GLOA 3IM7A 1Y7BA 4JKQA 3WASA 4HR6C 2YFSA 3I29B 1JT5A 4UDGA 1UYPA 1PUMB 3UGGA 4DENA 3K1XA 3O4OA 1UPSA 1JY0A 1M2TB 4GAFA 1IRAX 3SNVA 3BTAA 1YF8B 5JOZA 5D63A 4AN7B 4I4XA 2RSTA 3WPYA 1EVTA 3WMYA 2NM1A 3N0KA 3AZVA 4IQPA 4LO0C 3Q7XA 4G9NA 5AYEA 2VU9A 2YUGA 5FK7A 3BRFA 3AKIA 5FLWA 4ZFYB 5EHAA 1WD3A 3N7JA 3CRGA 3IIRA 2IHOA 1GYEB 4IONA 4L4HA 3OBRA 5DUYA 3ZXGA 2EXHA 1M16A 4FFFA 5DSSB 4L4IA 1F31A 1G82A 1SZ6B 1R8NA 4P0JA 3WMZA 4LO3C 3VUOA 3WN2A 4I2SA 2E4MA 2AEZA 5E24E 4AK5A 5A8CA 3NBNA 4XFTA 3FGMA 1ISWA 3WMUA 5B6SA 1T4QA 1XZZA 3PG0A 4QD2C 1MD6A 3D5ZA 3PIJA 4ZFWB 3CQAA 4KEJA 3P2NA 3QR5A 2EXKA 4U6BA 4MZHA 3KMVA 2DS0A 1BFFA 5BQUC 3I2XA 4KC8A 5GLKA 3FUQA 3R4UA 4JPZA 3WMVA 4MZFB 4KMIA 3CA3A 4KC7A 2D20A 2FFVA 3LDKA 1W18A 4XKIA 1OQLB 1Z0HA 4QALA 2X2SA 1JTCA 4LO7C 4OWKA 3V0AA 4KC3A 1GYHA 1HKNA 3WO4A 1HCEA 1BLDA 4F83A 1G9BA 3E8LC 3HALA 4QKRA 3VEQA 1S0GA 1SR4C 4CJMA 1Q03A 1R8OA 4I1EA 2XOAA 5GAQA 5BVPI 3R4ZA 3AJ5A 2EXJA 4ZBVB 4EQVA 4G6JA 4D0TA 1BFCA 3VSSA 5FNWA 2Q3NB 4LO0A 1Y9MA 4EEEB 1YYNA 2VLCA 3NQHA 1CE7B 3D61A 1TOOA 1WD4A 3S8JA 1HWNB 3AZWA 1BARA 1EPWA 1NZKA 3A22A 5JLVA 3RWKX 3VSFA 3O5WB 2KH2A 3FJKA 3HN1A 3AH4A 5FMBA 1DFQA 1FV2A 3NBCA 4QBCA 3VT0A 4EFQA 3C7FA 2D44A 3PHZA 4N4BA 1I1BA 3OJMA 4UY4A 5C0PA 1Z4SA 3Q7YA 4IY9A 3CA1A 2ZQOA 1TTUA 2WBCA 2WRYA 3HBWA 3LTQA 1PWAA 1QXMA 3P6IA 3P53A 3RMXA 1FN0A 3BAOA 4LO3A 5DZUA 4LO1A 1JT4A 2KKIA 4LO2C 4OUJA 2E4MC 21BIA 4FFGA 1BASA 3FJFA 1JLYA 1FWUA 2B4WA 1XHBA 3O44A 4Q9PA 31BIA 5GLLA 3H6SE 1JT3A 5GLRA 5FZZA 4DEPA 2P39A 4II0A 2LIQA 4F34A 3NBDA 3AKFA 4UDJA 1DIWA 2DRYA 4XFSA 2D22A 4X39A 4P6AA 3JUTA 5BQUA 2MC2A 3D5YA 1JT7A 4OWJA 4QBVA 4XFUA 3ZXDA 5GLPA 2ZR1B 3OBTA 2Y9WC 3BAQA 3FJDA 4J2KA 3LEMA 1DZCA 4X37A 1E0OA 4AK6A 3A07A 4IYBA 5A8DA 1AFCA 1BLAA 3I2AA 3MALA 4HA2A 2VDTA 1AXMA 1S0CA 3ZXLA 3BA4A 3OM5A 1FWVA 3O4DA 1SR4A 4MLGA 4I4VA 1ABRB 3ZX7A 3BRDA 4PVAA 1HWMB 8I1BA 4P0LA 3AKGA 1FV3A 4JQ0A 5ANNA 2M49A 5JOXA 3AH2A 3CA6A 1L2HA 3OGFA 4ISQA 1G9AA 4UDIA 1IRPA 5D62A 3BB2A 3QZ4A 1V6UA 1ISYA 2RG9B 3RTJB 3FJBA 4EB2B 4KBBA 1S0EA 5B2HA 4D0ZA 3C2UA 3BA7A 4D8HA 3OM6A 2HWMA 3BX1C 5F8SA 3QC2A 1DJSB 2HZ9A 3O4BA 4QD2B 3UD7A 3OGGA 3H6RB 2QQVA 2D43A 1EYLA 2J3PA 2RQ9A 3F62B 5A7VA 3A23A 4Z8SB 2VXRA 4HJJA 2NVHA 3K1UA 3O4AA 2L5XA 3WPUA 4LO2A 4LO1C 3N7LA 3KF3A 1VCLA 4PC4A 3WO3A 3VSZA 4JKXB 3TAWA 3D60A 3A21A 4N2ZA 4LO7B 1S0DA 3BADA 1RY7A 2K4AB 2KLLA 4GOVA 4UDKE 4I3NA 3V0BA 2KI4A 4LO8B 2ERMA 5JMCA 3WINC 4Q91A 1ONKB 1W3FA 1ILR1 1Y9GA 3CA4A 4J23B 1W2TA 3QEEA 3FJJA 1K5UA 1FMZA 2D24A 3OM2A 1DFCA 3AKHA 3UGFA 1GGPB
chains in the Genus database with same CATH topology
5GLNA 4N1IA 2F2FA 3PIGA 5FNXA 4EKXB 1S0FA 2ADDA 2NP0A 4J2XA 5AYCA 1AVUA 5F90A 3UJ0A 3WN1A 1FQ9A 1K5VA 4GOYA 4JAWA 5A7VB 4GP0A 2MIBA 3F1RA 2ESUA 3O49A 2Q9XA 2K43A 2VSAA 3WN0A 2NS2A 2NZ9A 2AQZA 3BYNA 1IOBA 2ET2A 2MLLB 1PT2A 2Y9GA 4KEKA 5BXTA 3OM4A 3V0BB 4USOA 4I1BA 5GLMA 1IT0A 3FJAA 3TC2A 2XQRA 1V6XA 4H75A 3T8SA 2GZBA 3ZXKA 5FZUA 1NUNA 1Q04A 2P23A 4EFRA 3R4SA 3RMYA 3RTIB 4H04A 3BRGC 1YXWA 2X2TA 4EFPA 3ZC8A 1T9FA 1TWEA 2YFTA 3U14A 4I4UA 4JP0A 2AFGA 4A7ZA 1V6VA 3QYDA 3V0AB 5DVHA 4OEEA 1G9CA 1FMMS 1YIFA 5FKCA 1HIBA 4AN6A 1P63A 3EF2A 1Y4WA 1DQGA 3LIGA 3WINA 3B9UA 5AY9A 3CRIA 2VXTI 3D7WB 4O8PA 1TIEA 3V79C 4KCBA 5B6TA 3ZC9A 4I96A 2BFHA 5FMCA 5GLQA 3QEFA 5F8WA 1AVWB 3RSJA 5BP5C 2AEYA 1IILA 4TLPA 2F2FC 2ADEA 1TP0A 2EXIA 1A8DA 2D1ZA 3FJ8A 3WATA 1XYFA 1HCDA 3HOMA 3R67A 1JQZA 3H6QA 3KF5A 1ST8A 3CU1B 2AAIB 3LFIA 3LF7A 1OYGA 5D61A 4I4PA 6I1BA 3VSRA 1YTOA 3POKA 4I6IA 3WO2A 3QEDA 3R4YA 1AVXB 2AC1A 3P6JA 1TWMA 4ZKTB 2QQWA 3VWCA 3IAGC 1HWOB 1D0HA 3BYKA 4YOLA 1BA7A 4X3AA 3W9TA 3FUOA 3BYJA 4OEFA 3WPZA 4OWLA 3UJ4A 3HSMA 2DRZA 2AXMA 4USPA 1KNMA 1DLLA 1XG6A 3BAHA 2D7IA 5F8YA 3S8KA 3PMEA 5FIXA 4I37A 5EG6C 1MC9A 4Q9GA 2GO2A 3CA0A 4ZGRB 4QC4A 3WPVA 3FJEA 4ZOTA 1II4A 3C7EA 1RG8A 4GAIA 1PZZA 3FJCA 5G00A 