3VT1A

Crystal structure of ct1,3gal43a in complex with galactose
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 128
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt1A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt1A01
4UDIA 3BRFA 3BYKA 4U6DA 4O8OA 2MIBA 1HWNB 4DEPA 3V79C 1BA7A 1IRAX 1RZOB 3FJIA 2QQWA 1S0LA 1Q03A 4IZXA 1IOBA 4KC3A 1FWVA 3VT2A 1JT5A 2HZ9A 3OGGA 4ZKTB 1Y4WA 5GLKA 2NM1A 3QZ4A 5C0PA 3WPZA 3MALA 3BA7A 3O4AA 4TLPA 3JUTA 2NZ9A 3OJMA 5G00A 3FJCA 3H6SE 4I4VA 1K5UA 2EXKA 1QQKA 3AH2A 5HPZA 2YFRA 1MC9A 3QEFA 3FUOA 1DQGA 3HBWA 3ZXGA 4D0TA 4I3NA 1GYDB 4D8HA 3CA0A 4L4IA 3SNVA 3VEQA 5BP5C 5I1BA 2E4MA 1GGPB 4ZA3B 1HCDA 1JLYA 3OM5A 3AKIA 1YIFA 1FMZA 1DIWA 4OEGA 5JOXA 2P23A 3HMYA 5AYDA 3Q7XA 5DVHA 4ISRA 5FMBA 3P6JA 2QQUA 3BTAA 1V6WA 4EFQA 2ADEA 3QR5A 2VSAA 3POKA 3AKGA 4UDGA 5FZZA 1RMLA 5FIXA 3CA1A 4IY8A 2KLLA 4AK7A 4NOVA 1G9DA 3CQAA 3CRGA 4AK6A 3NBCA 1DJSB 2I1BA 1YXWA 1W2TA 3AJ6A 2D7RA 5GLQA 1DFCA 2Y9WC 1OQLB 2VXRA 3LLPA 1DLLA 3ZC8A 4I4QA 5EG6C 3VSRA 1HWOB 4UDKE 1JLXA 2KI6B 1IHKA 1S0EA 4FVVA 4WBCA 3LIGA 1FV2A 1HWMB 2F2FC 3PIJA 3BAOA 3LTQA 3C9ZA 1IILA 1EYLA 1V6UA 5F90A 1FMMS 3QYDA 4EFRA 5JOYA 4I4UA 2Q3NB 2XQRA 3HSMA 3AKHA 3TC2A 4J23B 1P63A 1N4KA 1YTOA 4J2KA 1EPWA 1JT4A 1BLDA 3CAHA 1II4A 4GOVA 2AFGA 4I1BA 3WO4A 2HWAA 3BB2A 1S0BA 2RG9B 4I2SA 5A7VA 3SC7X 2WRYA 4HR6C 2YFSA 3D5YA 3UGFA 2NYYA 4COTA 1AF9A 1D0HA 2L5XA 3CU1B 3D7WB 2YUGA 3I2XA 4I37A 3P53A 5FK7A 1ILR1 1PWAA 3WMVA 5GLOA 5AY9A 5GLMA 3O4OA 1ISVA 4QBCA 1XZZA 4KC7A 2ZQOA 3RMYA 2WBCA 1FV3A 1NUNA 2K8RA 5DZUA 2BFHA 3FJAA 3BX1C 1UYPA 4JKXB 2E4MC 3ZX7A 3QEDA 5F8WA 3CA6A 3P2NA 4AN6A 2AQZA 4FFIA 2D22A 4CJMA 2QYIB 1AVAC 2FGFA 4I4OA 3FJHA 1S0GA 4KEKA 4G9NA 5A8DA 2Z49A 4I8MA 3BAUA 3PUBA 3OBTA 3K1UA 1K5VA 4JP0A 3BYLA 3O3QA 2F8XC 1DQOA 3A22A 3BRDA 1WL7A 1CE7B 1JQZA 1W3AA 3ZXKA 1BASA 3FJ9A 3FJ8A 4QO3A 3WPUA 3C7OA 5FNXA 2D24A 2HW9A 1G82A 3BAVA 1SR4A 4IONA 3VT1A 1DZCA 1Y9GA 3NQHA 3QEEA 1WD4A 5B6TA 3VSFA 1RY7A 21BIA 2IHOA 5DUYA 3BYJA 3IAGC 4I7IA 2GZBA 4PC4A 1XG6A 3WINA 1HIBA 4HJJA 3IM5A 3KSTA 3IM7A 2KI4A 3ZXDA 4L4HA 3KF3A 2NVHA 4OWLA 3NBDA 2YFTA 1HKNA 2J3PA 1Z2VA 3BA4A 1JTCA 4II0A 4N2RA 4FFHA 1PT2A 3BAGA 2D20A 4DENA 3UDAA 4P0KA 2LIQA 1AXMA 5EHAA 4Q9GA 1TIEA 3O4BA 3D60A 4P0LA 3V0AB 4IHZA 1VKDA 3EF2A 3LDRA 1Z4SA 2MLLB 2FO1A 3UD8A 5E24E 1FN0A 2Z48A 4PVAA 3NBEA 3S8KA 3AH4A 4MLGA 4N2ZA 1W3FA 4EFPA 3CA3A 3NJ5A 3LFIA 3VSZA 3A21A 1BFGA 1V6VA 3KF5A 4DCKC 2ZR1B 2FDBM 1WBCA 2Q9XA 1FGAA 3R4SA 1W18A 4A7KA 1Y9MA 3OM2A 3W9TA 1T9FA 2X8FA 2DS0A 4I4RA 2OXBA 3ZC9A 1TFMB 3OM7A 4ZOTA 3WMYA 3V0BA 4XKIA 5BQUA 5BXSA 2LIEA 3OM4A 3O49A 2KH2A 3OM6A 4HA2A 1I1EA 3VSSA 9ILBA 2QQVA 3A07A 1PUMB 1ISWA 1BLAA 4IQPA 3BAHA 2EXIA 4J2SA 1GYEB 3T8SA 1KNMA 3WAUA 5BXTA 2NTDA 4OEFA 4EEEB 2D1ZA 3UD9A 2EXHA 3IIRA 4IY9A 2D23A 5FZYA 4D47A 4Z8SB 5JMCA 4QC4A 1ST8A 2M49A 1SR4C 7I1BA 3WATA 5BVPI 2BEAA 1BFBA 3O4DA 1AVXB 2GO2A 3WINC 3C7EA 4GOYA 4OUJA 4QKRA 3Q7YA 2BEBA 4IYBA 4P6AA 4X3AA 6I1BA 3FGMA 1Q1UA 5FNWA 4EKXB 3R4UA 5F8SA 4O8NA 4I4SA 2DREA 1V6XA 3C2UA 2AAIB 2VUAA 5AYCA 5A7VB 5GLRA 2K43A 3KMVA 2D44A 1AFCA 1R8NA 4LO0A 3AH1A 3LF7A 4JQ0A 3U14A 4I4XA 1S0DA 2QN4A 3WN2A 3HN1A 1DFQA 3OJVA 2X8SA 2VXTI 3OBRA 3PMEA 3UJ0A 4AN7B 5GLLA 1HWPB 3A23A 5GLPA 1S0CA 4J2YA 1TOOA 1EV2A 4R6UB 4OEEA 3VWCA 4ZFYB 2Y9XE 1BARA 1YBIA 5B6SA 2AEZA 3VT0A 3HOMA 1HCEA 3H6RB 1ITBA 3FJDA 1BFCA 3FFZA 4FFGA 1PUUB 4X38A 5DSSB 3LEMA 1J0SA 2AC1A 3C7HA 2ERMA 4USOA 3WMUA 4LO3C 5BQUC 5BOWA 4I6IA 3F62B 3D5ZA 1Z0HA 4I4YA 3K1XA 3CRHA 3D61A 4KEJA 2FFUA 5A8CA 5EC5A 2K4AB 3FUQA 2VLCA 3PG0A 8I1BA 4N4BA 3WASA 3BA5A 4F34A 1YRZA 2X2SA 1NZKA 4OWJA 1R8OA 1YF8B 4ENDA 3RTJB 1JT7A 3N7LA 4JRAA 1YI7A 2B4WA 3OGFA 3N0KA 4LO2A 1S0FA 3WN0A 4QD2C 1Q04A 3UD7A 5D61A 4LO7C 5D63A 4ZBVB 3CA5A 4FFFA 4GP0A 1AVWB 4G6JA 2ZQNA 4I1EA 1IRPA 2P39A 1QXMA 4UDJA 4OWKA 4KCBA 4Z9WB 4N1IA 4KCAA 3ZXLA 1XHBA 2RQ9A 3OJ2A 3I29B 2Y9GA 3CA4A 1TP0A 4ONZA 5FLWA 4H04A 4I96A 3LIHA 4KC8A 3V0AA 1DZDA 2X2TA 4EQVA 3R67A 1XYFA 1TWMA 3BAQA 4X37A 3WPVA 3H6QA 5JOWA 5BXRA 3FJKA 4P0JA 4GAFA 2DRZA 4LO0C 3AJ5A 3RSJA 2Y9FA 4G6MA 2IWTB 1I1BA 3BADA 3BRGC 3N7KA 3CRIA 4I4PA 4A7YA 4XFUA 1G9AA 1AVUA 3PHZA 4LO3A 5FZUA 3JRRA 5JLVA 1RG8A 1L2HA 1M16A 3F1RA 2D7IA 2HWMA 1WD3A 3FJFA 3WA1A 3VUOA 3UGHA 1T4QA 5GAQA 3IM6A 41BIA 2DRYA 4Q91A 3N7JA 4LO1A 4ISQA 5D62A 3E8LC 3V0BB 5GLNA 1E0OA 2D43A 2XOAA 1IJTA 3I2AA 3QC2A 2MC2A 3AZVA 2R9KB 4ZGRB 1Y7BA 1VCLA 2ESUA 1FWUA 4YOLA 1OYGA 4ZFWB 5FMCA 3R4ZA 1SZ6B 3ILAA 5FK8A 1IT0A 3FJJA 1BFFA 4XFTA 2VDTA 3N7MA 1W3GA 4PVIA 5AYEA 4UDKA 1ABRB 3S8JA 2RSTA 2VU9A 4F83A 4QD2B 4JKQA 5BXPA 4LO2C 4LO7B 1F31A 3R4YA 3U75A 3BYNA 1JY0A 4KEIA 3ZXJA 3O4CA 5FMDA 3AZWA 1A8DA 1ISZA 5FKBA 3UGGA 4J2XA 3HALA 2UUSA 3CU9A 5F8YA 4X39A 2ADDA 4GP3A 1WBAA 1ISYA 1UV4A 4FGFA 4I0YA 4OW4A 31BIA 3O5WB 4QBVA 3AKFA 4G9MA 3NBNA 5BP5A 1QQLA 3FJEA 3Q7WA 2X8TA 3LV4A 2FFVA 1TWEA 3WO2A 3FJBA 4JAWA 2NP0A 3TAWA 4G1RA 3B9UA 1ONKB 4AK5A 4KBBA 1YYNA 2AXMA 4A7ZA 3LDKA 3WN1A 1GYHA 4EB2B 3RWKX 3WO3A 4QALA 4ZFUB 3RTIB 1G9CA 5JOZA 4Q9PA 4LO8B 2VSEA 4XFSA 3P6IA 5FKCA 3H6RA 1MD6A 4GAIA 4H9WA 4IZEA 1G9BA 1PZZA 4ZLBB 3C7GA 2KKIA 4JPZA 4KMIA 1FQ9A 4QKSA 4U6BA 5ANNA 2ET2A 1UPSA 1TTUA 1PC8B 3MPPG 3UJ4A 4D0ZA 3C7FA 4LO1C 3PIGA 4QQSA 1JT3A 1ISXA 2F2FA 2EXJA 4O8PA 3WMZA 3WPYA 1M2TB 3O44A 4USPA 5B2HA 1EVTA 2AEYA 3RMXA 1CVSA
