3VT2A

Crystal structure of ct1,3gal43a in complex with isopropy-beta-d-thiogalactoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 120
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vt2A02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vt2A01
4GP0A 2FFUA 3C7EA 3D60A 3FJFA 3ZXKA 5JMCA 1DQGA 4MLGA 2HWMA 1YYNA 3NBEA 5A7VA 4IQPA 3H6QA 5AY9A 3C2UA 1YXWA 4ZLBB 2P39A 2FDBM 2OXBA 3OM2A 4QBVA 2D44A 1T9FA 3QC2A 1R8OA 2I1BA 4ZKTB 3AH1A 3QR5A 4EFQA 4JQ0A 4Q9GA 1BFGA 1CE7B 2D43A 3O4AA 3N0KA 4I96A 2XQRA 1IJTA 4KC8A 2RSTA 4XKIA 3EF2A 2J3PA 4N4BA 1AVWB 1YRZA 1MC9A 2UUSA 1E0OA 2YUGA 3O49A 1JLXA 1SR4A 2ZQOA 2KKIA 2WBCA 1Q1UA 1YBIA 4LO7C 3PG0A 4G9MA 3AKIA 1BARA 1ISVA 1W3AA 3ZC9A 1NUNA 4J2XA 4A7ZA 1V6WA 1PUUB 3FUQA 4IZXA 4XFUA 3BRDA 2FO1A 4I4YA 2BEAA 1JY0A 4JPZA 1Q04A 4HJJA 4LO3C 4OWKA 1Q03A 1JLYA 4DCKC 2K8RA 4ZFYB 5B2HA 5FIXA 5FMBA 3IM7A 3WMZA 4KCBA 4KC7A 3CA4A 4FFGA 3A07A 4I4QA 1HCDA 2Y9XE 3OGGA 1PWAA 2BFHA 3BRFA 3BRGC 1SZ6B 2HZ9A 4AN7B 3VT2A 3A23A 1AXMA 5AYCA 1BFBA 2ADEA 4FFHA 1V6UA 1Z0HA 3IM6A 3Q7WA 3BTAA 1HWMB 2P23A 3LLPA 1HWNB 3PUBA 4IYBA 4USPA 1I1EA 5D63A 1UYPA 1EV2A 3FJCA 4IHZA 2NZ9A 3K1UA 4KEIA 4IONA 3UJ0A 1PT2A 2AEZA 2L5XA 4J2YA 4GOYA 4J23B 2AQZA 41BIA 5I1BA 4OEGA 4QQSA 3IM5A 4UDIA 5EG6C 3FJBA 2LIQA 3BYKA 2VLCA 4II0A 5F8WA 2F8XC 2NVHA 1TFMB 4QKSA 3ZXJA 4D47A 2ADDA 3A22A 4PVAA 2Y9FA 4LO7B 4ZGRB 3AKGA 8I1BA 1FV3A 3Q7XA 1W3FA 3CAHA 1DJSB 3O5WB 3CA3A 1ISWA 4G6MA 1S0LA 3OGFA 1WD4A 7I1BA 1G9BA 3WINA 4I4XA 4R6UB 2F2FA 4I4UA 4KMIA 5FKBA 3WPUA 2ET2A 3BADA 4I4RA 3RTJB 3WN2A 1SR4C 3UGFA 1JT4A 4EEEB 3HN1A 2X8SA 1PUMB 2LIEA 3R4SA 1M2TB 4QC4A 1TP0A 3WATA 1QQLA 1TWEA 5FZZA 3OM4A 3AKFA 3N7LA 3IIRA 1ST8A 5FKCA 3AJ5A 2DREA 4GP3A 3V0AB 2IHOA 3CA6A 1G9DA 5F8YA 1GYDB 2MLLB 3JRRA 5B6TA 4A7YA 3CQAA 1XZZA 1DFCA 4O8NA 1JT7A 3C7GA 2FFVA 4WBCA 5BXTA 3V0BA 3D5YA 5GLMA 1Z4SA 1JQZA 3CA0A 3TAWA 2HW9A 2XOAA 2QQVA 5JOZA 2KH2A 3HOMA 3LIHA 