2VSEA 1YI7A 9ILBA 2FFUA 1I1EA 1VKDA 3U75A 2D23A 1S0LA 5AYDA 5JOWA 5FK8A 5FZYA 2QN4A 41BIA 4D47A 4QKSA 1PC8B 3BAUA 3MPPG 1Z2VA 2UUSA 4X38A 4DCKC 4I4SA 4O8NA 2X8FA 4G6MA 1UV4A 5I1BA 3BAVA 4AK7A 3LIHA 4J2YA 4I8MA 1WBAA 4I0YA 3IM5A 3NJ5A 4Z9WB 4IZEA 3KSTA 1AF9A 3WAUA 2YFRA 4U6DA 1CVSA 5BP5A 4COTA 5HPZA 2Z48A 3LDRA 4P0KA 1ITBA 5BOWA 2R9KB 2FDBM 3AH1A 3UD8A 3WA1A 1YBIA 3HMYA 4QO3A 2X8TA 4ONZA 4GP3A 4IHZA 4KEIA 3UGHA 2FO1A 3CU9A 4FFHA 3CA5A 3FJHA 3LLPA 3ZXJA 5JOYA 3BYLA 4NOVA 1EV2A 1W3AA 1TFMB 1WBCA 4MZGB 1V6WA 1G9DA 3C7HA 2HW9A 2NTDA 4I4YA 2OXBA 3OJ2A 4I4OA 3C7GA 1IJTA 3VT1A 3C7OA 3UDAA 1HWPB 4H9WA 3ILAA 2LIEA 1DZDA 4FVVA 1BFBA 1AVAC 1WL7A 1PUUB 1S0BA 3CAHA 4FGFA 1RMLA 1N4KA 4IZXA 4A7YA 1ISXA 4I4QA 4KCAA 4FFIA 1GYDB 3BA5A 3N7KA 1J0SA 2DREA 3OJVA 2IWTB 2X8SA 5FKBA 5FMDA 2D7RA 2FGFA 3NBEA 1BFGA 1RZOB 4UDKA 1DQOA 2QYIB 1FGAA 1QQKA 3OM7A 3SC7X 3C9ZA 3VT2A 3FJ9A 4I4RA 3BAGA 2BEBA 2ZQNA 2NYYA 4OEGA 4QQSA 4R6UB 1Q1UA 3Q7WA 4OW4A 3O4CA 3AJ6A 4WBCA 4IY8A 2K8RA 5EC5A 4G9MA 2VUAA 1QQLA 2BEAA 4J2SA 3N7MA 1IHKA 3LV4A 2I1BA 2QQUA 2HWAA 4ENDA 3IM6A 4ISRA 5BXRA 3PUBA 5BXSA 1YRZA 4N2RA 3UD9A 4JRAA 3CRHA 4G1RA 1ISVA 4A7KA 1ISZA 1JLXA 3H6RA 4O8OA 3FFZA 3FJIA 2Y9FA 7I1BA 2Y9XE 3JRRA 4ZLBB 4ZA3B 4PVIA 4ZFUB 3O3QA 5BXPA 2Z49A 4I7IA 1W3GA 2F8XC 2KI6B 5GLOA 3IM7A 1Y7BA 4JKQA 3WASA 4HR6C 2YFSA 3I29B 1JT5A 4UDGA 1UYPA 1PUMB 3UGGA 4DENA 3K1XA 3O4OA 1UPSA 1JY0A 1M2TB 4GAFA 1IRAX 3SNVA 3BTAA 1YF8B 5JOZA 5D63A 4AN7B 4I4XA 2RSTA 3WPYA 1EVTA 3WMYA 2NM1A 3N0KA 3AZVA 4IQPA 4LO0C 3Q7XA 4G9NA 5AYEA 2VU9A 2YUGA 5FK7A 3BRFA 3AKIA 5FLWA 4ZFYB 5EHAA 1WD3A 3N7JA 3CRGA 3IIRA 2IHOA 1GYEB 4IONA 4L4HA 3OBRA 5DUYA 3ZXGA 2EXHA 1M16A 4FFFA 5DSSB 4L4IA 1F31A 1G82A 1SZ6B 1R8NA 4P0JA 3WMZA 4LO3C 3VUOA 3WN2A 4I2SA 2E4MA 2AEZA 5E24E 4AK5A 5A8CA 3NBNA 4XFTA 3FGMA 1ISWA 3WMUA 5B6SA 1T4QA 1XZZA 3PG0A 4QD2C 1MD6A 3D5ZA 3PIJA 4ZFWB 3CQAA 4KEJA 3P2NA 3QR5A 2EXKA 4U6BA 4MZHA 3KMVA 2DS0A 1BFFA 5BQUC 3I2XA 4KC8A 5GLKA 3FUQA 3R4UA 4JPZA 3WMVA 4MZFB 4KMIA 3CA3A 4KC7A 2D20A 2FFVA 3LDKA 1W18A 4XKIA 1OQLB 1Z0HA 4QALA 2X2SA 1JTCA 4LO7C 4OWKA 3V0AA 4KC3A 1GYHA 1HKNA 3WO4A 1HCEA 1BLDA 4F83A 1G9BA 3E8LC 3HALA 4QKRA 3VEQA 1S0GA 1SR4C 4CJMA 1Q03A 1R8OA 4I1EA 2XOAA 5GAQA 5BVPI 3R4ZA 3AJ5A 2EXJA 4ZBVB 4EQVA 4G6JA 4D0TA 1BFCA 3VSSA 5FNWA 2Q3NB 4LO0A 1Y9MA 4EEEB 1YYNA 2VLCA 3NQHA 1CE7B 3D61A 1TOOA 1WD4A 3S8JA 1HWNB 3AZWA 1BARA 1EPWA 1NZKA 3A22A 5JLVA 3RWKX 3VSFA 3O5WB 2KH2A 3FJKA 3HN1A 3AH4A 5FMBA 1DFQA 1FV2A 3NBCA 4QBCA 3VT0A 4EFQA 3C7FA 2D44A 3PHZA 4N4BA 1I1BA 3OJMA 4UY4A 5C0PA 1Z4SA 3Q7YA 4IY9A 3CA1A 2ZQOA 1TTUA 2WBCA 2WRYA 3HBWA 3LTQA 1PWAA 1QXMA 3P6IA 3P53A 3RMXA 1FN0A 3BAOA 4LO3A 5DZUA 4LO1A 1JT4A 2KKIA 4LO2C 4OUJA 2E4MC 21BIA 4FFGA 1BASA 3FJFA 1JLYA 1FWUA 2B4WA 1XHBA 3O44A 4Q9PA 31BIA 5GLLA 3H6SE 1JT3A 5GLRA 5FZZA 4DEPA 2P39A 4II0A 2LIQA 4F34A 3NBDA 3AKFA 4UDJA 1DIWA 2DRYA 4XFSA 2D22A 4X39A 4P6AA 3JUTA 5BQUA 2MC2A 3D5YA 1JT7A 4OWJA 4QBVA 4XFUA 3ZXDA 5GLPA 2ZR1B 3OBTA 2Y9WC 3BAQA 3FJDA 4J2KA 3LEMA 1DZCA 4X37A 1E0OA 4AK6A 3A07A 4IYBA 5A8DA 1AFCA 1BLAA 3I2AA 3MALA 4HA2A 2VDTA 1AXMA 1S0CA 3ZXLA 3BA4A 3OM5A 1FWVA 3O4DA 1SR4A 4MLGA 4I4VA 1ABRB 3ZX7A 3BRDA 4PVAA 1HWMB 8I1BA 4P0LA 3AKGA 1FV3A 4JQ0A 5ANNA 2M49A 5JOXA 3AH2A 3CA6A 1L2HA 3OGFA 4ISQA 1G9AA 4UDIA 1IRPA 5D62A 3BB2A 3QZ4A 1V6UA 1ISYA 2RG9B 3RTJB 3FJBA 4EB2B 4KBBA 1S0EA 5B2HA 4D0ZA 3C2UA 3BA7A 4D8HA 3OM6A 2HWMA 3BX1C 5F8SA 3QC2A 1DJSB 2HZ9A 3O4BA 4QD2B 3UD7A 3OGGA 3H6RB 2QQVA 2D43A 1EYLA 2J3PA 2RQ9A 3F62B 5A7VA 3A23A 4Z8SB 2VXRA 4HJJA 2NVHA 3K1UA 3O4AA 2L5XA 3WPUA 4LO2A 4LO1C 3N7LA 3KF3A 1VCLA 4PC4A 3WO3A 3VSZA 4JKXB 3TAWA 3D60A 3A21A 4N2ZA 4LO7B 1S0DA 3BADA 1RY7A 2K4AB 2KLLA 4GOVA 4UDKE 4I3NA 3V0BA 2KI4A 4LO8B 2ERMA 5JMCA 3WINC 4Q91A 1ONKB 1W3FA 1ILR1 1Y9GA 3CA4A 4J23B 1W2TA 3QEEA 3FJJA 1K5UA 1FMZA 2D24A 3OM2A 1DFCA 3AKHA 3UGFA 1GGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLN A;  4N1I A;  2F2F A;  3PIG A;  5FNX A;  4EKX B;  1S0F A;  2ADD A;  2NP0 A;  4J2X A;  5AYC A;  1AVU A;  5F90 A;  3UJ0 A;  3WN1 A;  1FQ9 A;  1K5V A;  4GOY A;  4JAW A;  5A7V B;  4GP0 A;  2MIB A;  3F1R A;  2ESU A;  3O49 A;  2Q9X A;  2K43 A;  2VSA A;  3WN0 A;  2NZ9 A;  2AQZ A;  3BYN A;  1IOB A;  2ET2 A;  2MLL B;  1PT2 A;  2Y9G A;  4KEK A;  5BXT A;  3OM4 A;  3V0B B;  4USO A;  4I1B A;  5GLM A;  1IT0 A;  3FJA A;  3TC2 A;  2XQR A;  1V6X A;  3T8S A;  2GZB A;  3ZXK A;  5FZU A;  1NUN A;  1Q04 A;  2P23 A;  4EFR A;  3R4S A;  3RMY A;  3RTI B;  4H04 A;  3BRG C;  1YXW A;  2X2T A;  4EFP A;  3ZC8 A;  1T9F A;  1TWE A;  2YFT A;  3U14 A;  4I4U A;  4JP0 A;  2AFG A;  4A7Z A;  1V6V A;  3QYD A;  3V0A B;  5DVH A;  4OEE A;  1G9C A;  1FMM S;  1YIF A;  5FKC A;  1HIB A;  4AN6 A;  1P63 A;  3EF2 A;  1Y4W A;  1DQG A;  3LIG A;  3WIN A;  3B9U A;  5AY9 A;  3CRI A;  2VXT I;  3D7W B;  4O8P A;  1TIE A;  3V79 C;  4KCB A;  5B6T A;  3ZC9 A;  4I96 A;  2BFH A;  5FMC A;  5GLQ A;  3QEF A;  5F8W A;  1AVW B;  3RSJ A;  5BP5 C;  2AEY A;  1IIL A;  4TLP A;  2F2F C;  2ADE A;  1TP0 A;  2EXI A;  1A8D A;  2D1Z A;  3FJ8 A;  3WAT A;  1XYF A;  1HCD A;  3HOM A;  3R67 A;  1JQZ A;  3H6Q A;  3KF5 A;  1ST8 A;  3CU1 B;  2AAI B;  3LFI A;  3LF7 A;  1OYG A;  5D61 A;  4I4P A;  6I1B A;  3VSR A;  1YTO A;  3POK A;  4I6I A;  3WO2 A;  3QED A;  3R4Y A;  1AVX B;  2AC1 A;  3P6J A;  1TWM A;  4ZKT B;  2QQW A;  3VWC A;  3IAG C;  1HWO B;  1D0H A;  3BYK A;  4YOL A;  1BA7 A;  4X3A A;  3W9T A;  3FUO A;  3BYJ A;  4OEF A;  3WPZ A;  4OWL A;  3UJ4 A;  3HSM A;  2DRZ A;  2AXM A;  4USP A;  1KNM A;  1DLL A;  1XG6 A;  3BAH A;  2D7I A;  5F8Y A;  3S8K A;  3PME A;  5FIX A;  4I37 A;  5EG6 C;  1MC9 A;  4Q9G A;  2GO2 A;  3CA0 A;  4ZGR B;  4QC4 A;  3WPV A;  3FJE A;  4ZOT A;  1II4 A;  3C7E A;  1RG8 A;  4GAI A;  1PZZ A;  3FJC A;  5G00 A;  2VSE A;  1YI7 A;  9ILB A;  2FFU A;  1I1E A;  1VKD A;  3U75 A;  2D23 A;  1S0L A;  5AYD A;  5JOW A;  5FK8 A;  5FZY A;  2QN4 A;  41BI A;  4D47 A;  4QKS A;  1PC8 B;  3BAU A;  3MPP G;  1Z2V A;  2UUS A;  4X38 A;  4DCK C;  4I4S A;  4O8N A;  2X8F A;  4G6M A;  1UV4 A;  5I1B A;  3BAV A;  4AK7 A;  3LIH A;  4J2Y A;  4I8M A;  1WBA A;  4I0Y A;  3IM5 A;  3NJ5 A;  4Z9W B;  4IZE A;  3KST A;  1AF9 A;  3WAU A;  2YFR A;  4U6D A;  1CVS A;  5BP5 A;  4COT A;  5HPZ A;  2Z48 A;  3LDR A;  4P0K A;  1ITB A;  5BOW A;  2R9K B;  2FDB M;  3AH1 A;  3UD8 A;  3WA1 A;  1YBI A;  3HMY A;  4QO3 A;  2X8T A;  4ONZ A;  4GP3 A;  4IHZ A;  4KEI A;  3UGH A;  2FO1 A;  3CU9 A;  4FFH A;  3CA5 A;  3FJH A;  3LLP A;  3ZXJ A;  5JOY A;  3BYL A;  4NOV A;  1EV2 A;  1W3A A;  1TFM B;  1WBC A;  1V6W A;  1G9D A;  3C7H A;  2HW9 A;  2NTD A;  4I4Y A;  2OXB A;  3OJ2 A;  4I4O A;  3C7G A;  1IJT A;  3VT1 A;  3C7O A;  3UDA A;  1HWP B;  4H9W A;  3ILA A;  2LIE A;  1DZD A;  4FVV A;  1BFB A;  1AVA C;  1WL7 A;  1PUU B;  1S0B A;  3CAH A;  4FGF A;  1RML A;  1N4K A;  4IZX A;  4A7Y A;  1ISX A;  4I4Q A;  4KCA A;  4FFI A;  1GYD B;  3BA5 A;  3N7K A;  1J0S A;  2DRE A;  3OJV A;  2IWT B;  2X8S A;  5FKB A;  5FMD A;  2D7R A;  2FGF A;  3NBE A;  1BFG A;  1RZO B;  4UDK A;  1DQO A;  2QYI B;  1FGA A;  1QQK A;  3OM7 A;  3SC7 X;  3C9Z A;  3VT2 A;  3FJ9 A;  4I4R A;  3BAG A;  2BEB A;  2ZQN A;  2NYY A;  4OEG A;  4QQS A;  4R6U B;  1Q1U A;  3Q7W A;  4OW4 A;  3O4C A;  3AJ6 A;  4WBC A;  4IY8 A;  2K8R A;  5EC5 A;  4G9M A;  2VUA A;  1QQL A;  2BEA A;  4J2S A;  3N7M A;  1IHK A;  3LV4 A;  2I1B A;  2QQU A;  2HWA A;  4END A;  3IM6 A;  4ISR A;  5BXR A;  3PUB A;  5BXS A;  1YRZ A;  4N2R A;  3UD9 A;  4JRA A;  3CRH A;  4G1R A;  1ISV A;  4A7K A;  1ISZ A;  1JLX A;  3H6R A;  4O8O A;  3FFZ A;  3FJI A;  2Y9F A;  7I1B A;  2Y9X E;  3JRR A;  4ZLB B;  4ZA3 B;  4PVI A;  4ZFU B;  3O3Q A;  5BXP A;  2Z49 A;  4I7I A;  1W3G A;  2F8X C;  2KI6 B;  5GLO A;  