chains in the Genus database with same CATH superfamily
4UDIA 3BRFA 3BYKA 4U6DA 4O8OA 2MIBA 1HWNB 4DEPA 3V79C 1BA7A 1IRAX 1RZOB 3FJIA 2QQWA 1S0LA 1Q03A 4IZXA 1IOBA 4KC3A 1FWVA 3VT2A 1JT5A 2HZ9A 3OGGA 4ZKTB 1Y4WA 5GLKA 2NM1A 3QZ4A 5C0PA 3WPZA 3MALA 3BA7A 3O4AA 4TLPA 3JUTA 2NZ9A 3OJMA 5G00A 3FJCA 3H6SE 4I4VA 1K5UA 2EXKA 1QQKA 3AH2A 5HPZA 2YFRA 1MC9A 3QEFA 3FUOA 1DQGA 3HBWA 3ZXGA 4D0TA 4I3NA 1GYDB 4D8HA 3CA0A 4L4IA 3SNVA 3VEQA 5BP5C 5I1BA 2E4MA 1GGPB 4ZA3B 1HCDA 1JLYA 3OM5A 3AKIA 1YIFA 1FMZA 1DIWA 4OEGA 5JOXA 2P23A 3HMYA 5AYDA 3Q7XA 5DVHA 4ISRA 5FMBA 3P6JA 2QQUA 3BTAA 1V6WA 4EFQA 2ADEA 3QR5A 2VSAA 3POKA 3AKGA 4UDGA 5FZZA 1RMLA 5FIXA 3CA1A 4IY8A 2KLLA 4AK7A 4NOVA 1G9DA 3CQAA 3CRGA 4AK6A 3NBCA 1DJSB 2I1BA 1YXWA 1W2TA 3AJ6A 2D7RA 5GLQA 1DFCA 2Y9WC 1OQLB 2VXRA 3LLPA 1DLLA 3ZC8A 4I4QA 5EG6C 3VSRA 1HWOB 4UDKE 1JLXA 2KI6B 1IHKA 1S0EA 4FVVA 4WBCA 3LIGA 1FV2A 1HWMB 2F2FC 3PIJA 3BAOA 3LTQA 3C9ZA 1IILA 1EYLA 1V6UA 5F90A 1FMMS 3QYDA 4EFRA 5JOYA 4I4UA 2Q3NB 2XQRA 3HSMA 3AKHA 3TC2A 4J23B 1P63A 1N4KA 1YTOA 4J2KA 1EPWA 1JT4A 1BLDA 3CAHA 1II4A 4GOVA 2AFGA 4I1BA 3WO4A 2HWAA 3BB2A 1S0BA 2RG9B 4I2SA 5A7VA 3SC7X 2WRYA 4HR6C 2YFSA 3D5YA 3UGFA 2NYYA 4COTA 1AF9A 1D0HA 2NS2A 2L5XA 3CU1B 3D7WB 2YUGA 3I2XA 4I37A 3P53A 5FK7A 1ILR1 1PWAA 3WMVA 5GLOA 5AY9A 5GLMA 3O4OA 1ISVA 4QBCA 1XZZA 4KC7A 2ZQOA 3RMYA 2WBCA 1FV3A 1NUNA 2K8RA 5DZUA 2BFHA 3FJAA 3BX1C 1UYPA 4JKXB 2E4MC 3ZX7A 3QEDA 5F8WA 3CA6A 3P2NA 4AN6A 2AQZA 4FFIA 2D22A 4CJMA 2QYIB 1AVAC 2FGFA 4I4OA 3FJHA 1S0GA 4KEKA 4G9NA 5A8DA 2Z49A 4I8MA 3BAUA 3PUBA 3OBTA 3K1UA 1K5VA 4JP0A 3BYLA 3O3QA 2F8XC 1DQOA 3A22A 3BRDA 1WL7A 1CE7B 1JQZA 1W3AA 3ZXKA 1BASA 3FJ9A 3FJ8A 4QO3A 3WPUA 3C7OA 5FNXA 2D24A 2HW9A 1G82A 3BAVA 1SR4A 4IONA 3VT1A 1DZCA 1Y9GA 3NQHA 3QEEA 1WD4A 5B6TA 3VSFA 1RY7A 21BIA 2IHOA 5DUYA 3BYJA 3IAGC 4I7IA 2GZBA 4PC4A 1XG6A 3WINA 1HIBA 4HJJA 3IM5A 3KSTA 3IM7A 2KI4A 3ZXDA 4L4HA 1TL2A 3KF3A 2NVHA 4OWLA 3NBDA 2YFTA 1HKNA 2J3PA 1Z2VA 3BA4A 1JTCA 4II0A 4N2RA 4FFHA 1PT2A 3BAGA 2D20A 4DENA 3UDAA 4P0KA 2LIQA 1AXMA 5EHAA 4MZGB 4Q9GA 1TIEA 3O4BA 3D60A 4P0LA 3V0AB 4IHZA 1VKDA 3EF2A 3LDRA 1Z4SA 2MLLB 2FO1A 3UD8A 5E24E 1FN0A 2Z48A 4PVAA 3NBEA 3S8KA 3AH4A 4MLGA 4N2ZA 1W3FA 4EFPA 3CA3A 3NJ5A 3LFIA 3VSZA 3A21A 1BFGA 1V6VA 3KF5A 4DCKC 2ZR1B 2FDBM 1WBCA 2Q9XA 1FGAA 3R4SA 1W18A 4A7KA 1Y9MA 3OM2A 3W9TA 1T9FA 2X8FA 2DS0A 4I4RA 2OXBA 3ZC9A 1TFMB 3OM7A 4ZOTA 3WMYA 3V0BA 4XKIA 5BQUA 5BXSA 2LIEA 3OM4A 3O49A 2KH2A 3OM6A 4HA2A 1I1EA 3VSSA 9ILBA 2QQVA 3A07A 1PUMB 1ISWA 1BLAA 4IQPA 3BAHA 2EXIA 4J2SA 1GYEB 3T8SA 1KNMA 3WAUA 5BXTA 2NTDA 4OEFA 4EEEB 2D1ZA 3UD9A 2EXHA 3IIRA 4IY9A 2D23A 5FZYA 4D47A 4Z8SB 5JMCA 4QC4A 1ST8A 2M49A 1SR4C 7I1BA 4H75A 3WATA 5BVPI 2BEAA 1BFBA 3O4DA 1AVXB 2GO2A 3WINC 3C7EA 4GOYA 4OUJA 4QKRA 3Q7YA 2BEBA 4IYBA 4P6AA 4X3AA 6I1BA 3FGMA 1Q1UA 5FNWA 4EKXB 3R4UA 5F8SA 4O8NA 4I4SA 2DREA 1V6XA 3C2UA 2AAIB 2VUAA 5AYCA 5A7VB 5GLRA 2K43A 3KMVA 2D44A 1AFCA 1R8NA 4LO0A 3AH1A 3LF7A 4JQ0A 3U14A 4I4XA 1S0DA 2QN4A 3WN2A 3HN1A 1DFQA 3OJVA 2X8SA 2VXTI 3OBRA 3PMEA 3UJ0A 4AN7B 5GLLA 1HWPB 3A23A 5GLPA 1S0CA 4J2YA 1TOOA 1EV2A 4R6UB 4OEEA 3VWCA 4ZFYB 2Y9XE 1BARA 1YBIA 5B6SA 2AEZA 3VT0A 3HOMA 1HCEA 3H6RB 1ITBA 3FJDA 1BFCA 3FFZA 4FFGA 1PUUB 4X38A 5DSSB 3LEMA 1J0SA 2AC1A 3C7HA 2ERMA 4USOA 3WMUA 4LO3C 5BQUC 5BOWA 4I6IA 3F62B 3D5ZA 1Z0HA 4I4YA 3K1XA 3CRHA 3D61A 4KEJA 2FFUA 5A8CA 5EC5A 2K4AB 3FUQA 2VLCA 3PG0A 8I1BA 4N4BA 3WASA 3BA5A 4F34A 1YRZA 2X2SA 1NZKA 4OWJA 1R8OA 1YF8B 4ENDA 3RTJB 1JT7A 3N7LA 4JRAA 1YI7A 2B4WA 3OGFA 3N0KA 4LO2A 1S0FA 3WN0A 4QD2C 1Q04A 3UD7A 5D61A 4LO7C 5D63A 4ZBVB 3CA5A 4FFFA 4GP0A 1AVWB 4G6JA 2ZQNA 4I1EA 1IRPA 2P39A 1QXMA 4UDJA 4OWKA 4KCBA 4Z9WB 4N1IA 4KCAA 3ZXLA 1XHBA 2RQ9A 3OJ2A 3I29B 2Y9GA 3CA4A 1TP0A 4ONZA 5FLWA 4H04A 4I96A 3LIHA 4KC8A 3V0AA 1DZDA 2X2TA 4EQVA 3R67A 1XYFA 1TWMA 3BAQA 4X37A 3WPVA 3H6QA 5JOWA 5BXRA 3FJKA 4P0JA 4GAFA 2DRZA 4LO0C 3AJ5A 3RSJA 2Y9FA 4G6MA 2IWTB 1I1BA 3BADA 3BRGC 3N7KA 3CRIA 4UY4A 4I4PA 4A7YA 4XFUA 1G9AA 1AVUA 3PHZA 4LO3A 5FZUA 3JRRA 5JLVA 1RG8A 1L2HA 1M16A 3F1RA 5C2MA 2D7IA 2HWMA 1WD3A 3FJFA 3WA1A 3VUOA 3UGHA 1T4QA 5GAQA 3IM6A 41BIA 2DRYA 4Q91A 3N7JA 4LO1A 4ISQA 5D62A 3E8LC 3V0BB 5GLNA 1E0OA 2D43A 2XOAA 1IJTA 3I2AA 3QC2A 2MC2A 3AZVA 2R9KB 4ZGRB 1Y7BA 1VCLA 2ESUA 1FWUA 4YOLA 1OYGA 4ZFWB 5FMCA 3R4ZA 1SZ6B 3ILAA 5FK8A 1IT0A 3FJJA 1BFFA 4XFTA 2VDTA 3N7MA 1W3GA 4PVIA 5AYEA 4UDKA 