2Z49A 3WMVA 3QEDA 3BX1C 4EQVA 3BB2A 3LDKA 2Y9WC 3OJ2A 1Y9GA 3WPZA 2R9KB 3F62B 5A7VB 2D20A 2VSEA 2DRYA 4GOVA 4GAIA 5EC5A 4U6BA 1TWMA 4UDKA 3W9TA 4OWLA 5JOYA 3BAOA 2D23A 2M49A 4ZFUB 2D7RA 3N7MA 5HPZA 3VSZA 3BAUA 4ZA3B 2KI4A 1HKNA 1QQKA 5A8CA 3LFIA 5GLNA 4IY8A 3LF7A 1ISYA 4J2SA 3FJJA 4ZFWB 5D62A 5BP5C 1IT0A 3ZXLA 3WA1A 1D0HA 1S0CA 4XFTA 2B4WA 1IRAX 4I1EA 4ZOTA 4QD2C 4USOA 4H9WA 1EYLA 2AXMA 2YFRA 3WN0A 5JOXA 1EPWA 3HALA 3AKHA 4Z9WB 3VT0A 1AVAC 1GGPB 2ZQNA 3SNVA 3KF3A 1PZZA 3O4CA 1FMZA 4P0LA 4N1IA 1RY7A 3WINC 2NP0A 2VDTA 3P2NA 5GLOA 3BYLA 3Q7YA 1FWVA 4LO1A 2NYYA 5DZUA 3WAUA 2KLLA 2WRYA 1HIBA 2E4MA 4X3AA 4QO3A 3UGGA 1K5VA 3AZWA 3LV4A 4AK7A 6I1BA 4ONZA 3N7KA 1ONKB 1AF9A 4I4VA 1EVTA 9ILBA 3E8LC 1TOOA 1G82A 1YTOA 2DRZA 1AVXB 3BAHA 4J2KA 1G9CA 1VKDA 4AN6A 1FV2A 4LO8B 3C7HA 3RTIB 3CA5A 3NBNA 1L2HA 1XG6A 3FUOA 1FWUA 31BIA 3H6RB 1DZCA 3OJVA 4P6AA 3C7OA 4PVIA 3BAQA 1BFCA 2AC1A 3WPYA 4P0KA 5FNXA 4Z8SB 3OJMA 2FGFA 3UD9A 2GO2A 3ZC8A 1M16A 3NQHA 4XFSA 3FJHA 3AJ6A 4YOLA 3WO4A 3HSMA 1DFQA 5FNWA 2X2TA 1F31A 1S0DA 3FJDA 3WMUA 2VU9A 4EFPA 4OWJA 2DS0A 1DZDA 1IRPA 1HWPB 2D1ZA 4FFFA 1YF8B 4JAWA 1GYHA 2HWAA 3VT1A 1S0EA 3C9ZA 3CRHA 5E24E 1IILA 3VSRA 2Z48A 3PHZA 4I3NA 1G9AA 4KBBA 2D22A 5BXRA 1DIWA 4ZBVB 4I7IA 2VSAA 2AAIB 1BLDA 3RSJA 4ISQA 5FK7A 3O4BA 3BA4A 4FVVA 1XHBA 1DLLA 3I29B 5BXPA 4OUJA 21BIA 4DENA 1UV4A 4P0JA 4U6DA 5GLLA 1JT5A 3P53A 3LEMA 3FJEA 3CA1A 2QQUA 3R4UA 2AFGA 4G6JA 3VSFA 1JT3A 3POKA 3WO3A 4L4HA 4IZEA 2X8TA 1WBCA 1HCEA 4OW4A 3FJAA 5GLKA 4COTA 3AH4A 5DVHA 3NBCA 3D5ZA 3P6JA 2EXKA 4I0YA 5BXSA 4N2ZA 3ZXDA 1S0GA 1TIEA 3FJKA 2E4MC 3I2XA 5FMDA 5BQUA 1FQ9A 2RG9B 1OYGA 1WL7A 4F83A 5FMCA 4I4PA 2D24A 4KEKA 4LO2A 3FJ8A 3QZ4A 4F34A 1Y4WA 2VXTI 3TC2A 3NBDA 3BA5A 5GLPA 3FJ9A 4QKRA 1ISZA 4I8MA 5F90A 2X8FA 3UD8A 1AFCA 2EXHA 1V6XA 5ANNA 2IWTB 1J0SA 1K5UA 5AYEA 1MD6A 4G9NA 4ISRA 4I37A 2Q9XA 3KF5A 3WASA 1RZOB 4H04A 4JKQA 1N4KA 3JUTA 3D61A 2EXJA 