3IM7 A;  1Y7B A;  4JKQ A;  3WAS A;  4HR6 C;  2YFS A;  3I29 B;  1JT5 A;  4UDG A;  1UYP A;  1PUM B;  3UGG A;  4DEN A;  3K1X A;  3O4O A;  1UPS A;  1JY0 A;  1M2T B;  4GAF A;  1IRA X;  3SNV A;  3BTA A;  1YF8 B;  5JOZ A;  5D63 A;  4AN7 B;  4I4X A;  2RST A;  3WPY A;  1EVT A;  3WMY A;  2NM1 A;  3N0K A;  3AZV A;  4IQP A;  4LO0 C;  3Q7X A;  4G9N A;  5AYE A;  2VU9 A;  2YUG A;  5FK7 A;  3BRF A;  3AKI A;  5FLW A;  4ZFY B;  5EHA A;  1WD3 A;  3N7J A;  3CRG A;  3IIR A;  2IHO A;  1GYE B;  4ION A;  4L4H A;  3OBR A;  5DUY A;  3ZXG A;  2EXH A;  1M16 A;  4FFF A;  5DSS B;  4L4I A;  1F31 A;  1G82 A;  1SZ6 B;  1R8N A;  4P0J A;  3WMZ A;  4LO3 C;  3VUO A;  3WN2 A;  4I2S A;  2E4M A;  2AEZ A;  5E24 E;  4AK5 A;  5A8C A;  3NBN A;  4XFT A;  3FGM A;  1ISW A;  3WMU A;  5B6S A;  1T4Q A;  1XZZ A;  3PG0 A;  4QD2 C;  1MD6 A;  3D5Z A;  3PIJ A;  4ZFW B;  3CQA A;  4KEJ A;  3P2N A;  3QR5 A;  2EXK A;  4U6B A;  3KMV A;  2DS0 A;  1BFF A;  5BQU C;  3I2X A;  4KC8 A;  5GLK A;  3FUQ A;  3R4U A;  4JPZ A;  3WMV A;  4KMI A;  3CA3 A;  4KC7 A;  2D20 A;  2FFV A;  3LDK A;  1W18 A;  4XKI A;  1OQL B;  1Z0H A;  4QAL A;  2X2S A;  1JTC A;  4LO7 C;  4OWK A;  3V0A A;  4KC3 A;  1GYH A;  1HKN A;  3WO4 A;  1HCE A;  1BLD A;  4F83 A;  1G9B A;  3E8L C;  3HAL A;  4QKR A;  3VEQ A;  1S0G A;  1SR4 C;  4CJM A;  1Q03 A;  1R8O A;  4I1E A;  2XOA A;  5GAQ A;  5BVP I;  3R4Z A;  3AJ5 A;  2EXJ A;  4ZBV B;  4EQV A;  4G6J A;  4D0T A;  1BFC A;  3VSS A;  5FNW A;  2Q3N B;  4LO0 A;  1Y9M A;  4EEE B;  1YYN A;  2VLC A;  3NQH A;  1CE7 B;  3D61 A;  1TOO A;  1WD4 A;  3S8J A;  1HWN B;  3AZW A;  1BAR A;  1EPW A;  1NZK A;  3A22 A;  5JLV A;  3RWK X;  3VSF A;  3O5W B;  2KH2 A;  3FJK A;  3HN1 A;  3AH4 A;  5FMB A;  1DFQ A;  1FV2 A;  3NBC A;  4QBC A;  3VT0 A;  4EFQ A;  3C7F A;  2D44 A;  3PHZ A;  4N4B A;  1I1B A;  3OJM A;  5C0P A;  1Z4S A;  3Q7Y A;  4IY9 A;  3CA1 A;  2ZQO A;  1TTU A;  2WBC A;  2WRY A;  3HBW A;  3LTQ A;  1PWA A;  1QXM A;  3P6I A;  3P53 A;  3RMX A;  1FN0 A;  3BAO A;  4LO3 A;  5DZU A;  4LO1 A;  1JT4 A;  2KKI A;  4LO2 C;  4OUJ A;  2E4M C;  21BI A;  4FFG A;  1BAS A;  3FJF A;  1JLY A;  1FWU A;  2B4W A;  1XHB A;  3O44 A;  4Q9P A;  31BI A;  5GLL A;  3H6S E;  1JT3 A;  5GLR A;  5FZZ A;  4DEP A;  2P39 A;  4II0 A;  2LIQ A;  4F34 A;  3NBD A;  3AKF A;  4UDJ A;  1DIW A;  2DRY A;  4XFS A;  2D22 A;  4X39 A;  4P6A A;  3JUT A;  5BQU A;  2MC2 A;  3D5Y A;  1JT7 A;  4OWJ A;  4QBV A;  4XFU A;  3ZXD A;  5GLP A;  2ZR1 B;  3OBT A;  2Y9W C;  3BAQ A;  3FJD A;  4J2K A;  3LEM A;  1DZC A;  4X37 A;  1E0O A;  4AK6 A;  3A07 A;  4IYB A;  5A8D A;  1AFC A;  1BLA A;  3I2A A;  3MAL A;  4HA2 A;  2VDT A;  1AXM A;  1S0C A;  3ZXL A;  3BA4 A;  3OM5 A;  1FWV A;  3O4D A;  1SR4 A;  4MLG A;  4I4V A;  1ABR B;  3ZX7 A;  3BRD A;  4PVA A;  1HWM B;  8I1B A;  4P0L A;  3AKG A;  1FV3 A;  4JQ0 A;  5ANN A;  2M49 A;  5JOX A;  3AH2 A;  3CA6 A;  1L2H A;  3OGF A;  4ISQ A;  1G9A A;  4UDI A;  1IRP A;  5D62 A;  3BB2 A;  3QZ4 A;  1V6U A;  1ISY A;  2RG9 B;  3RTJ B;  3FJB A;  4EB2 B;  4KBB A;  1S0E A;  5B2H A;  4D0Z A;  3C2U A;  3BA7 A;  4D8H A;  3OM6 A;  2HWM A;  3BX1 C;  5F8S A;  3QC2 A;  1DJS B;  2HZ9 A;  3O4B A;  4QD2 B;  3UD7 A;  3OGG A;  3H6R B;  2QQV A;  2D43 A;  1EYL A;  2J3P A;  2RQ9 A;  3F62 B;  5A7V A;  3A23 A;  4Z8S B;  2VXR A;  4HJJ A;  2NVH A;  3K1U A;  3O4A A;  2L5X A;  3WPU A;  4LO2 A;  4LO1 C;  3N7L A;  3KF3 A;  1VCL A;  4PC4 A;  3WO3 A;  3VSZ A;  4JKX B;  3TAW A;  3D60 A;  3A21 A;  4N2Z A;  4LO7 B;  1S0D A;  3BAD A;  1RY7 A;  2K4A B;  2KLL A;  4GOV A;  4UDK E;  4I3N A;  3V0B A;  2KI4 A;  4LO8 B;  2ERM A;  5JMC A;  3WIN C;  4Q91 A;  1ONK B;  1W3F A;  1ILR 1;  1Y9G A;  3CA4 A;  4J23 B;  1W2T A;  3QEE A;  3FJJ A;  1K5U A;  1FMZ A;  2D24 A;  3OM2 A;  1DFC A;  3AKH A;  3UGF A;  1GGP B; 
#chains in the Genus database with same CATH topology