1ABRB 3S8JA 2RSTA 2VU9A 4F83A 4QD2B 4JKQA 5BXPA 4LO2C 4LO7B 1F31A 3R4YA 3U75A 3BYNA 1JY0A 4KEIA 3ZXJA 3O4CA 4MZFB 5FMDA 3AZWA 1A8DA 1ISZA 5FKBA 3UGGA 4J2XA 3HALA 2UUSA 3CU9A 5F8YA 4X39A 2ADDA 4GP3A 1WBAA 4MZHA 1ISYA 1UV4A 4FGFA 4I0YA 4OW4A 31BIA 3O5WB 4QBVA 3AKFA 4G9MA 3NBNA 5BP5A 1QQLA 3FJEA 3Q7WA 2X8TA 3LV4A 2FFVA 1TWEA 3WO2A 3FJBA 4JAWA 2NP0A 3TAWA 4G1RA 3B9UA 1ONKB 4AK5A 4KBBA 1YYNA 2AXMA 4A7ZA 3LDKA 3WN1A 1GYHA 4EB2B 3RWKX 3WO3A 4QALA 4ZFUB 3RTIB 1G9CA 5JOZA 4Q9PA 4LO8B 2VSEA 4XFSA 3P6IA 5FKCA 3H6RA 1MD6A 4GAIA 4H9WA 4IZEA 1G9BA 1PZZA 4ZLBB 3C7GA 2KKIA 4JPZA 4KMIA 1FQ9A 4QKSA 4U6BA 5ANNA 2ET2A 1UPSA 1TTUA 1PC8B 3MPPG 3UJ4A 4D0ZA 3C7FA 4LO1C 3PIGA 4QQSA 1JT3A 1ISXA 2F2FA 2EXJA 4O8PA 3WMZA 3WPYA 1M2TB 3O44A 4USPA 5B2HA 1EVTA 2AEYA 3RMXA 1CVSA
chains in the Genus database with same CATH topology
4UDIA 3BRFA 3BYKA 4U6DA 4O8OA 2MIBA 1HWNB 4DEPA 3V79C 1BA7A 1IRAX 1RZOB 3FJIA 2QQWA 1S0LA 1Q03A 4IZXA 1IOBA 4KC3A 1FWVA 3VT2A 1JT5A 2HZ9A 3OGGA 4ZKTB 1Y4WA 5GLKA 2NM1A 3QZ4A 5C0PA 3WPZA 3MALA 3BA7A 3O4AA 4TLPA 3JUTA 2NZ9A 3OJMA 5G00A 3FJCA 3H6SE 4I4VA 1K5UA 2EXKA 1QQKA 3AH2A 5HPZA 2YFRA 1MC9A 3QEFA 3FUOA 1DQGA 3HBWA 3ZXGA 4D0TA 4I3NA 1GYDB 4D8HA 3CA0A 4L4IA 3SNVA 3VEQA 5BP5C 5I1BA 2E4MA 1GGPB 4ZA3B 1HCDA 1JLYA 3OM5A 3AKIA 1YIFA 1FMZA 1DIWA 4OEGA 5JOXA 2P23A 3HMYA 5AYDA 3Q7XA 5DVHA 4ISRA 5FMBA 3P6JA 2QQUA 3BTAA 1V6WA 4EFQA 2ADEA 3QR5A 2VSAA 3POKA 3AKGA 4UDGA 5FZZA 1RMLA 5FIXA 3CA1A 4IY8A 2KLLA 4AK7A 4NOVA 1G9DA 3CQAA 3CRGA 4AK6A 3NBCA 1DJSB 2I1BA 1YXWA 1W2TA 3AJ6A 2D7RA 5GLQA 1DFCA 2Y9WC 1OQLB 2VXRA 3LLPA 1DLLA 3ZC8A 4I4QA 5EG6C 3VSRA 1HWOB 4UDKE 1JLXA 2KI6B 1IHKA 1S0EA 4FVVA 4WBCA 3LIGA 1FV2A 1HWMB 2F2FC 3PIJA 3BAOA 3LTQA 3C9ZA 1IILA 1EYLA 1V6UA 5F90A 1FMMS 3QYDA 4EFRA 5JOYA 4I4UA 2Q3NB 2XQRA 3HSMA 3AKHA 3TC2A 4J23B 1P63A 1N4KA 1YTOA 4J2KA 1EPWA 1JT4A 1BLDA 3CAHA 1II4A 4GOVA 2AFGA 4I1BA 3WO4A 2HWAA 3BB2A 1S0BA 2RG9B 4I2SA 5A7VA 3SC7X 2WRYA 4HR6C 2YFSA 3D5YA 3UGFA 2NYYA 4COTA 1AF9A 1D0HA 2NS2A 2L5XA 3CU1B 3D7WB 2YUGA 3I2XA 4I37A 3P53A 5FK7A 1ILR1 1PWAA 3WMVA 5GLOA 5AY9A 5GLMA 3O4OA 1ISVA 4QBCA 1XZZA 4KC7A 2ZQOA 3RMYA 2WBCA 1FV3A 1NUNA 2K8RA 5DZUA 2BFHA 3FJAA 3BX1C 1UYPA 4JKXB 2E4MC 3ZX7A 3QEDA 5F8WA 3CA6A 3P2NA 4AN6A 2AQZA 4FFIA 2D22A 4CJMA 2QYIB 1AVAC 2FGFA 4I4OA 3FJHA 1S0GA 4KEKA 4G9NA 5A8DA 2Z49A 4I8MA 3BAUA 3PUBA 3OBTA 3K1UA 1K5VA 4JP0A 3BYLA 3O3QA 2F8XC 1DQOA 3A22A 3BRDA 1WL7A 1CE7B 1JQZA 1W3AA 3ZXKA 1BASA 3FJ9A 3FJ8A 4QO3A 3WPUA 3C7OA 5FNXA 2D24A 2HW9A 1G82A 3BAVA 1SR4A 4IONA 3VT1A 1DZCA 1Y9GA 3NQHA 3QEEA 1WD4A 5B6TA 3VSFA 1RY7A 21BIA 2IHOA 5DUYA 3BYJA 3IAGC 4I7IA 2GZBA 4PC4A 1XG6A 3WINA 1HIBA 4HJJA 3IM5A 3KSTA 3IM7A 2KI4A 3ZXDA 4L4HA 3KF3A 2NVHA 4OWLA 3NBDA 2YFTA 1HKNA 2J3PA 1Z2VA 3BA4A 1JTCA 4II0A 4N2RA 4FFHA 1PT2A 3BAGA 2D20A 4DENA 3UDAA 4P0KA 2LIQA 1AXMA 5EHAA 4MZGB 4Q9GA 1TIEA 3O4BA 3D60A 4P0LA 3V0AB 4IHZA 1VKDA 3EF2A 3LDRA 1Z4SA 2MLLB 2FO1A 3UD8A 5E24E 1FN0A 2Z48A 4PVAA 3NBEA 3S8KA 3AH4A 4MLGA 4N2ZA 1W3FA 4EFPA 3CA3A 3NJ5A 3LFIA 3VSZA 3A21A 1BFGA 1V6VA 3KF5A 4DCKC 2ZR1B 2FDBM 1WBCA 2Q9XA 1FGAA 3R4SA 1W18A 4A7KA 1Y9MA 3OM2A 3W9TA 1T9FA 2X8FA 2DS0A 4I4RA 2OXBA 3ZC9A 1TFMB 3OM7A 4ZOTA 3WMYA 3V0BA 4XKIA 5BQUA 5BXSA 2LIEA 3OM4A 3O49A 2KH2A 3OM6A 4HA2A 1I1EA 3VSSA 9ILBA 2QQVA 3A07A 1PUMB 1ISWA 1BLAA 4IQPA 3BAHA 2EXIA 4J2SA 1GYEB 3T8SA 1KNMA 3WAUA 5BXTA 2NTDA 4OEFA 4EEEB 2D1ZA 3UD9A 2EXHA 3IIRA 4IY9A 2D23A 5FZYA 4D47A 4Z8SB 5JMCA 4QC4A 1ST8A 2M49A 1SR4C 7I1BA 4H75A 3WATA 5BVPI 2BEAA 1BFBA 3O4DA 1AVXB 2GO2A 3WINC 3C7EA 4GOYA 4OUJA 4QKRA 3Q7YA 2BEBA 4IYBA 4P6AA 4X3AA 6I1BA 3FGMA 1Q1UA 5FNWA 4EKXB 3R4UA 5F8SA 4O8NA 4I4SA 2DREA 1V6XA 3C2UA 2AAIB 2VUAA 5AYCA 5A7VB 5GLRA 2K43A 3KMVA 2D44A 1AFCA 1R8NA 4LO0A 3AH1A 3LF7A 4JQ0A 3U14A 4I4XA 1S0DA 2QN4A 3WN2A 3HN1A 1DFQA 3OJVA 2X8SA 2VXTI 3OBRA 3PMEA 3UJ0A 4AN7B 5GLLA 1HWPB 3A23A 5GLPA 1S0CA 4J2YA 1TOOA 1EV2A 4R6UB 4OEEA 3VWCA 4ZFYB 2Y9XE 1BARA 1YBIA 5B6SA 2AEZA 3VT0A 3HOMA 1HCEA 3H6RB 1ITBA 3FJDA 1BFCA 3FFZA 4FFGA 1PUUB 4X38A 5DSSB 3LEMA 1J0SA 2AC1A 3C7HA 2ERMA 4USOA 3WMUA 4LO3C 5BQUC 5BOWA 4I6IA 3F62B 3D5ZA 1Z0HA 4I4YA 3K1XA 3CRHA 3D61A 4KEJA 2FFUA 5A8CA 5EC5A 2K4AB 3FUQA 2VLCA 3PG0A 8I1BA 4N4BA 3WASA 3BA5A 4F34A 1YRZA 2X2SA 1NZKA 4OWJA 1R8OA 1YF8B 4ENDA 3RTJB 1JT7A 3N7LA 4JRAA 1YI7A 2B4WA 3OGFA 3N0KA 4LO2A 1S0FA 3WN0A 4QD2C 1Q04A 3UD7A 5D61A 4LO7C 5D63A 4ZBVB 3CA5A 4FFFA 4GP0A 1AVWB 4G6JA 2ZQNA 4I1EA 1IRPA 2P39A 1QXMA 4UDJA 4OWKA 4KCBA 4Z9WB 4N1IA 4KCAA 3ZXLA 1XHBA 2RQ9A 3OJ2A 3I29B 2Y9GA 3CA4A 1TP0A 4ONZA 5FLWA 4H04A 4I96A 3LIHA 4KC8A 3V0AA 1DZDA 2X2TA 4EQVA 3R67A 1XYFA 1TWMA 3BAQA 4X37A 3WPVA 3H6QA 5JOWA 5BXRA 3FJKA 4P0JA 4GAFA 2DRZA 4LO0C 3AJ5A 3RSJA 2Y9FA 4G6MA 2IWTB 1I1BA 3BADA 3BRGC 3N7KA 3CRIA 4UY4A 4I4PA 4A7YA 4XFUA 1G9AA 1AVUA 3PHZA 4LO3A 5FZUA 3JRRA 5JLVA 1RG8A 1L2HA 1M16A 3F1RA 2D7IA 2HWMA 1WD3A 