2KI6B 2QN4A 3HBWA 3O3QA 3S8JA 3UJ4A 1Z2VA 3RMXA 4LO0A 1TTUA 3LTQA 1W18A 2MIBA 5FK8A 4Q9PA 5F8SA 5BVPI 1Y7BA 4HA2A 3AZVA 1P63A 3VUOA 4DEPA 4I4SA 3VSSA 3OBRA 3BYJA 4FGFA 2Q3NB 4HR6C 5JOWA 3P6IA 4I4OA 3R4ZA 2YFSA 3WPVA 3U14A 5D61A 3O4DA 4I1BA 5DSSB 3OBTA 4EB2B 2VXRA 3BAVA 2F2FC 3IAGC 2X2SA 3OM7A 3PIGA 3CU9A 4D0TA 3A21A 4GAFA 1XYFA 4NOVA 5FZYA 1VCLA 4I6IA 3LIGA 1JTCA 3CU1B 1ISXA 4JRAA 4D0ZA 2ESUA 1ABRB 3N7JA 1QXMA 4IY9A 2YFTA 3HMYA 1I1BA 4A7KA 3FGMA 1S0BA 1IOBA 2BEBA 3ZX7A 4X38A 3VEQA 1NZKA 5C0PA 4JP0A 1YIFA 5FZUA 4FFIA 4KEJA 5G00A 4EKXB 4Q91A 4ENDA 2VUAA 3RWKX 3K1XA 4O8OA 3S8KA 2ZR1B 3F1RA 5AYDA 3QYDA 5A8DA 4JKXB 4UDJA 4PC4A 3AH2A 2MC2A 1BFFA 1GYEB 5GLRA 4I2SA 3C7FA 3O44A 4OEEA 2QYIB 2RQ9A 5JLVA 5BQUC 2Y9GA 3H6RA 3ILAA 4G1RA 4N2RA 4CJMA 2GZBA 4LO2C 4UDKE 3H6SE 4TLPA 1T4QA 1A8DA 4O8PA 1OQLB 4L4IA 1DQOA 3D7WB 3KSTA 3I2AA 4X39A 3R4YA 4D8HA 4QD2B 3BYNA 3CRGA 1IHKA 3LDRA 3BA7A 3MPPG 3V79C 3O4OA 4KC3A 1WBAA 5DUYA 3R67A 3QEFA 3ZXGA 3CRIA 4UDGA 5EHAA 3WO2A 1ITBA 1FN0A 5BP5A 3UGHA 3WN1A 2NM1A 4LO0C 1R8NA 3PIJA 3UD7A 1II4A 1KNMA 4QALA 3T8SA 4X37A 5GAQA 1W2TA 1FGAA 3OM5A 4KCAA 4LO3A 2D7IA 2ERMA 4AK6A 3FFZA 5BOWA 3KMVA 3QEEA 3BAGA 1UPSA 3FJIA 2AEYA 2NTDA 1BLAA 3MALA 2K43A 4AK5A 3PMEA 1CVSA 4LO1C 5FLWA 1PC8B 3UDAA 1FMMS 3V0AA 2QQWA 1AVUA 3U75A 1HWOB 4OEFA 5GLQA 3V0BB 1YI7A 1BA7A 1RG8A 3B9UA 2EXIA 3NJ5A 1S0FA 1V6VA 4QBCA 1ILR1 3OM6A 2K4AB 1BASA 1Y9MA 3WMYA 1WD3A 1W3GA 3RMYA 3VWCA 1RMLA 4EFRA 3SC7X 5B6SA
chains in the Genus database with same CATH superfamily
4GP0A 2FFUA 3C7EA 3D60A 3FJFA 3ZXKA 5JMCA 1DQGA 4MLGA 2HWMA 1YYNA 3NBEA 5A7VA 4IQPA 3H6QA 5AY9A 3C2UA 1YXWA 4ZLBB 2P39A 2FDBM 2OXBA 3OM2A 4QBVA 2D44A 1T9FA 3QC2A 1R8OA 2I1BA 4ZKTB 3AH1A 3QR5A 4EFQA 4JQ0A 4Q9GA 1BFGA 1CE7B 2D43A 3O4AA 3N0KA 4I96A 2XQRA 1IJTA 4KC8A 2RSTA 4XKIA 3EF2A 2J3PA 4N4BA 1AVWB 1YRZA 1MC9A 2UUSA 1E0OA 2YUGA 3O49A 1JLXA 1SR4A 2ZQOA 2KKIA 2WBCA 1Q1UA 1YBIA 