 5GLN A;  4N1I A;  2F2F A;  3PIG A;  5FNX A;  4EKX B;  1S0F A;  2ADD A;  2NP0 A;  4J2X A;  5AYC A;  1AVU A;  5F90 A;  3UJ0 A;  3WN1 A;  1FQ9 A;  1K5V A;  4GOY A;  4JAW A;  5A7V B;  4GP0 A;  2MIB A;  3F1R A;  2ESU A;  3O49 A;  2Q9X A;  2K43 A;  2VSA A;  3WN0 A;  2NS2 A;  2NZ9 A;  2AQZ A;  3BYN A;  1IOB A;  2ET2 A;  2MLL B;  1PT2 A;  2Y9G A;  4KEK A;  5BXT A;  3OM4 A;  3V0B B;  4USO A;  4I1B A;  5GLM A;  1IT0 A;  3FJA A;  3TC2 A;  2XQR A;  1V6X A;  4H75 A;  3T8S A;  2GZB A;  3ZXK A;  5FZU A;  1NUN A;  1Q04 A;  2P23 A;  4EFR A;  3R4S A;  3RMY A;  3RTI B;  4H04 A;  3BRG C;  1YXW A;  2X2T A;  4EFP A;  3ZC8 A;  1T9F A;  1TWE A;  2YFT A;  3U14 A;  4I4U A;  4JP0 A;  2AFG A;  4A7Z A;  1V6V A;  3QYD A;  3V0A B;  5DVH A;  4OEE A;  1G9C A;  1FMM S;  1YIF A;  5FKC A;  1HIB A;  4AN6 A;  1P63 A;  3EF2 A;  1Y4W A;  1DQG A;  3LIG A;  3WIN A;  3B9U A;  5AY9 A;  3CRI A;  2VXT I;  3D7W B;  4O8P A;  1TIE A;  3V79 C;  4KCB A;  5B6T A;  3ZC9 A;  4I96 A;  2BFH A;  5FMC A;  5GLQ A;  3QEF A;  5F8W A;  1AVW B;  3RSJ A;  5BP5 C;  2AEY A;  1IIL A;  4TLP A;  2F2F C;  2ADE A;  1TP0 A;  2EXI A;  1A8D A;  2D1Z A;  3FJ8 A;  3WAT A;  1XYF A;  1HCD A;  3HOM A;  3R67 A;  1JQZ A;  3H6Q A;  3KF5 A;  1ST8 A;  3CU1 B;  2AAI B;  3LFI A;  3LF7 A;  1OYG A;  5D61 A;  4I4P A;  6I1B A;  3VSR A;  1YTO A;  3POK A;  4I6I A;  3WO2 A;  3QED A;  3R4Y A;  1AVX B;  2AC1 A;  3P6J A;  1TWM A;  4ZKT B;  2QQW A;  3VWC A;  3IAG C;  1HWO B;  1D0H A;  3BYK A;  4YOL A;  1BA7 A;  4X3A A;  3W9T A;  3FUO A;  3BYJ A;  4OEF A;  3WPZ A;  4OWL A;  3UJ4 A;  3HSM A;  2DRZ A;  2AXM A;  4USP A;  1KNM A;  1DLL A;  1XG6 A;  3BAH A;  2D7I A;  5F8Y A;  3S8K A;  3PME A;  5FIX A;  4I37 A;  5EG6 C;  1MC9 A;  4Q9G A;  2GO2 A;  3CA0 A;  4ZGR B;  4QC4 A;  3WPV A;  3FJE A;  4ZOT A;  1II4 A;  3C7E A;  1RG8 A;  4GAI A;  1PZZ A;  3FJC A;  5G00 A;  2VSE A;  1YI7 A;  9ILB A;  2FFU A;  1I1E A;  1VKD A;  3U75 A;  2D23 A;  1S0L A;  5AYD A;  5JOW A;  5FK8 A;  5FZY A;  2QN4 A;  41BI A;  4D47 A;  4QKS A;  1PC8 B;  3BAU A;  3MPP G;  1Z2V A;  2UUS A;  4X38 A;  4DCK C;  4I4S A;  4O8N A;  2X8F A;  4G6M A;  1UV4 A;  5I1B A;  3BAV A;  4AK7 A;  3LIH A;  4J2Y A;  4I8M A;  1WBA A;  4I0Y A;  3IM5 A;  3NJ5 A;  4Z9W B;  4IZE A;  3KST A;  1AF9 A;  3WAU A;  2YFR A;  4U6D A;  1CVS A;  5BP5 A;  4COT A;  5HPZ A;  2Z48 A;  3LDR A;  4P0K A;  1ITB A;  5BOW A;  2R9K B;  2FDB M;  3AH1 A;  3UD8 A;  3WA1 A;  1YBI A;  3HMY A;  4QO3 A;  2X8T A;  4ONZ A;  4GP3 A;  4IHZ A;  4KEI A;  3UGH A;  2FO1 A;  3CU9 A;  4FFH A;  3CA5 A;  3FJH A;  3LLP A;  3ZXJ A;  5JOY A;  3BYL A;  4NOV A;  1EV2 A;  1W3A A;  1TFM B;  1WBC A;  4MZG B;  1V6W A;  1G9D A;  3C7H A;  2HW9 A;  2NTD A;  4I4Y A;  2OXB A;  3OJ2 A;  4I4O A;  3C7G A;  1IJT A;  3VT1 A;  3C7O A;  3UDA A;  1HWP B;  4H9W A;  3ILA A;  2LIE A;  1DZD A;  4FVV A;  1BFB A;  1AVA C;  1WL7 A;  1PUU B;  5C2M A;  1S0B A;  3CAH A;  4FGF A;  1RML A;  1N4K A;  4IZX A;  4A7Y A;  1ISX A;  4I4Q A;  4KCA A;  4FFI A;  1GYD B;  3BA5 A;  3N7K A;  1J0S A;  2DRE A;  3OJV A;  2IWT B;  2X8S A;  5FKB A;  5FMD A;  2D7R A;  2FGF A;  3NBE A;  1BFG A;  1RZO B;  4UDK A;  1DQO A;  2QYI B;  1FGA A;  1QQK A;  3OM7 A;  3SC7 X;  3C9Z A;  3VT2 A;  3FJ9 A;  4I4R A;  3BAG A;  2BEB A;  2ZQN A;  2NYY A;  4OEG A;  4QQS A;  4R6U B;  1Q1U A;  3Q7W A;  4OW4 A;  3O4C A;  3AJ6 A;  4WBC A;  4IY8 A;  2K8R A;  5EC5 A;  4G9M A;  2VUA A;  1QQL A;  2BEA A;  4J2S A;  3N7M A;  1IHK A;  3LV4 A;  2I1B A;  2QQU A;  2HWA A;  4END A;  3IM6 A;  4ISR A;  5BXR A;  3PUB A;  5BXS A;  1YRZ A;  4N2R A;  3UD9 A;  4JRA A;  3CRH A;  4G1R A;  1ISV A;  4A7K A;  1ISZ A;  1JLX A;  3H6R A;  4O8O A;  1TL2 A;  3FFZ A;  3FJI A;  2Y9F A;  7I1B A;  2Y9X E;  3JRR A;  4ZLB B;  4ZA3 B;  4PVI A;  4ZFU B;  3O3Q A;  5BXP A;  2Z49 A;  4I7I A;  1W3G A;  2F8X C;  2KI6 B;  5GLO A;  3IM7 A;  1Y7B