3FJFA 3WA1A 3VUOA 3UGHA 1T4QA 5GAQA 3IM6A 41BIA 2DRYA 4Q91A 3N7JA 4LO1A 4ISQA 5D62A 3E8LC 3V0BB 5GLNA 1E0OA 2D43A 2XOAA 1IJTA 3I2AA 3QC2A 2MC2A 3AZVA 2R9KB 4ZGRB 1Y7BA 1VCLA 2ESUA 1FWUA 4YOLA 1OYGA 4ZFWB 5FMCA 3R4ZA 1SZ6B 3ILAA 5FK8A 1IT0A 3FJJA 1BFFA 4XFTA 2VDTA 3N7MA 1W3GA 4PVIA 5AYEA 4UDKA 1ABRB 3S8JA 2RSTA 2VU9A 4F83A 4QD2B 4JKQA 5BXPA 4LO2C 4LO7B 1F31A 3R4YA 3U75A 3BYNA 1JY0A 4KEIA 3ZXJA 3O4CA 4MZFB 5FMDA 3AZWA 1A8DA 1ISZA 5FKBA 3UGGA 4J2XA 3HALA 2UUSA 3CU9A 5F8YA 4X39A 2ADDA 4GP3A 1WBAA 4MZHA 1ISYA 1UV4A 4FGFA 4I0YA 4OW4A 31BIA 3O5WB 4QBVA 3AKFA 4G9MA 3NBNA 5BP5A 1QQLA 3FJEA 3Q7WA 2X8TA 3LV4A 2FFVA 1TWEA 3WO2A 3FJBA 4JAWA 2NP0A 3TAWA 4G1RA 3B9UA 1ONKB 4AK5A 4KBBA 1YYNA 2AXMA 4A7ZA 3LDKA 3WN1A 1GYHA 4EB2B 3RWKX 3WO3A 4QALA 4ZFUB 3RTIB 1G9CA 5JOZA 4Q9PA 4LO8B 2VSEA 4XFSA 3P6IA 5FKCA 3H6RA 1MD6A 4GAIA 4H9WA 4IZEA 1G9BA 1PZZA 4ZLBB 3C7GA 2KKIA 4JPZA 4KMIA 1FQ9A 4QKSA 4U6BA 5ANNA 2ET2A 1UPSA 1TTUA 1PC8B 3MPPG 3UJ4A 4D0ZA 3C7FA 4LO1C 3PIGA 4QQSA 1JT3A 1ISXA 2F2FA 2EXJA 4O8PA 3WMZA 3WPYA 1M2TB 3O44A 4USPA 5B2HA 1EVTA 2AEYA 3RMXA 1CVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDI A;  3BRF A;  3BYK A;  4U6D A;  4O8O A;  2MIB A;  1HWN B;  4DEP A;  3V79 C;  1BA7 A;  1IRA X;  1RZO B;  3FJI A;  2QQW A;  1S0L A;  1Q03 A;  4IZX A;  1IOB A;  4KC3 A;  1FWV A;  3VT2 A;  1JT5 A;  2HZ9 A;  3OGG A;  4ZKT B;  1Y4W A;  5GLK A;  2NM1 A;  3QZ4 A;  5C0P A;  3WPZ A;  3MAL A;  3BA7 A;  3O4A A;  4TLP A;  3JUT A;  2NZ9 A;  3OJM A;  5G00 A;  3FJC A;  3H6S E;  4I4V A;  1K5U A;  2EXK A;  1QQK A;  3AH2 A;  5HPZ A;  2YFR A;  1MC9 A;  3QEF A;  3FUO A;  1DQG A;  3HBW A;  3ZXG A;  4D0T A;  4I3N A;  1GYD B;  4D8H A;  3CA0 A;  4L4I A;  3SNV A;  3VEQ A;  5BP5 C;  5I1B A;  2E4M A;  1GGP B;  4ZA3 B;  1HCD A;  1JLY A;  3OM5 A;  3AKI A;  1YIF A;  1FMZ A;  1DIW A;  4OEG A;  5JOX A;  2P23 A;  3HMY A;  5AYD A;  3Q7X A;  5DVH A;  4ISR A;  5FMB A;  3P6J A;  2QQU A;  3BTA A;  1V6W A;  4EFQ A;  2ADE A;  3QR5 A;  2VSA A;  3POK A;  3AKG A;  4UDG A;  5FZZ A;  1RML A;  5FIX A;  3CA1 A;  4IY8 A;  2KLL A;  4AK7 A;  4NOV A;  1G9D A;  3CQA A;  3CRG A;  4AK6 A;  3NBC A;  1DJS B;  2I1B A;  1YXW A;  1W2T A;  3AJ6 A;  2D7R A;  5GLQ A;  1DFC A;  2Y9W C;  1OQL B;  2VXR A;  3LLP A;  1DLL A;  3ZC8 A;  4I4Q A;  5EG6 C;  3VSR A;  1HWO B;  4UDK E;  1JLX A;  2KI6 B;  1IHK A;  1S0E A;  4FVV A;  4WBC A;  3LIG A;  1FV2 A;  1HWM B;  2F2F C;  3PIJ A;  3BAO A;  3LTQ A;  3C9Z A;  1IIL A;  1EYL A;  1V6U A;  5F90 A;  1FMM S;  3QYD A;  4EFR A;  5JOY A;  4I4U A;  2Q3N B;  2XQR A;  3HSM A;  3AKH A;  3TC2 A;  4J23 B;  1P63 A;  1N4K A;  1YTO A;  4J2K A;  1EPW A;  1JT4 A;  1BLD A;  3CAH A;  1II4 A;  4GOV A;  2AFG A;  4I1B A;  3WO4 A;  2HWA A;  3BB2 A;  1S0B A;  2RG9 B;  4I2S A;  5A7V A;  3SC7 X;  2WRY A;  4HR6 C;  2YFS A;  3D5Y A;  3UGF A;  2NYY A;  4COT A;  1AF9 A;  1D0H A;  2L5X A;  3CU1 B;  3D7W B;  2YUG A;  3I2X A;  4I37 A;  3P53 A;  5FK7 A;  1ILR 1;  1PWA A;  3WMV A;  5GLO A;  5AY9 A;  5GLM A;  3O4O A;  1ISV A;  4QBC A;  1XZZ A;  4KC7 A;  2ZQO A;  3RMY A;  2WBC A;  1FV3 A;  1NUN A;  2K8R A;  5DZU A;  2BFH A;  3FJA A;  3BX1 C;  1UYP A;  4JKX B;  2E4M C;  3ZX7 A;  3QED A;  5F8W A;  3CA6 A;  3P2N A;  4AN6 A;  2AQZ A;  4FFI A;  2D22 A;  4CJM A;  2QYI B;  1AVA C;  2FGF A;  4I4O A;  3FJH A;  1S0G A;  4KEK A;  4G9N A;  5A8D A;  2Z49 A;  4I8M A;  3BAU A;  3PUB A;  3OBT A;  3K1U A;  1K5V A;  4JP0 A;  3BYL A;  3O3Q A;  2F8X C;  1DQO A;  3A22 A;  3BRD A;  1WL7 A;  1CE7 B;  1JQZ A;  1W3A A;  3ZXK A;  1BAS A;  3FJ9 A;  3FJ8 A;  4QO3 A;  3WPU A;  3C7O A;  5FNX A;  2D24 A;  2HW9 A;  1G82 A;  3BAV A;  1SR4 A;  4ION A;  3VT1 A;  1DZC A;  1Y9G A;  3NQH A;  3QEE A;  1WD4 A;  5B6T A;  3VSF A;  1RY7 A;  21BI A;  2IHO A;  5DUY A;  3BYJ A;  3IAG C;  4I7I A;  2GZB A;  4PC4 A;  1XG6 A;  3WIN A;  1HIB A;  4HJJ A;  3IM5 A;  3KST A;  3IM7 A;  2KI4 A;  3ZXD A;  4L4H A;  3KF3 A;  2NVH A;  4OWL A;  3NBD A;  2YFT A;  1HKN A;  2J3P A;  1Z2V A;  3BA4 A;  1JTC A;  4II0 A;  4N2R A;  4FFH A;  1PT2 A;  3BAG A;  2D20 A;  4DEN A;  3UDA A;  4P0K A;  2LIQ A;  1AXM A;  5EHA A;  4Q9G A;  1TIE A;  3O4B A;  3D60 A;  4P0L A;  3V0A B;  4IHZ A;  1VKD A;  3EF2 A;  3LDR A;  1Z4S A;  2MLL B;  2FO1 A;  3UD8 A;  5E24 E;  1FN0 A;  2Z48 A;  4PVA A;  3NBE A;  3S8K A;  3AH4 A;  4MLG A;  4N2Z A;  1W3F A;  4EFP A;  3CA3 A;  3NJ5 A;  3LFI A;  3VSZ A;  3A21 A;  1BFG A;  1V6V A;  3KF5 A;  4DCK C;  2ZR1 B;  2FDB M;  1WBC A;  2Q9X A;  1FGA A;  3R4S A;  1W18 A;  4A7K A;  1Y9M A;  3OM2 A;  3W9T A;  1T9F A;  2X8F A;  2DS0 A;  4I4R A;  2OXB A;  3ZC9 A;  1TFM B;  3OM7 A;  4ZOT A;  3WMY A;  3V0B A;  4XKI A;  5BQU A;  5BXS A;  2LIE A;  3OM4 A;  3O49 A;  2KH2 A;  3OM6 A;  4HA2 A;  1I1E A;  3VSS A;  9ILB A;  2QQV A;  3A07 A;  1PUM B;  1ISW A;  1BLA A;  4IQP A;  3BAH A;  2EXI A;  