4LO7C 3PG0A 4G9MA 3AKIA 1BARA 1ISVA 1W3AA 3ZC9A 1NUNA 4J2XA 4A7ZA 1V6WA 1PUUB 3FUQA 4IZXA 4XFUA 3BRDA 2FO1A 4I4YA 2BEAA 1JY0A 4JPZA 1Q04A 4HJJA 4LO3C 4OWKA 1Q03A 1JLYA 4DCKC 2K8RA 4ZFYB 5B2HA 5FIXA 5FMBA 3IM7A 3WMZA 4KCBA 4KC7A 3CA4A 4FFGA 3A07A 4I4QA 1HCDA 2Y9XE 3OGGA 1PWAA 2BFHA 3BRFA 3BRGC 1SZ6B 2HZ9A 4AN7B 3VT2A 3A23A 1AXMA 5AYCA 1BFBA 2ADEA 4FFHA 1V6UA 1Z0HA 3IM6A 3Q7WA 3BTAA 1HWMB 2P23A 3LLPA 1HWNB 3PUBA 4IYBA 4USPA 1I1EA 5D63A 1UYPA 1EV2A 3FJCA 4IHZA 2NZ9A 3K1UA 4KEIA 4IONA 3UJ0A 1PT2A 2AEZA 2L5XA 4J2YA 4GOYA 4J23B 2AQZA 41BIA 5I1BA 4OEGA 4QQSA 3IM5A 4UDIA 5EG6C 3FJBA 2LIQA 3BYKA 2VLCA 4II0A 5F8WA 2F8XC 2NVHA 1TFMB 4QKSA 3ZXJA 4D47A 4UY4A 2ADDA 3A22A 4PVAA 2Y9FA 4LO7B 4ZGRB 3AKGA 8I1BA 1FV3A 3Q7XA 1W3FA 3CAHA 1DJSB 5C2MA 3O5WB 3CA3A 1ISWA 4G6MA 1S0LA 3OGFA 1WD4A 7I1BA 1G9BA 3WINA 4I4XA 4R6UB 2F2FA 4I4UA 4KMIA 5FKBA 3WPUA 2ET2A 3BADA 4I4RA 3RTJB 3WN2A 1SR4C 3UGFA 1JT4A 4EEEB 3HN1A 2X8SA 1PUMB 2LIEA 3R4SA 1M2TB 4H75A 4QC4A 1TP0A 3WATA 1QQLA 1TWEA 5FZZA 3OM4A 3AKFA 3N7LA 3IIRA 1ST8A 5FKCA 3AJ5A 2DREA 4GP3A 3V0AB 2IHOA 3CA6A 1G9DA 5F8YA 1GYDB 2MLLB 3JRRA 5B6TA 4A7YA 3CQAA 4MZFB 1XZZA 1DFCA 4O8NA 1JT7A 3C7GA 2FFVA 4WBCA 5BXTA 3V0BA 3D5YA 5GLMA 1Z4SA 1JQZA 3CA0A 3TAWA 2HW9A 2XOAA 2QQVA 5JOZA 2KH2A 3HOMA 3LIHA 2Z49A 3WMVA 3QEDA 3BX1C 4EQVA 3BB2A 3LDKA 2Y9WC 3OJ2A 1Y9GA 3WPZA 2R9KB 3F62B 5A7VB 2D20A 2VSEA 2DRYA 4GOVA 4GAIA 5EC5A 4U6BA 1TWMA 4UDKA 3W9TA 4OWLA 5JOYA 3BAOA 2D23A 2M49A 4ZFUB 2D7RA 3N7MA 5HPZA 3VSZA 3BAUA 4ZA3B 2KI4A 1HKNA 1QQKA 5A8CA 3LFIA 5GLNA 4IY8A 3LF7A 4MZHA 1ISYA 4J2SA 3FJJA 4ZFWB 5D62A 5BP5C 1IT0A 3ZXLA 3WA1A 1D0HA 1S0CA 4XFTA 2B4WA 1IRAX 4I1EA 4ZOTA 4QD2C 4USOA 4H9WA 1EYLA 2AXMA 2YFRA 3WN0A 5JOXA 1EPWA 3HALA 3AKHA 4Z9WB 3VT0A 1AVAC 1GGPB 2ZQNA 3SNVA 3KF3A 1PZZA 3O4CA 1FMZA 4P0LA 4N1IA 1RY7A 3WINC 2NP0A 2VDTA 3P2NA 5GLOA 3BYLA 3Q7YA 1FWVA 4LO1A 2NYYA 5DZUA 3WAUA 2KLLA 2WRYA 1HIBA 2E4MA 4X3AA 