A;  4JKQ A;  3WAS A;  4HR6 C;  2YFS A;  3I29 B;  1JT5 A;  4UDG A;  1UYP A;  1PUM B;  3UGG A;  4DEN A;  3K1X A;  3O4O A;  1UPS A;  1JY0 A;  1M2T B;  4GAF A;  1IRA X;  3SNV A;  3BTA A;  1YF8 B;  5JOZ A;  5D63 A;  4AN7 B;  4I4X A;  2RST A;  3WPY A;  1EVT A;  3WMY A;  2NM1 A;  3N0K A;  3AZV A;  4IQP A;  4LO0 C;  3Q7X A;  4G9N A;  5AYE A;  2VU9 A;  2YUG A;  5FK7 A;  3BRF A;  3AKI A;  5FLW A;  4ZFY B;  5EHA A;  1WD3 A;  3N7J A;  3CRG A;  3IIR A;  2IHO A;  1GYE B;  4ION A;  4L4H A;  3OBR A;  5DUY A;  3ZXG A;  2EXH A;  1M16 A;  4FFF A;  5DSS B;  4L4I A;  1F31 A;  1G82 A;  1SZ6 B;  1R8N A;  4P0J A;  3WMZ A;  4LO3 C;  3VUO A;  3WN2 A;  4I2S A;  2E4M A;  2AEZ A;  5E24 E;  4AK5 A;  5A8C A;  3NBN A;  4XFT A;  3FGM A;  1ISW A;  3WMU A;  5B6S A;  1T4Q A;  1XZZ A;  3PG0 A;  4QD2 C;  1MD6 A;  3D5Z A;  3PIJ A;  4ZFW B;  3CQA A;  4KEJ A;  3P2N A;  3QR5 A;  2EXK A;  4U6B A;  4MZH A;  3KMV A;  2DS0 A;  1BFF A;  5BQU C;  3I2X A;  4KC8 A;  5GLK A;  3FUQ A;  3R4U A;  4JPZ A;  3WMV A;  4MZF B;  4KMI A;  3CA3 A;  4KC7 A;  2D20 A;  2FFV A;  3LDK A;  1W18 A;  4XKI A;  1OQL B;  1Z0H A;  4QAL A;  2X2S A;  1JTC A;  4LO7 C;  4OWK A;  3V0A A;  4KC3 A;  1GYH A;  1HKN A;  3WO4 A;  1HCE A;  1BLD A;  4F83 A;  1G9B A;  3E8L C;  3HAL A;  4QKR A;  3VEQ A;  1S0G A;  1SR4 C;  4CJM A;  1Q03 A;  1R8O A;  4I1E A;  2XOA A;  5GAQ A;  5BVP I;  3R4Z A;  3AJ5 A;  2EXJ A;  4ZBV B;  4EQV A;  4G6J A;  4D0T A;  1BFC A;  3VSS A;  5FNW A;  2Q3N B;  4LO0 A;  1Y9M A;  4EEE B;  1YYN A;  2VLC A;  3NQH A;  1CE7 B;  3D61 A;  1TOO A;  1WD4 A;  3S8J A;  1HWN B;  3AZW A;  1BAR A;  1EPW A;  1NZK A;  3A22 A;  5JLV A;  3RWK X;  3VSF A;  3O5W B;  2KH2 A;  3FJK A;  3HN1 A;  3AH4 A;  5FMB A;  1DFQ A;  1FV2 A;  3NBC A;  4QBC A;  3VT0 A;  4EFQ A;  3C7F A;  2D44 A;  3PHZ A;  4N4B A;  1I1B A;  3OJM A;  4UY4 A;  5C0P A;  1Z4S A;  3Q7Y A;  4IY9 A;  3CA1 A;  2ZQO A;  1TTU A;  2WBC A;  2WRY A;  3HBW A;  3LTQ A;  1PWA A;  1QXM A;  3P6I A;  3P53 A;  3RMX A;  1FN0 A;  3BAO A;  4LO3 A;  5DZU A;  4LO1 A;  1JT4 A;  2KKI A;  4LO2 C;  4OUJ A;  2E4M C;  21BI A;  4FFG A;  1BAS A;  3FJF A;  1JLY A;  1FWU A;  2B4W A;  1XHB A;  3O44 A;  4Q9P A;  31BI A;  5GLL A;  3H6S E;  1JT3 A;  5GLR A;  5FZZ A;  4DEP A;  2P39 A;  4II0 A;  2LIQ A;  4F34 A;  3NBD A;  3AKF A;  4UDJ A;  1DIW A;  2DRY A;  4XFS A;  2D22 A;  4X39 A;  4P6A A;  3JUT A;  5BQU A;  2MC2 A;  3D5Y A;  1JT7 A;  4OWJ A;  4QBV A;  4XFU A;  3ZXD A;  5GLP A;  2ZR1 B;  3OBT A;  2Y9W C;  3BAQ A;  3FJD A;  4J2K A;  3LEM A;  1DZC A;  4X37 A;  1E0O A;  4AK6 A;  3A07 A;  4IYB A;  5A8D A;  1AFC A;  1BLA A;  3I2A A;  3MAL A;  4HA2 A;  2VDT A;  1AXM A;  1S0C A;  3ZXL A;  3BA4 A;  3OM5 A;  1FWV A;  3O4D A;  1SR4 A;  4MLG A;  4I4V A;  1ABR B;  3ZX7 A;  3BRD A;  4PVA A;  1HWM B;  8I1B A;  4P0L A;  3AKG A;  1FV3 A;  4JQ0 A;  5ANN A;  2M49 A;  5JOX A;  3AH2 A;  3CA6 A;  1L2H A;  3OGF A;  4ISQ A;  1G9A A;  4UDI A;  1IRP A;  5D62 A;  3BB2 A;  3QZ4 A;  1V6U A;  1ISY A;  2RG9 B;  3RTJ B;  3FJB A;  4EB2 B;  4KBB A;  1S0E A;  5B2H A;  4D0Z A;  3C2U A;  3BA7 A;  4D8H A;  3OM6 A;  2HWM A;  3BX1 C;  5F8S A;  3QC2 A;  1DJS B;  2HZ9 A;  3O4B A;  4QD2 B;  3UD7 A;  3OGG A;  3H6R B;  2QQV A;  2D43 A;  1EYL A;  2J3P A;  2RQ9 A;  3F62 B;  5A7V A;  3A23 A;  4Z8S B;  2VXR A;  4HJJ A;  2NVH A;  3K1U A;  3O4A A;  2L5X A;  3WPU A;  4LO2 A;  4LO1 C;  3N7L A;  3KF3 A;  1VCL A;  4PC4 A;  3WO3 A;  3VSZ A;  4JKX B;  3TAW A;  3D60 A;  3A21 A;  4N2Z A;  4LO7 B;  1S0D A;  3BAD A;  1RY7 A;  2K4A B;  2KLL A;  4GOV A;  4UDK E;  4I3N A;  3V0B A;  2KI4 A;  4LO8 B;  2ERM A;  5JMC A;  3WIN C;  4Q91 A;  1ONK B;  1W3F A;  1ILR 1;  1Y9G A;  3CA4 A;  4J23 B;  1W2T A;  3QEE A;  3FJJ A;  1K5U A;  1FMZ A;  2D24 A;  3OM2 A;  1DFC A;  3AKH A;  3UGF A;  1GGP B; 
#chains in the Genus database with same CATH homology