4J2S A;  1GYE B;  3T8S A;  1KNM A;  3WAU A;  5BXT A;  2NTD A;  4OEF A;  4EEE B;  2D1Z A;  3UD9 A;  2EXH A;  3IIR A;  4IY9 A;  2D23 A;  5FZY A;  4D47 A;  4Z8S B;  5JMC A;  4QC4 A;  1ST8 A;  2M49 A;  1SR4 C;  7I1B A;  3WAT A;  5BVP I;  2BEA A;  1BFB A;  3O4D A;  1AVX B;  2GO2 A;  3WIN C;  3C7E A;  4GOY A;  4OUJ A;  4QKR A;  3Q7Y A;  2BEB A;  4IYB A;  4P6A A;  4X3A A;  6I1B A;  3FGM A;  1Q1U A;  5FNW A;  4EKX B;  3R4U A;  5F8S A;  4O8N A;  4I4S A;  2DRE A;  1V6X A;  3C2U A;  2AAI B;  2VUA A;  5AYC A;  5A7V B;  5GLR A;  2K43 A;  3KMV A;  2D44 A;  1AFC A;  1R8N A;  4LO0 A;  3AH1 A;  3LF7 A;  4JQ0 A;  3U14 A;  4I4X A;  1S0D A;  2QN4 A;  3WN2 A;  3HN1 A;  1DFQ A;  3OJV A;  2X8S A;  2VXT I;  3OBR A;  3PME A;  3UJ0 A;  4AN7 B;  5GLL A;  1HWP B;  3A23 A;  5GLP A;  1S0C A;  4J2Y A;  1TOO A;  1EV2 A;  4R6U B;  4OEE A;  3VWC A;  4ZFY B;  2Y9X E;  1BAR A;  1YBI A;  5B6S A;  2AEZ A;  3VT0 A;  3HOM A;  1HCE A;  3H6R B;  1ITB A;  3FJD A;  1BFC A;  3FFZ A;  4FFG A;  1PUU B;  4X38 A;  5DSS B;  3LEM A;  1J0S A;  2AC1 A;  3C7H A;  2ERM A;  4USO A;  3WMU A;  4LO3 C;  5BQU C;  5BOW A;  4I6I A;  3F62 B;  3D5Z A;  1Z0H A;  4I4Y A;  3K1X A;  3CRH A;  3D61 A;  4KEJ A;  2FFU A;  5A8C A;  5EC5 A;  2K4A B;  3FUQ A;  2VLC A;  3PG0 A;  8I1B A;  4N4B A;  3WAS A;  3BA5 A;  4F34 A;  1YRZ A;  2X2S A;  1NZK A;  4OWJ A;  1R8O A;  1YF8 B;  4END A;  3RTJ B;  1JT7 A;  3N7L A;  4JRA A;  1YI7 A;  2B4W A;  3OGF A;  3N0K A;  4LO2 A;  1S0F A;  3WN0 A;  4QD2 C;  1Q04 A;  3UD7 A;  5D61 A;  4LO7 C;  5D63 A;  4ZBV B;  3CA5 A;  4FFF A;  4GP0 A;  1AVW B;  4G6J A;  2ZQN A;  4I1E A;  1IRP A;  2P39 A;  1QXM A;  4UDJ A;  4OWK A;  4KCB A;  4Z9W B;  4N1I A;  4KCA A;  3ZXL A;  1XHB A;  2RQ9 A;  3OJ2 A;  3I29 B;  2Y9G A;  3CA4 A;  1TP0 A;  4ONZ A;  5FLW A;  4H04 A;  4I96 A;  3LIH A;  4KC8 A;  3V0A A;  1DZD A;  2X2T A;  4EQV A;  3R67 A;  1XYF A;  1TWM A;  3BAQ A;  4X37 A;  3WPV A;  3H6Q A;  5JOW A;  5BXR A;  3FJK A;  4P0J A;  4GAF A;  2DRZ A;  4LO0 C;  3AJ5 A;  3RSJ A;  2Y9F A;  4G6M A;  2IWT B;  1I1B A;  3BAD A;  3BRG C;  3N7K A;  3CRI A;  4I4P A;  4A7Y A;  4XFU A;  1G9A A;  1AVU A;  3PHZ A;  4LO3 A;  5FZU A;  3JRR A;  5JLV A;  1RG8 A;  1L2H A;  1M16 A;  3F1R A;  2D7I A;  2HWM A;  1WD3 A;  3FJF A;  3WA1 A;  3VUO A;  3UGH A;  1T4Q A;  5GAQ A;  3IM6 A;  41BI A;  2DRY A;  4Q91 A;  3N7J A;  4LO1 A;  4ISQ A;  5D62 A;  3E8L C;  3V0B B;  5GLN A;  1E0O A;  2D43 A;  2XOA A;  1IJT A;  3I2A A;  3QC2 A;  2MC2 A;  3AZV A;  2R9K B;  4ZGR B;  1Y7B A;  1VCL A;  2ESU A;  1FWU A;  4YOL A;  1OYG A;  4ZFW B;  5FMC A;  3R4Z A;  1SZ6 B;  3ILA A;  5FK8 A;  1IT0 A;  3FJJ A;  1BFF A;  4XFT A;  2VDT A;  3N7M A;  1W3G A;  4PVI A;  5AYE A;  4UDK A;  1ABR B;  3S8J A;  2RST A;  2VU9 A;  4F83 A;  4QD2 B;  4JKQ A;  5BXP A;  4LO2 C;  4LO7 B;  1F31 A;  3R4Y A;  3U75 A;  3BYN A;  1JY0 A;  4KEI A;  3ZXJ A;  3O4C A;  5FMD A;  3AZW A;  1A8D A;  1ISZ A;  5FKB A;  3UGG A;  4J2X A;  3HAL A;  2UUS A;  3CU9 A;  5F8Y A;  4X39 A;  2ADD A;  4GP3 A;  1WBA A;  1ISY A;  1UV4 A;  4FGF A;  4I0Y A;  4OW4 A;  31BI A;  3O5W B;  4QBV A;  3AKF A;  4G9M A;  3NBN A;  5BP5 A;  1QQL A;  3FJE A;  3Q7W A;  2X8T A;  3LV4 A;  2FFV A;  1TWE A;  3WO2 A;  3FJB A;  4JAW A;  2NP0 A;  3TAW A;  4G1R A;  3B9U A;  1ONK B;  4AK5 A;  4KBB A;  1YYN A;  2AXM A;  4A7Z A;  3LDK A;  3WN1 A;  1GYH A;  4EB2 B;  3RWK X;  3WO3 A;  4QAL A;  4ZFU B;  3RTI B;  1G9C A;  5JOZ A;  4Q9P A;  4LO8 B;  2VSE A;  4XFS A;  3P6I A;  5FKC A;  3H6R A;  1MD6 A;  4GAI A;  4H9W A;  4IZE A;  1G9B A;  1PZZ A;  4ZLB B;  3C7G A;  2KKI A;  4JPZ A;  4KMI A;  1FQ9 A;  4QKS A;  4U6B A;  5ANN A;  2ET2 A;  1UPS A;  1TTU A;  1PC8 B;  3MPP G;  3UJ4 A;  4D0Z A;  3C7F A;  4LO1 C;  3PIG A;  4QQS A;  1JT3 A;  1ISX A;  2F2F A;  2EXJ A;  4O8P A;  3WMZ A;  3WPY A;  1M2T B;  3O44 A;  4USP A;  5B2H A;  1EVT A;  2AEY A;  3RMX A;  1CVS A; 
#chains in the Genus database with same CATH topology
 4UDI A;  3BRF A;  3BYK A;  4U6D A;  4O8O A;  2MIB A;  1HWN B;  4DEP A;  3V79 C;  1BA7 A;  1IRA X;  1RZO B;  3FJI A;  2QQW A;  1S0L A;  1Q03 A;  4IZX A;  1IOB A;  4KC3 A;  1FWV A;  3VT2 A;  1JT5 A;  2HZ9 A;  3OGG A;  4ZKT B;  1Y4W A;  5GLK A;  2NM1 A;  3QZ4 A;  5C0P A;  3WPZ A;  3MAL A;  3BA7 A;  3O4A A;  4TLP A;  3JUT A;  2NZ9 A;  3OJM A;  5G00 A;  3FJC A;  3H6S E;  4I4V A;  1K5U A;  2EXK A;  1QQK A;  3AH2 A;  5HPZ A;  2YFR A;  1MC9 A;  3QEF A;  3FUO A;  1DQG A;  3HBW A;  3ZXG A;  4D0T A;  4I3N A;  1GYD B;  4D8H A;  3CA0 A;  4L4I A;  3SNV A;  3VEQ A;  5BP5 C;  5I1B A;  2E4M A;  1GGP B;  4ZA3 B;  1HCD A;  1JLY A;  3OM5 A;  3AKI A;  1YIF A;  1FMZ A;  1DIW A;  4OEG A;  5JOX A;  2P23 A;  3HMY A;  5AYD A;  3Q7X A;  5DVH A;  4ISR A;  5FMB A;  3P6J A;  2QQU A;  3BTA A;  1V6W A;  4EFQ A;  2ADE A;  3QR5 A;  2VSA A;  3POK A;  3AKG A;  4UDG A;  5FZZ A;  1RML A;  5FIX A;  3CA1 A;  4IY8 A;  2KLL A;  4AK7 A;  4NOV A;  1G9D A;  3CQA A;  3CRG A;  4AK6 A;  3NBC A;  1DJS B;  2I1B A;  1YXW A;  1W2T A;  3AJ6 A;  2D7R A;  5GLQ A;  1DFC A;  2Y9W C;  1OQL B;  2VXR A;  3LLP A;  1DLL A;  3ZC8 A;  4I4Q A;  5EG6 C;  3VSR A;  1HWO B;  4UDK E;  1JLX A;  2KI6 B;  1IHK A;  1S0E A;  4FVV A;  4WBC A;  3LIG A;  1FV2 A;  1HWM B;  2F2F C;  3PIJ A;  3BAO A;  3LTQ A;  3C9Z A;  1IIL A;  1EYL A;  1V6U A;  5F90 A;  1FMM S;  3QYD A;  4EFR A;  5JOY A;  4I4U A;  2Q3N B;  2XQR A;  3HSM A;  3AKH A;  3TC2 A;  4J23 B;  1P63 A;  1N4K A;  1YTO A;  4J2K A;  1EPW A;  1JT4 A;  1BLD A;  3CAH A;  1II4 A;  4GOV A;  2AFG A;  4I1B A;  3WO4 A;  2HWA A;  3BB2 A;  1S0B A;  2RG9 B;  4I2S A;  5A7V A;  3SC7 X;  2WRY A;  4HR6 C;  2YFS A;  3D5Y A;  3UGF A;  2NYY A;  4COT A;  1AF9 A;  1D0H A;  2NS2 A;  2L5X A;  3CU1 B;  3D7W B;  2YUG A;  3I2X A;  4I37 A;  3P53 A;  5FK7 A;  1ILR 1;  1PWA A;  3WMV A;  5GLO A;  5AY9 A;  5GLM A;  3O4O A;  1ISV A;  4QBC A;  1XZZ A;  4KC7 A;  2ZQO A;  3RMY A;  2WBC A;  1FV3 A;  1NUN A;  2K8R A;  5DZU A;  2BFH A;  3FJA A;  3BX1 C;  1UYP A;  4JKX B;  2E4M C;  3ZX7 A;  3QED A;  5F8W A;  3CA6 A;  3P2N A;  4AN6 A;  2AQZ A;  4FFI A;  2D22 A;  4CJM A;  2QYI B;  1AVA C;  2FGF A;  4I4O A;  3FJH A;  1S0G A;  4KEK A;  4G9N A;  5A8D A;  2Z49 A;  4I8M A;  3BAU A;  3PUB A;  3OBT A;  3K1U A;  1K5V A;  4JP0 A;  3BYL A;  3O3Q A;  2F8X C;  1DQO A;  3A22 A;  3BRD A;  1WL7 A;  1CE7 B;  1JQZ A;  1W3A A;  3ZXK A;  1BAS A;  3FJ9 A;  3FJ8 A;  4QO3 A;  3WPU A;  3C7O A;  5FNX A;  2D24 A;  2HW9 A;  1G82 A;  3BAV A;  1SR4 A;  4ION A;  3VT1 A;  1DZC A;  1Y9G A;  3NQH A;  3QEE A;  1WD4 A;  5B6T A;  3VSF A;  1RY7 A;  21BI A;  2IHO A;  5DUY A;  3BYJ A;  3IAG C;  4I7I A;  2GZB A;  4PC4 A;  1XG6 A;  3WIN A;  1HIB A;  4HJJ A;  3IM5 A;  3KST A;  3IM7 A;  2KI4 A;  3ZXD A;  4L4H A;  1TL2 A;  3KF3 A;  2NVH A;  4OWL A;  3NBD A;  2YFT A;  1HKN A;  2J3P A;  1Z2V A;  3BA4 A;  1JTC A;  4II0 A;  4N2R A;  4FFH A;  1PT2 A;  3BAG A;  2D20 A;  4DEN A;  3UDA A;  4P0K A;  2LIQ A;  1AXM A;  5EHA A;  4MZG B;  4Q9G A;  1TIE A;  3O4B A;  3D60 A;  4P0L A;  3V0A B;  4IHZ A;  1VKD A;  3EF2 A;  3LDR A;  1Z4S A;  2MLL B;  2FO1 A;  3UD8 A;  5E24 E;  1FN0 A;  2Z48 A;  4PVA A;  3NBE A;  3S8K A;  3AH4 A;  4MLG A;  4N2Z A;  1W3F A;  4EFP A;  3CA3 A;  3NJ5 A;  3LFI A;  3VSZ A;  3A21 A;  1BFG A;  1V6V A;  3KF5 A;  4DCK C;  2ZR1 B;  2FDB M;  1WBC A;  2Q9X A;  1FGA A;  3R4S A;  1W18 A;  4A7K A;  1Y9M A;  3OM2 A;  3W9T A;  1T9F A;  2X8F A;  2DS0 A;  4I4R A;  2OXB A;  3ZC9 A;  1TFM B;  3OM7 A;  4ZOT A;  3WMY A;  3V0B A;  4XKI A;  5BQU A;  5BXS A;  2LIE A;  3OM4 A;  3O49 A;  2KH2 A;  3OM6 A;  4HA2 A;  1I1E A;  3VSS A;  9ILB A;  2QQV A;  3A07 A;  1PUM B;  1ISW A;  1BLA A;  4IQP A;  3BAH A;  2EXI A;  4J2S A;  1GYE B;  3T8S A;  1KNM A;  3WAU A;  5BXT A;  2NTD A;  4OEF A;  4EEE B;  2D1Z A;  3UD9 A;  2EXH A;  3IIR A;  4IY9 A;  2D23 A;  5FZY A;  4D47 A;  4Z8S B;  5JMC A;  4QC4 A;  1ST8 A;  2M49 A;  1SR4 C;  7I1B A;  4H75 A;  3WAT A;  5BVP I;  2BEA A;  1BFB A;  3O4D A;  1AVX B;  2GO2 A;  3WIN C;  3C7E A;  4GOY A;  4OUJ A;  4QKR A;  3Q7Y A;  2BEB A;  4IYB A;  4P6A A;  4X3A A;  6I1B A;  3FGM A;  1Q1U A;  5FNW A;  4EKX B;  3R4U A;  5F8S A;  4O8N A;  4I4S A;  2DRE A;  1V6X A;  3C2U A;  2AAI B;  2VUA A;  5AYC A;  5A7V B;  5GLR A;  2K43 A;  3KMV A;  2D44 A;  1AFC A;  1R8N A;  4LO0 A;  3AH1 A;  3LF7 A;  4JQ0 A;  3U14 A;  4I4X A;  1S0D A;  2QN4 A;  3WN2 A;  3HN1 A;  1DFQ A;  3OJV A;  2X8S A;  2VXT I;  3OBR A;  3PME A;  3UJ0 A;  4AN7 B;  5GLL A;  1HWP B;  3A23 A;  5GLP A;  1S0C A;  4J2Y A;  1TOO A;  1EV2 A;  4R6U B;  4OEE A;  3VWC A;  4ZFY B;  2Y9X E;  1BAR A;  1YBI A;  5B6S A;  2AEZ A;  3VT0 A;  3HOM A;  1HCE A;  3H6R B;  1ITB A;  3FJD A;  1BFC A;  3FFZ A;  4FFG A;  1PUU B;  4X38 A;  5DSS B;  3LEM A;  1J0S A;  2AC1 A;  3C7H A;  2ERM A;  4USO A;  3WMU A;  4LO3 C;  5BQU C;  5BOW A;  4I6I A;  3F62 B;  3D5Z A;  1Z0H A;  4I4Y A;  3K1X A;  3CRH A;  3D61 A;  4KEJ A;  2FFU A;  5A8C A;  5EC5 A;  2K4A B;  3FUQ A;  2VLC A;  3PG0 A;  8I1B A;  4N4B A;  3WAS A;  3BA5 A;  4F34 A;  1YRZ A;  2X2S A;  1NZK A;  4OWJ A;  1R8O A;  1YF8 B;  4END A;  3RTJ B;  1JT7 A;  3N7L A;  4JRA A;  1YI7 A;  2B4W A;  3OGF A;  3N0K A;  4LO2 A;  1S0F A;  3WN0 A;  4QD2 C;  1Q04 A;  3UD7 A;  5D61 A;  4LO7 C;  5D63 A;  4ZBV B;  3CA5 A;  4FFF A;  4GP0 A;  1AVW B;  4G6J A;  2ZQN A;  4I1E A;  1IRP A;  2P39 A;  1QXM A;  4UDJ A;  4OWK A;  4KCB A;  4Z9W B;  4N1I A;  4KCA A;  3ZXL A;  1XHB A;  2RQ9 A;  3OJ2 A;  3I29 B;  2Y9G A;  3CA4 A;  1TP0 A;  4ONZ A;  5FLW A;  4H04 A;  4I96 A;  3LIH A;  4KC8 A;  3V0A A;  1DZD A;  2X2T A;  4EQV A;  3R67 A;  1XYF A;  1TWM A;  3BAQ A;  4X37 A;  3WPV A;  3H6Q A;  5JOW A;  5BXR A;  3FJK A;  4P0J A;  4GAF A;  2DRZ A;  