4QO3A 3UGGA 1K5VA 3AZWA 3LV4A 4AK7A 6I1BA 4ONZA 3N7KA 1ONKB 1AF9A 4I4VA 1EVTA 9ILBA 3E8LC 1TOOA 1G82A 1YTOA 2DRZA 1AVXB 3BAHA 4J2KA 1G9CA 1VKDA 4AN6A 1FV2A 4LO8B 3C7HA 3RTIB 3CA5A 3NBNA 1L2HA 1XG6A 1FWUA 31BIA 3FUOA 3H6RB 1DZCA 3OJVA 4P6AA 1TL2A 3C7OA 3BAQA 1BFCA 2AC1A 4PVIA 3WPYA 4P0KA 5FNXA 4Z8SB 3OJMA 2FGFA 3UD9A 2GO2A 3ZC8A 1M16A 3NQHA 4XFSA 3FJHA 3AJ6A 4YOLA 3WO4A 3HSMA 1DFQA 5FNWA 2X2TA 1F31A 1S0DA 3FJDA 3WMUA 2VU9A 4EFPA 4OWJA 2DS0A 1DZDA 1IRPA 1HWPB 2D1ZA 4FFFA 1YF8B 4JAWA 1GYHA 2HWAA 3VT1A 1S0EA 3C9ZA 2NS2A 3CRHA 5E24E 1IILA 3VSRA 2Z48A 3PHZA 4I3NA 1G9AA 4KBBA 2D22A 5BXRA 1DIWA 4ZBVB 4I7IA 2VSAA 2AAIB 1BLDA 3RSJA 4ISQA 5FK7A 3O4BA 3BA4A 4FVVA 1XHBA 1DLLA 3I29B 5BXPA 4OUJA 21BIA 4DENA 1UV4A 4P0JA 4U6DA 5GLLA 1JT5A 3P53A 3LEMA 3FJEA 3CA1A 2QQUA 3R4UA 2AFGA 4G6JA 3VSFA 1JT3A 3POKA 3WO3A 4L4HA 4IZEA 2X8TA 1WBCA 1HCEA 4OW4A 3FJAA 5GLKA 4COTA 3AH4A 5DVHA 3NBCA 3D5ZA 3P6JA 2EXKA 4I0YA 5BXSA 4N2ZA 3ZXDA 1S0GA 1TIEA 3FJKA 2E4MC 3I2XA 5FMDA 5BQUA 1FQ9A 2RG9B 1OYGA 1WL7A 4F83A 5FMCA 4I4PA 2D24A 4KEKA 4LO2A 3FJ8A 3QZ4A 4F34A 1Y4WA 2VXTI 3TC2A 3NBDA 3BA5A 5GLPA 3FJ9A 4QKRA 1ISZA 4I8MA 5F90A 2X8FA 3UD8A 1AFCA 2EXHA 1V6XA 5ANNA 2IWTB 1J0SA 1K5UA 5AYEA 1MD6A 4G9NA 4ISRA 4I37A 2Q9XA 3KF5A 3WASA 1RZOB 4H04A 4JKQA 1N4KA 3JUTA 3D61A 2EXJA 2KI6B 2QN4A 3HBWA 3O3QA 3S8JA 3UJ4A 1Z2VA 3RMXA 4LO0A 1TTUA 3LTQA 1W18A 2MIBA 5FK8A 4Q9PA 5F8SA 5BVPI 1Y7BA 4HA2A 3AZVA 1P63A 3VUOA 4DEPA 4I4SA 3VSSA 3OBRA 3BYJA 4FGFA 2Q3NB 4HR6C 5JOWA 3P6IA 4I4OA 3R4ZA 2YFSA 3WPVA 3U14A 5D61A 3O4DA 4I1BA 5DSSB 3OBTA 4EB2B 2VXRA 3BAVA 2F2FC 3IAGC 2X2SA 3OM7A 3PIGA 3CU9A 4D0TA 3A21A 4GAFA 1XYFA 4NOVA 5FZYA 1VCLA 4I6IA 3LIGA 1JTCA 3CU1B 1ISXA 4JRAA 4D0ZA 2ESUA 1ABRB 3N7JA 1QXMA 4IY9A 2YFTA 3HMYA 1I1BA 4A7KA 3FGMA 1S0BA 1IOBA 2BEBA 3ZX7A 4X38A 3VEQA 1NZKA 5C0PA 4JP0A 1YIFA 5FZUA 4FFIA 4KEJA 5G00A 4EKXB 4Q91A 4ENDA 2VUAA 3RWKX 3K1XA 4O8OA 3S8KA 2ZR1B 3F1RA 5AYDA 3QYDA 5A8DA 4JKXB 4UDJA 4PC4A 3AH2A 2MC2A 1BFFA 1GYEB 5GLRA 4I2SA 3C7FA 3O44A 4OEEA 2QYIB 2RQ9A 5JLVA 5BQUC 2Y9GA 3H6RA 3ILAA 4G1RA 4N2RA 4CJMA 2GZBA 4LO2C 4UDKE 3H6SE 4TLPA 1T4QA 1A8DA 4O8PA 1OQLB 4L4IA 1DQOA 3D7WB 3KSTA 3I2AA 4X39A 3R4YA 4D8HA 4QD2B 3BYNA 3CRGA 1IHKA 3LDRA 3BA7A 3MPPG 3V79C 3O4OA 4KC3A 1WBAA 5DUYA 3R67A 3QEFA 3ZXGA 3CRIA 4UDGA 5EHAA 3WO2A 1ITBA 1FN0A 5BP5A 3UGHA 3WN1A 2NM1A 4LO0C 1R8NA 3PIJA 3UD7A 4MZGB 1II4A 1KNMA 4QALA 3T8SA 4X37A 5GAQA 1W2TA 1FGAA 3OM5A 4KCAA 4LO3A 2D7IA 2ERMA 4AK6A 3FFZA 5BOWA 3KMVA 3QEEA 3BAGA 1UPSA 3FJIA 2AEYA 2NTDA 1BLAA 3MALA 2K43A 4AK5A 3PMEA 1CVSA 4LO1C 5FLWA 1PC8B 3UDAA 1FMMS 3V0AA 2QQWA 1AVUA 3U75A 1HWOB 4OEFA 5GLQA 3V0BB 1YI7A 1BA7A 1RG8A 3B9UA 2EXIA 3NJ5A 1S0FA 1V6VA 4QBCA 1ILR1 3OM6A 2K4AB 1BASA 1Y9MA 3WMYA 1WD3A 1W3GA 3RMYA 3VWCA 1RMLA 4EFRA 3SC7X 5B6SA
chains in the Genus database with same CATH topology
4GP0A 2FFUA 3C7EA 3D60A 3FJFA 3ZXKA 5JMCA 1DQGA 4MLGA 2HWMA 1YYNA 3NBEA 5A7VA 4IQPA 3H6QA 5AY9A 3C2UA 1YXWA 4ZLBB 2P39A 2FDBM 2OXBA 3OM2A 4QBVA 2D44A 1T9FA 3QC2A 1R8OA 2I1BA 4ZKTB 3AH1A 3QR5A 4EFQA 4JQ0A 4Q9GA 1BFGA 1CE7B 2D43A 3O4AA 3N0KA 4I96A 2XQRA 1IJTA 4KC8A 2RSTA 4XKIA 3EF2A 2J3PA 4N4BA 1AVWB 1YRZA 1MC9A 2UUSA 1E0OA 2YUGA 3O49A 1JLXA 1SR4A 2ZQOA 2KKIA 2WBCA 1Q1UA 1YBIA 4LO7C 3PG0A 4G9MA 3AKIA 1BARA 1ISVA 1W3AA 3ZC9A 1NUNA 4J2XA 4A7ZA 1V6WA 1PUUB 3FUQA 4IZXA 4XFUA 3BRDA 2FO1A 4I4YA 2BEAA 1JY0A 4JPZA 1Q04A 4HJJA 4LO3C 4OWKA 1Q03A 1JLYA 4DCKC 2K8RA 4ZFYB 5B2HA 5FIXA 5FMBA 3IM7A 3WMZA 4KCBA 4KC7A 3CA4A 4FFGA 3A07A 4I4QA 1HCDA 2Y9XE 3OGGA 1PWAA 2BFHA 3BRFA 3BRGC 1SZ6B 2HZ9A 4AN7B 3VT2A 3A23A 1AXMA 5AYCA 1BFBA 2ADEA 4FFHA 1V6UA 1Z0HA 3IM6A 3Q7WA 3BTAA 1HWMB 2P23A 3LLPA 1HWNB 3PUBA 4IYBA 4USPA 1I1EA 5D63A 1UYPA 1EV2A 3FJCA 4IHZA 2NZ9A 3K1UA 4KEIA 4IONA 3UJ0A 1PT2A 2AEZA 2L5XA 4J2YA 4GOYA 4J23B 2AQZA 41BIA 5I1BA 4OEGA 4QQSA 3IM5A 4UDIA 5EG6C 3FJBA 2LIQA 