 5GLN A;  4N1I A;  2F2F A;  3PIG A;  5FNX A;  4EKX B;  1S0F A;  2ADD A;  2NP0 A;  4J2X A;  5AYC A;  1AVU A;  5F90 A;  3UJ0 A;  3WN1 A;  1FQ9 A;  1K5V A;  4GOY A;  4JAW A;  5A7V B;  4GP0 A;  2MIB A;  3F1R A;  2ESU A;  3O49 A;  2Q9X A;  2K43 A;  2VSA A;  3WN0 A;  2NS2 A;  2NZ9 A;  2AQZ A;  3BYN A;  1IOB A;  2ET2 A;  2MLL B;  1PT2 A;  2Y9G A;  4KEK A;  5BXT A;  3OM4 A;  3V0B B;  4USO A;  4I1B A;  5GLM A;  1IT0 A;  3FJA A;  3TC2 A;  2XQR A;  1V6X A;  4H75 A;  3T8S A;  2GZB A;  3ZXK A;  5FZU A;  1NUN A;  1Q04 A;  2P23 A;  4EFR A;  3R4S A;  3RMY A;  3RTI B;  4H04 A;  3BRG C;  1YXW A;  2X2T A;  4EFP A;  3ZC8 A;  1T9F A;  1TWE A;  2YFT A;  3U14 A;  4I4U A;  4JP0 A;  2AFG A;  4A7Z A;  1V6V A;  3QYD A;  3V0A B;  5DVH A;  4OEE A;  1G9C A;  1FMM S;  1YIF A;  5FKC A;  1HIB A;  4AN6 A;  1P63 A;  3EF2 A;  1Y4W A;  1DQG A;  3LIG A;  3WIN A;  3B9U A;  5AY9 A;  3CRI A;  2VXT I;  3D7W B;  4O8P A;  1TIE A;  3V79 C;  4KCB A;  5B6T A;  3ZC9 A;  4I96 A;  2BFH A;  5FMC A;  5GLQ A;  3QEF A;  5F8W A;  1AVW B;  3RSJ A;  5BP5 C;  2AEY A;  1IIL A;  4TLP A;  2F2F C;  2ADE A;  1TP0 A;  2EXI A;  1A8D A;  2D1Z A;  3FJ8 A;  3WAT A;  1XYF A;  1HCD A;  3HOM A;  3R67 A;  1JQZ A;  3H6Q A;  3KF5 A;  1ST8 A;  3CU1 B;  2AAI B;  3LFI A;  3LF7 A;  1OYG A;  5D61 A;  4I4P A;  6I1B A;  3VSR A;  1YTO A;  3POK A;  4I6I A;  3WO2 A;  3QED A;  3R4Y A;  1AVX B;  2AC1 A;  3P6J A;  1TWM A;  4ZKT B;  2QQW A;  3VWC A;  3IAG C;  1HWO B;  1D0H A;  3BYK A;  4YOL A;  1BA7 A;  4X3A A;  3W9T A;  3FUO A;  3BYJ A;  4OEF A;  3WPZ A;  4OWL A;  3UJ4 A;  3HSM A;  2DRZ A;  2AXM A;  4USP A;  1KNM A;  1DLL A;  1XG6 A;  3BAH A;  2D7I A;  5F8Y A;  3S8K A;  3PME A;  5FIX A;  4I37 A;  5EG6 C;  1MC9 A;  4Q9G A;  2GO2 A;  3CA0 A;  4ZGR B;  4QC4 A;  3WPV A;  3FJE A;  4ZOT A;  1II4 A;  3C7E A;  1RG8 A;  4GAI A;  1PZZ A;  3FJC A;  5G00 A;  2VSE A;  1YI7 A;  9ILB A;  2FFU A;  1I1E A;  1VKD A;  3U75 A;  2D23 A;  1S0L A;  5AYD A;  5JOW A;  5FK8 A;  5FZY A;  2QN4 A;  41BI A;  4D47 A;  4QKS A;  1PC8 B;  3BAU A;  3MPP G;  1Z2V A;  2UUS A;  4X38 A;  4DCK C;  4I4S A;  4O8N A;  2X8F A;  4G6M A;  1UV4 A;  5I1B A;  3BAV A;  4AK7 A;  3LIH A;  4J2Y A;  4I8M A;  1WBA A;  4I0Y A;  3IM5 A;  3NJ5 A;  4Z9W B;  4IZE A;  3KST A;  1AF9 A;  3WAU A;  2YFR A;  4U6D A;  1CVS A;  5BP5 A;  4COT A;  5HPZ A;  2Z48 A;  3LDR A;  4P0K A;  1ITB A;  5BOW A;  2R9K B;  2FDB M;  3AH1 A;  3UD8 A;  3WA1 A;  1YBI A;  3HMY A;  4QO3 A;  2X8T A;  4ONZ A;  4GP3 A;  4IHZ A;  4KEI A;  3UGH A;  2FO1 A;  3CU9 A;  4FFH A;  3CA5 A;  3FJH A;  3LLP A;  3ZXJ A;  5JOY A;  3BYL A;  4NOV A;  1EV2 A;  1W3A A;  1TFM B;  1WBC A;  4MZG B;  1V6W A;  1G9D A;  3C7H A;  2HW9 A;  2NTD A;  4I4Y A;  2OXB A;  3OJ2 A;  4I4O A;  3C7G A;  1IJT A;  3VT1 A;  3C7O A;  3UDA A;  1HWP B;  4H9W A;  3ILA A;  2LIE A;  1DZD A;  4FVV A;  1BFB A;  1AVA C;  1WL7 A;  1PUU B;  1S0B A;  3CAH A;  4FGF A;  1RML A;  1N4K A;  4IZX A;  4A7Y A;  1ISX A;  4I4Q A;  4KCA A;  4FFI A;  1GYD B;  3BA5 A;  3N7K A;  1J0S A;  2DRE A;  3OJV A;  2IWT B;  2X8S A;  5FKB A;  5FMD A;  2D7R A;  2FGF A;  3NBE A;  1BFG A;  1RZO B;  4UDK A;  1DQO A;  2QYI B;  1FGA A;  1QQK A;  3OM7 A;  3SC7 X;  3C9Z A;  3VT2 A;  3FJ9 A;  4I4R A;  3BAG A;  2BEB A;  2ZQN A;  2NYY A;  4OEG A;  4QQS A;  4R6U B;  1Q1U A;  3Q7W A;  4OW4 A;  3O4C A;  3AJ6 A;  4WBC A;  4IY8 A;  2K8R A;  5EC5 A;  4G9M A;  2VUA A;  1QQL A;  2BEA A;  4J2S A;  3N7M A;  1IHK A;  3LV4 A;  2I1B A;  2QQU A;  2HWA A;  4END A;  3IM6 A;  4ISR A;  5BXR A;  3PUB A;  5BXS A;  1YRZ A;  4N2R A;  3UD9 A;  4JRA A;  3CRH A;  4G1R A;  1ISV A;  4A7K A;  1ISZ A;  1JLX A;  3H6R A;  4O8O A;  3FFZ A;  3FJI A;  2Y9F A;  7I1B A;  2Y9X E;  3JRR A;  4ZLB B;  4ZA3 B;  4PVI A;  4ZFU B;  3O3Q A;  5BXP A;  2Z49 A;  4I7I A;  1W3G A;  2F8X C;  2KI6 B;  5GLO A;  3IM7 A;  1Y7B