4LO0 C;  3AJ5 A;  3RSJ A;  2Y9F A;  4G6M A;  2IWT B;  1I1B A;  3BAD A;  3BRG C;  3N7K A;  3CRI A;  4UY4 A;  4I4P A;  4A7Y A;  4XFU A;  1G9A A;  1AVU A;  3PHZ A;  4LO3 A;  5FZU A;  3JRR A;  5JLV A;  1RG8 A;  1L2H A;  1M16 A;  3F1R A;  5C2M A;  2D7I A;  2HWM A;  1WD3 A;  3FJF A;  3WA1 A;  3VUO A;  3UGH A;  1T4Q A;  5GAQ A;  3IM6 A;  41BI A;  2DRY A;  4Q91 A;  3N7J A;  4LO1 A;  4ISQ A;  5D62 A;  3E8L C;  3V0B B;  5GLN A;  1E0O A;  2D43 A;  2XOA A;  1IJT A;  3I2A A;  3QC2 A;  2MC2 A;  3AZV A;  2R9K B;  4ZGR B;  1Y7B A;  1VCL A;  2ESU A;  1FWU A;  4YOL A;  1OYG A;  4ZFW B;  5FMC A;  3R4Z A;  1SZ6 B;  3ILA A;  5FK8 A;  1IT0 A;  3FJJ A;  1BFF A;  4XFT A;  2VDT A;  3N7M A;  1W3G A;  4PVI A;  5AYE A;  4UDK A;  1ABR B;  3S8J A;  2RST A;  2VU9 A;  4F83 A;  4QD2 B;  4JKQ A;  5BXP A;  4LO2 C;  4LO7 B;  1F31 A;  3R4Y A;  3U75 A;  3BYN A;  1JY0 A;  4KEI A;  3ZXJ A;  3O4C A;  4MZF B;  5FMD A;  3AZW A;  1A8D A;  1ISZ A;  5FKB A;  3UGG A;  4J2X A;  3HAL A;  2UUS A;  3CU9 A;  5F8Y A;  4X39 A;  2ADD A;  4GP3 A;  1WBA A;  4MZH A;  1ISY A;  1UV4 A;  4FGF A;  4I0Y A;  4OW4 A;  31BI A;  3O5W B;  4QBV A;  3AKF A;  4G9M A;  3NBN A;  5BP5 A;  1QQL A;  3FJE A;  3Q7W A;  2X8T A;  3LV4 A;  2FFV A;  1TWE A;  3WO2 A;  3FJB A;  4JAW A;  2NP0 A;  3TAW A;  4G1R A;  3B9U A;  1ONK B;  4AK5 A;  4KBB A;  1YYN A;  2AXM A;  4A7Z A;  3LDK A;  3WN1 A;  1GYH A;  4EB2 B;  3RWK X;  3WO3 A;  4QAL A;  4ZFU B;  3RTI B;  1G9C A;  5JOZ A;  4Q9P A;  4LO8 B;  2VSE A;  4XFS A;  3P6I A;  5FKC A;  3H6R A;  1MD6 A;  4GAI A;  4H9W A;  4IZE A;  1G9B A;  1PZZ A;  4ZLB B;  3C7G A;  2KKI A;  4JPZ A;  4KMI A;  1FQ9 A;  4QKS A;  4U6B A;  5ANN A;  2ET2 A;  1UPS A;  1TTU A;  1PC8 B;  3MPP G;  3UJ4 A;  4D0Z A;  3C7F A;  4LO1 C;  3PIG A;  4QQS A;  1JT3 A;  1ISX A;  2F2F A;  2EXJ A;  4O8P A;  3WMZ A;  3WPY A;  1M2T B;  3O44 A;  4USP A;  5B2H A;  1EVT A;  2AEY A;  3RMX A;  1CVS A; 
#chains in the Genus database with same CATH homology
 4UDI A;  3BRF A;  3BYK A;  4U6D A;  4O8O A;  2MIB A;  1HWN B;  4DEP A;  3V79 C;  1BA7 A;  1IRA X;  1RZO B;  3FJI A;  2QQW A;  1S0L A;  1Q03 A;  4IZX A;  1IOB A;  4KC3 A;  1FWV A;  3VT2 A;  1JT5 A;  2HZ9 A;  3OGG A;  4ZKT B;  1Y4W A;  5GLK A;  2NM1 A;  3QZ4 A;  5C0P A;  3WPZ A;  3MAL A;  3BA7 A;  3O4A A;  4TLP A;  3JUT A;  2NZ9 A;  3OJM A;  5G00 A;  3FJC A;  3H6S E;  4I4V A;  1K5U A;  2EXK A;  1QQK A;  3AH2 A;  5HPZ A;  2YFR A;  1MC9 A;  3QEF A;  3FUO A;  1DQG A;  3HBW A;  3ZXG A;  4D0T A;  4I3N A;  1GYD B;  4D8H A;  3CA0 A;  4L4I A;  3SNV A;  3VEQ A;  5BP5 C;  5I1B A;  2E4M A;  1GGP B;  4ZA3 B;  1HCD A;  1JLY A;  3OM5 A;  3AKI A;  1YIF A;  1FMZ A;  1DIW A;  4OEG A;  5JOX A;  2P23 A;  3HMY A;  5AYD A;  3Q7X A;  5DVH A;  4ISR A;  5FMB A;  3P6J A;  2QQU A;  3BTA A;  1V6W A;  4EFQ A;  2ADE A;  3QR5 A;  2VSA A;  3POK A;  3AKG A;  4UDG A;  5FZZ A;  1RML A;  5FIX A;  3CA1 A;  4IY8 A;  2KLL A;  4AK7 A;  4NOV A;  1G9D A;  3CQA A;  3CRG A;  4AK6 A;  3NBC A;  1DJS B;  2I1B A;  1YXW A;  1W2T A;  3AJ6 A;  2D7R A;  5GLQ A;  1DFC A;  2Y9W C;  1OQL B;  2VXR A;  3LLP A;  1DLL A;  3ZC8 A;  4I4Q A;  5EG6 C;  3VSR A;  1HWO B;  4UDK E;  1JLX A;  2KI6 B;  1IHK A;  1S0E A;  4FVV A;  4WBC A;  3LIG A;  1FV2 A;  1HWM B;  2F2F C;  3PIJ A;  3BAO A;  3LTQ A;  3C9Z A;  1IIL A;  1EYL A;  1V6U A;  5F90 A;  1FMM S;  3QYD A;  4EFR A;  5JOY A;  4I4U A;  2Q3N B;  2XQR A;  3HSM A;  3AKH A;  3TC2 A;  4J23 B;  1P63 A;  1N4K A;  1YTO A;  4J2K A;  1EPW A;  1JT4 A;  1BLD A;  3CAH A;  1II4 A;  4GOV A;  2AFG A;  4I1B A;  3WO4 A;  2HWA A;  3BB2 A;  1S0B A;  2RG9 B;  4I2S A;  5A7V A;  3SC7 X;  2WRY A;  4HR6 C;  2YFS A;  3D5Y A;  3UGF A;  2NYY A;  4COT A;  1AF9 A;  1D0H A;  2NS2 A;  2L5X A;  3CU1 B;  3D7W B;  2YUG A;  3I2X A;  4I37 A;  3P53 A;  5FK7 A;  1ILR 1;  1PWA A;  3WMV A;  5GLO A;  5AY9 A;  5GLM A;  3O4O A;  1ISV A;  4QBC A;  1XZZ A;  4KC7 A;  2ZQO A;  3RMY A;  2WBC A;  1FV3 A;  1NUN A;  2K8R A;  5DZU A;  2BFH A;  3FJA A;  3BX1 C;  1UYP A;  4JKX B;  2E4M C;  3ZX7 A;  3QED A;  5F8W A;  3CA6 A;  3P2N A;  4AN6 A;  2AQZ A;  4FFI A;  2D22 A;  4CJM A;  2QYI B;  1AVA C;  2FGF A;  4I4O A;  3FJH A;  1S0G A;  4KEK A;  4G9N A;  5A8D A;  2Z49 A;  4I8M A;  3BAU A;  3PUB A;  3OBT A;  3K1U A;  1K5V A;  4JP0 A;  3BYL A;  3O3Q A;  2F8X C;  1DQO A;  3A22 A;  3BRD A;  1WL7 A;  1CE7 B;  1JQZ A;  1W3A A;  3ZXK A;  1BAS A;  3FJ9 A;  3FJ8 A;  4QO3 A;  3WPU A;  3C7O A;  5FNX A;  2D24 A;  2HW9 A;  1G82 A;  3BAV A;  1SR4 A;  4ION A;  3VT1 A;  1DZC A;  1Y9G A;  3NQH A;  3QEE A;  1WD4 A;  5B6T A;  3VSF A;  1RY7 A;  21BI A;  2IHO A;  5DUY A;  3BYJ A;  3IAG C;  4I7I A;  2GZB A;  4PC4 A;  1XG6 A;  3WIN A;  1HIB A;  4HJJ A;  3IM5 A;  3KST A;  3IM7 A;  2KI4 A;  3ZXD A;  4L4H A;  3KF3 A;  2NVH A;  4OWL A;  3NBD A;  2YFT A;  1HKN A;  2J3P A;  1Z2V A;  