3BYKA 2VLCA 4II0A 5F8WA 2F8XC 2NVHA 1TFMB 4QKSA 3ZXJA 4D47A 4UY4A 2ADDA 3A22A 4PVAA 2Y9FA 4LO7B 4ZGRB 3AKGA 8I1BA 1FV3A 3Q7XA 1W3FA 3CAHA 1DJSB 3O5WB 3CA3A 1ISWA 4G6MA 1S0LA 3OGFA 1WD4A 7I1BA 1G9BA 3WINA 4I4XA 4R6UB 2F2FA 4I4UA 4KMIA 5FKBA 3WPUA 2ET2A 3BADA 4I4RA 3RTJB 3WN2A 1SR4C 3UGFA 1JT4A 4EEEB 3HN1A 2X8SA 1PUMB 2LIEA 3R4SA 1M2TB 4H75A 4QC4A 1TP0A 3WATA 1QQLA 1TWEA 5FZZA 3OM4A 3AKFA 3N7LA 3IIRA 1ST8A 5FKCA 3AJ5A 2DREA 4GP3A 3V0AB 2IHOA 3CA6A 1G9DA 5F8YA 1GYDB 2MLLB 3JRRA 5B6TA 4A7YA 3CQAA 4MZFB 1XZZA 1DFCA 4O8NA 1JT7A 3C7GA 2FFVA 4WBCA 5BXTA 3V0BA 3D5YA 5GLMA 1Z4SA 1JQZA 3CA0A 3TAWA 2HW9A 2XOAA 2QQVA 5JOZA 2KH2A 3HOMA 3LIHA 2Z49A 3WMVA 3QEDA 3BX1C 4EQVA 3BB2A 3LDKA 2Y9WC 3OJ2A 1Y9GA 3WPZA 2R9KB 3F62B 5A7VB 2D20A 2VSEA 2DRYA 4GOVA 4GAIA 5EC5A 4U6BA 1TWMA 4UDKA 3W9TA 4OWLA 5JOYA 3BAOA 2D23A 2M49A 4ZFUB 2D7RA 3N7MA 5HPZA 3VSZA 3BAUA 4ZA3B 2KI4A 1HKNA 1QQKA 5A8CA 3LFIA 5GLNA 4IY8A 3LF7A 4MZHA 1ISYA 4J2SA 3FJJA 4ZFWB 5D62A 5BP5C 1IT0A 3ZXLA 3WA1A 1D0HA 1S0CA 4XFTA 2B4WA 1IRAX 4I1EA 4ZOTA 4QD2C 4USOA 4H9WA 1EYLA 2AXMA 2YFRA 3WN0A 5JOXA 1EPWA 3HALA 3AKHA 4Z9WB 3VT0A 1AVAC 1GGPB 2ZQNA 3SNVA 3KF3A 1PZZA 3O4CA 1FMZA 4P0LA 4N1IA 1RY7A 3WINC 2NP0A 2VDTA 3P2NA 5GLOA 3BYLA 3Q7YA 1FWVA 4LO1A 2NYYA 5DZUA 3WAUA 2KLLA 2WRYA 1HIBA 2E4MA 4X3AA 4QO3A 3UGGA 1K5VA 3AZWA 3LV4A 4AK7A 6I1BA 4ONZA 3N7KA 1ONKB 1AF9A 4I4VA 1EVTA 9ILBA 3E8LC 1TOOA 1G82A 1YTOA 2DRZA 1AVXB 3BAHA 4J2KA 1G9CA 1VKDA 4AN6A 1FV2A 4LO8B 3C7HA 3RTIB 3CA5A 3NBNA 1L2HA 1XG6A 1FWUA 31BIA 3FUOA 3H6RB 1DZCA 3OJVA 4P6AA 3C7OA 4PVIA 3BAQA 1BFCA 2AC1A 3WPYA 4P0KA 5FNXA 4Z8SB 3OJMA 2FGFA 3UD9A 2GO2A 3ZC8A 1M16A 3NQHA 4XFSA 3FJHA 3AJ6A 4YOLA 3WO4A 3HSMA 1DFQA 5FNWA 2X2TA 1F31A 1S0DA 3FJDA 3WMUA 2VU9A 4EFPA 4OWJA 2DS0A 1DZDA 1IRPA 1HWPB 2D1ZA 4FFFA 1YF8B 4JAWA 1GYHA 2HWAA 3VT1A 1S0EA 3C9ZA 2NS2A 3CRHA 5E24E 1IILA 3VSRA 2Z48A 3PHZA 4I3NA 1G9AA 4KBBA 2D22A 5BXRA 1DIWA 4ZBVB 4I7IA 