A;  4JKQ A;  3WAS A;  4HR6 C;  2YFS A;  3I29 B;  1JT5 A;  4UDG A;  1UYP A;  1PUM B;  3UGG A;  4DEN A;  3K1X A;  3O4O A;  1UPS A;  1JY0 A;  1M2T B;  4GAF A;  1IRA X;  3SNV A;  3BTA A;  1YF8 B;  5JOZ A;  5D63 A;  4AN7 B;  4I4X A;  2RST A;  3WPY A;  1EVT A;  3WMY A;  2NM1 A;  3N0K A;  3AZV A;  4IQP A;  4LO0 C;  3Q7X A;  4G9N A;  5AYE A;  2VU9 A;  2YUG A;  5FK7 A;  3BRF A;  3AKI A;  5FLW A;  4ZFY B;  5EHA A;  1WD3 A;  3N7J A;  3CRG A;  3IIR A;  2IHO A;  1GYE B;  4ION A;  4L4H A;  3OBR A;  5DUY A;  3ZXG A;  2EXH A;  1M16 A;  4FFF A;  5DSS B;  4L4I A;  1F31 A;  1G82 A;  1SZ6 B;  1R8N A;  4P0J A;  3WMZ A;  4LO3 C;  3VUO A;  3WN2 A;  4I2S A;  2E4M A;  2AEZ A;  5E24 E;  4AK5 A;  5A8C A;  3NBN A;  4XFT A;  3FGM A;  1ISW A;  3WMU A;  5B6S A;  1T4Q A;  1XZZ A;  3PG0 A;  4QD2 C;  1MD6 A;  3D5Z A;  3PIJ A;  4ZFW B;  3CQA A;  4KEJ A;  3P2N A;  3QR5 A;  2EXK A;  4U6B A;  4MZH A;  3KMV A;  2DS0 A;  1BFF A;  5BQU C;  3I2X A;  4KC8 A;  5GLK A;  3FUQ A;  3R4U A;  4JPZ A;  3WMV A;  4MZF B;  4KMI A;  3CA3 A;  4KC7 A;  2D20 A;  2FFV A;  3LDK A;  1W18 A;  4XKI A;  1OQL B;  1Z0H A;  4QAL A;  2X2S A;  1JTC A;  4LO7 C;  4OWK A;  3V0A A;  4KC3 A;  1GYH A;  1HKN A;  3WO4 A;  1HCE A;  1BLD A;  4F83 A;  1G9B A;  3E8L C;  3HAL A;  4QKR A;  3VEQ A;  1S0G A;  1SR4 C;  4CJM A;  1Q03 A;  1R8O A;  4I1E A;  2XOA A;  5GAQ A;  5BVP I;  3R4Z A;  3AJ5 A;  2EXJ A;  4ZBV B;  4EQV A;  4G6J A;  4D0T A;  1BFC A;  3VSS A;  5FNW A;  2Q3N B;  4LO0 A;  1Y9M A;  4EEE B;  1YYN A;  2VLC A;  3NQH A;  1CE7 B;  3D61 A;  1TOO A;  1WD4 A;  3S8J A;  1HWN B;  3AZW A;  1BAR A;  1EPW A;  1NZK A;  3A22 A;  5JLV A;  3RWK X;  3VSF A;  3O5W B;  2KH2 A;  3FJK A;  3HN1 A;  3AH4 A;  5FMB A;  1DFQ A;  1FV2 A;  3NBC A;  4QBC A;  3VT0 A;  4EFQ A;  3C7F A;  2D44 A;  3PHZ A;  4N4B A;  1I1B A;  3OJM A;  4UY4 A;  5C0P A;  1Z4S A;  3Q7Y A;  4IY9 A;  3CA1 A;  2ZQO A;  1TTU A;  2WBC A;  2WRY A;  3HBW A;  3LTQ A;  1PWA A;  1QXM A;  3P6I A;  3P53 A;  3RMX A;  1FN0 A;  3BAO A;  4LO3 A;  5DZU A;  4LO1 A;  1JT4 A;  2KKI A;  4LO2 C;  4OUJ A;  2E4M C;  21BI A;  4FFG A;  1BAS A;  3FJF A;  1JLY A;  1FWU A;  2B4W A;  1XHB A;  3O44 A;  4Q9P A;  31BI A;  5GLL A;  3H6S E;  1JT3 A;  5GLR A;  5FZZ A;  4DEP A;  2P39 A;  4II0 A;  2LIQ A;  4F34 A;  3NBD A;  3AKF A;  4UDJ A;  1DIW A;  2DRY A;  4XFS A;  2D22 A;  4X39 A;  4P6A A;  3JUT A;  5BQU A;  2MC2 A;  3D5Y A;  1JT7 A;  4OWJ A;  4QBV A;  4XFU A;  3ZXD A;  5GLP A;  2ZR1 B;  3OBT A;  2Y9W C;  3BAQ A;  3FJD A;  4J2K A;  3LEM A;  1DZC A;  4X37 A;  1E0O A;  4AK6 A;  3A07 A;  4IYB A;  5A8D A;  1AFC A;  1BLA A;  3I2A A;  3MAL A;  4HA2 A;  2VDT A;  1AXM A;  1S0C A;  3ZXL A;  3BA4 A;  3OM5 A;  1FWV A;  3O4D A;  1SR4 A;  4MLG A;  4I4V A;  1ABR B;  3ZX7 A;  3BRD A;  4PVA A;  1HWM B;  8I1B A;  4P0L A;  3AKG A;  1FV3 A;  4JQ0 A;  5ANN A;  2M49 A;  5JOX A;  3AH2 A;  3CA6 A;  1L2H A;  3OGF A;  4ISQ A;  1G9A A;  4UDI A;  1IRP A;  5D62 A;  3BB2 A;  3QZ4 A;  1V6U A;  1ISY A;  2RG9 B;  3RTJ B;  3FJB A;  4EB2 B;  4KBB A;  1S0E A;  5B2H A;  4D0Z A;  3C2U A;  3BA7 A;  4D8H A;  3OM6 A;  2HWM A;  3BX1 C;  5F8S A;  3QC2 A;  1DJS B;  2HZ9 A;  3O4B A;  4QD2 B;  3UD7 A;  3OGG A;  3H6R B;  2QQV A;  2D43 A;  1EYL A;  2J3P A;  2RQ9 A;  3F62 B;  5A7V A;  3A23 A;  4Z8S B;  2VXR A;  4HJJ A;  2NVH A;  3K1U A;  3O4A A;  2L5X A;  3WPU A;  4LO2 A;  4LO1 C;  3N7L A;  3KF3 A;  1VCL A;  4PC4 A;  3WO3 A;  3VSZ A;  4JKX B;  3TAW A;  3D60 A;  3A21 A;  4N2Z A;  4LO7 B;  1S0D A;  3BAD A;  1RY7 A;  2K4A B;  2KLL A;  4GOV A;  4UDK E;  4I3N A;  3V0B A;  2KI4 A;  4LO8 B;  2ERM A;  5JMC A;  3WIN C;  4Q91 A;  1ONK B;  1W3F A;  1ILR 1;  1Y9G A;  3CA4 A;  4J23 B;  1W2T A;  3QEE A;  3FJJ A;  1K5U A;  1FMZ A;  2D24 A;  3OM2 A;  1DFC A;  3AKH A;  3UGF A;  1GGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...