3BA4 A;  1JTC A;  4II0 A;  4N2R A;  4FFH A;  1PT2 A;  3BAG A;  2D20 A;  4DEN A;  3UDA A;  4P0K A;  2LIQ A;  1AXM A;  5EHA A;  4MZG B;  4Q9G A;  1TIE A;  3O4B A;  3D60 A;  4P0L A;  3V0A B;  4IHZ A;  1VKD A;  3EF2 A;  3LDR A;  1Z4S A;  2MLL B;  2FO1 A;  3UD8 A;  5E24 E;  1FN0 A;  2Z48 A;  4PVA A;  3NBE A;  3S8K A;  3AH4 A;  4MLG A;  4N2Z A;  1W3F A;  4EFP A;  3CA3 A;  3NJ5 A;  3LFI A;  3VSZ A;  3A21 A;  1BFG A;  1V6V A;  3KF5 A;  4DCK C;  2ZR1 B;  2FDB M;  1WBC A;  2Q9X A;  1FGA A;  3R4S A;  1W18 A;  4A7K A;  1Y9M A;  3OM2 A;  3W9T A;  1T9F A;  2X8F A;  2DS0 A;  4I4R A;  2OXB A;  3ZC9 A;  1TFM B;  3OM7 A;  4ZOT A;  3WMY A;  3V0B A;  4XKI A;  5BQU A;  5BXS A;  2LIE A;  3OM4 A;  3O49 A;  2KH2 A;  3OM6 A;  4HA2 A;  1I1E A;  3VSS A;  9ILB A;  2QQV A;  3A07 A;  1PUM B;  1ISW A;  1BLA A;  4IQP A;  3BAH A;  2EXI A;  4J2S A;  1GYE B;  3T8S A;  1KNM A;  3WAU A;  5BXT A;  2NTD A;  4OEF A;  4EEE B;  2D1Z A;  3UD9 A;  2EXH A;  3IIR A;  4IY9 A;  2D23 A;  5FZY A;  4D47 A;  4Z8S B;  5JMC A;  4QC4 A;  1ST8 A;  2M49 A;  1SR4 C;  7I1B A;  4H75 A;  3WAT A;  5BVP I;  2BEA A;  1BFB A;  3O4D A;  1AVX B;  2GO2 A;  3WIN C;  3C7E A;  4GOY A;  4OUJ A;  4QKR A;  3Q7Y A;  2BEB A;  4IYB A;  4P6A A;  4X3A A;  6I1B A;  3FGM A;  1Q1U A;  5FNW A;  4EKX B;  3R4U A;  5F8S A;  4O8N A;  4I4S A;  2DRE A;  1V6X A;  3C2U A;  2AAI B;  2VUA A;  5AYC A;  5A7V B;  5GLR A;  2K43 A;  3KMV A;  2D44 A;  1AFC A;  1R8N A;  4LO0 A;  3AH1 A;  3LF7 A;  4JQ0 A;  3U14 A;  4I4X A;  1S0D A;  2QN4 A;  3WN2 A;  3HN1 A;  1DFQ A;  3OJV A;  2X8S A;  2VXT I;  3OBR A;  3PME A;  3UJ0 A;  4AN7 B;  5GLL A;  1HWP B;  3A23 A;  5GLP A;  1S0C A;  4J2Y A;  1TOO A;  1EV2 A;  4R6U B;  4OEE A;  3VWC A;  4ZFY B;  2Y9X E;  1BAR A;  1YBI A;  5B6S A;  2AEZ A;  3VT0 A;  3HOM A;  1HCE A;  3H6R B;  1ITB A;  3FJD A;  1BFC A;  3FFZ A;  4FFG A;  1PUU B;  4X38 A;  5DSS B;  3LEM A;  1J0S A;  2AC1 A;  3C7H A;  2ERM A;  4USO A;  3WMU A;  4LO3 C;  5BQU C;  5BOW A;  4I6I A;  3F62 B;  3D5Z A;  1Z0H A;  4I4Y A;  3K1X A;  3CRH A;  3D61 A;  4KEJ A;  2FFU A;  5A8C A;  5EC5 A;  2K4A B;  3FUQ A;  2VLC A;  3PG0 A;  8I1B A;  4N4B A;  3WAS A;  3BA5 A;  4F34 A;  1YRZ A;  2X2S A;  1NZK A;  4OWJ A;  1R8O A;  1YF8 B;  4END A;  3RTJ B;  1JT7 A;  3N7L A;  4JRA A;  1YI7 A;  2B4W A;  3OGF A;  3N0K A;  4LO2 A;  1S0F A;  3WN0 A;  4QD2 C;  1Q04 A;  3UD7 A;  5D61 A;  4LO7 C;  5D63 A;  4ZBV B;  3CA5 A;  4FFF A;  4GP0 A;  1AVW B;  4G6J A;  2ZQN A;  4I1E A;  1IRP A;  2P39 A;  1QXM A;  4UDJ A;  4OWK A;  4KCB A;  4Z9W B;  4N1I A;  4KCA A;  3ZXL A;  1XHB A;  2RQ9 A;  3OJ2 A;  3I29 B;  2Y9G A;  3CA4 A;  1TP0 A;  4ONZ A;  5FLW A;  4H04 A;  4I96 A;  3LIH A;  4KC8 A;  3V0A A;  1DZD A;  2X2T A;  4EQV A;  3R67 A;  1XYF A;  1TWM A;  3BAQ A;  4X37 A;  3WPV A;  3H6Q A;  5JOW A;  5BXR A;  3FJK A;  4P0J A;  4GAF A;  2DRZ A;  4LO0 C;  3AJ5 A;  3RSJ A;  2Y9F A;  4G6M A;  2IWT B;  1I1B A;  3BAD A;  3BRG C;  3N7K A;  3CRI A;  4UY4 A;  4I4P A;  4A7Y A;  4XFU A;  1G9A A;  1AVU A;  3PHZ A;  4LO3 A;  5FZU A;  3JRR A;  5JLV A;  1RG8 A;  1L2H A;  1M16 A;  3F1R A;  2D7I A;  2HWM A;  1WD3 A;  3FJF A;  3WA1 A;  3VUO A;  3UGH A;  1T4Q A;  5GAQ A;  3IM6 A;  41BI A;  2DRY A;  4Q91 A;  3N7J A;  4LO1 A;  4ISQ A;  5D62 A;  3E8L C;  3V0B B;  5GLN A;  1E0O A;  2D43 A;  2XOA A;  1IJT A;  3I2A A;  3QC2 A;  2MC2 A;  3AZV A;  2R9K B;  4ZGR B;  1Y7B A;  1VCL A;  2ESU A;  1FWU A;  4YOL A;  1OYG A;  4ZFW B;  5FMC A;  3R4Z A;  1SZ6 B;  3ILA A;  5FK8 A;  1IT0 A;  3FJJ A;  1BFF A;  4XFT A;  2VDT A;  3N7M A;  1W3G A;  4PVI A;  5AYE A;  4UDK A;  1ABR B;  3S8J A;  2RST A;  2VU9 A;  4F83 A;  4QD2 B;  4JKQ A;  5BXP A;  4LO2 C;  4LO7 B;  1F31 A;  3R4Y A;  3U75 A;  3BYN A;  1JY0 A;  4KEI A;  3ZXJ A;  3O4C A;  4MZF B;  5FMD A;  3AZW A;  1A8D A;  1ISZ A;  5FKB A;  3UGG A;  4J2X A;  3HAL A;  2UUS A;  3CU9 A;  5F8Y A;  4X39 A;  2ADD A;  4GP3 A;  1WBA A;  4MZH A;  1ISY A;  1UV4 A;  4FGF A;  4I0Y A;  4OW4 A;  31BI A;  3O5W B;  4QBV A;  3AKF A;  4G9M A;  3NBN A;  5BP5 A;  1QQL A;  3FJE A;  3Q7W A;  2X8T A;  3LV4 A;  2FFV A;  1TWE A;  3WO2 A;  3FJB A;  4JAW A;  2NP0 A;  3TAW A;  4G1R A;  3B9U A;  1ONK B;  4AK5 A;  4KBB A;  1YYN A;  2AXM A;  4A7Z A;  3LDK A;  3WN1 A;  1GYH A;  4EB2 B;  3RWK X;  3WO3 A;  4QAL A;  4ZFU B;  3RTI B;  1G9C A;  5JOZ A;  4Q9P A;  4LO8 B;  2VSE A;  4XFS A;  3P6I A;  5FKC A;  3H6R A;  1MD6 A;  4GAI A;  4H9W A;  4IZE A;  1G9B A;  1PZZ A;  4ZLB B;  3C7G A;  2KKI A;  4JPZ A;  4KMI A;  1FQ9 A;  4QKS A;  4U6B A;  5ANN A;  2ET2 A;  1UPS A;  1TTU A;  1PC8 B;  3MPP G;  3UJ4 A;  4D0Z A;  3C7F A;  4LO1 C;  3PIG A;  4QQS A;  1JT3 A;  1ISX A;  2F2F A;  2EXJ A;  4O8P A;  3WMZ A;  3WPY A;  1M2T B;  3O44 A;  4USP A;  5B2H A;  1EVT A;  2AEY A;  3RMX A;  1CVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...