2VSAA 2AAIB 1BLDA 3RSJA 4ISQA 5FK7A 3O4BA 3BA4A 4FVVA 1XHBA 1DLLA 3I29B 5BXPA 4OUJA 21BIA 4DENA 1UV4A 4P0JA 4U6DA 5GLLA 1JT5A 3P53A 3LEMA 3FJEA 3CA1A 2QQUA 3R4UA 2AFGA 4G6JA 3VSFA 1JT3A 3POKA 3WO3A 4L4HA 4IZEA 2X8TA 1WBCA 1HCEA 4OW4A 3FJAA 5GLKA 4COTA 3AH4A 5DVHA 3NBCA 3D5ZA 3P6JA 2EXKA 4I0YA 5BXSA 4N2ZA 3ZXDA 1S0GA 1TIEA 3FJKA 2E4MC 3I2XA 5FMDA 5BQUA 1FQ9A 2RG9B 1OYGA 1WL7A 4F83A 5FMCA 4I4PA 2D24A 4KEKA 4LO2A 3FJ8A 3QZ4A 4F34A 1Y4WA 2VXTI 3TC2A 3NBDA 3BA5A 5GLPA 3FJ9A 4QKRA 1ISZA 4I8MA 5F90A 2X8FA 3UD8A 1AFCA 2EXHA 1V6XA 5ANNA 2IWTB 1J0SA 1K5UA 5AYEA 1MD6A 4G9NA 4ISRA 4I37A 2Q9XA 3KF5A 3WASA 1RZOB 4H04A 4JKQA 1N4KA 3JUTA 3D61A 2EXJA 2KI6B 2QN4A 3HBWA 3O3QA 3S8JA 3UJ4A 1Z2VA 3RMXA 4LO0A 1TTUA 3LTQA 1W18A 2MIBA 5FK8A 4Q9PA 5F8SA 5BVPI 1Y7BA 4HA2A 3AZVA 1P63A 3VUOA 4DEPA 4I4SA 3VSSA 3OBRA 3BYJA 4FGFA 2Q3NB 4HR6C 5JOWA 3P6IA 4I4OA 3R4ZA 2YFSA 3WPVA 3U14A 5D61A 3O4DA 4I1BA 5DSSB 3OBTA 4EB2B 2VXRA 3BAVA 2F2FC 3IAGC 2X2SA 3OM7A 3PIGA 3CU9A 4D0TA 3A21A 4GAFA 1XYFA 4NOVA 5FZYA 1VCLA 4I6IA 3LIGA 1JTCA 3CU1B 1ISXA 4JRAA 4D0ZA 2ESUA 1ABRB 3N7JA 1QXMA 4IY9A 2YFTA 3HMYA 1I1BA 4A7KA 3FGMA 1S0BA 1IOBA 2BEBA 3ZX7A 4X38A 3VEQA 1NZKA 5C0PA 4JP0A 1YIFA 5FZUA 4FFIA 4KEJA 5G00A 4EKXB 4Q91A 4ENDA 2VUAA 3RWKX 3K1XA 4O8OA 3S8KA 2ZR1B 3F1RA 5AYDA 3QYDA 5A8DA 4JKXB 4UDJA 4PC4A 3AH2A 2MC2A 1BFFA 1GYEB 5GLRA 4I2SA 3C7FA 3O44A 4OEEA 2QYIB 2RQ9A 5JLVA 5BQUC 2Y9GA 3H6RA 3ILAA 4G1RA 4N2RA 4CJMA 2GZBA 4LO2C 4UDKE 3H6SE 4TLPA 1T4QA 1A8DA 4O8PA 1OQLB 4L4IA 1DQOA 3D7WB 3KSTA 3I2AA 4X39A 3R4YA 4D8HA 4QD2B 3BYNA 3CRGA 1IHKA 3LDRA 3BA7A 3MPPG 3V79C 3O4OA 4KC3A 1WBAA 5DUYA 3R67A 3QEFA 3ZXGA 3CRIA 4UDGA 5EHAA 3WO2A 1ITBA 1FN0A 5BP5A 3UGHA 3WN1A 2NM1A 4LO0C 1R8NA 3PIJA 3UD7A 4MZGB 1II4A 1KNMA 4QALA 3T8SA 4X37A 5GAQA 1W2TA 1FGAA 3OM5A 4KCAA 4LO3A 2D7IA 2ERMA 4AK6A 3FFZA 5BOWA 3KMVA 3QEEA 3BAGA 1UPSA 3FJIA 2AEYA 2NTDA 1BLAA 3MALA 2K43A 4AK5A 3PMEA 1CVSA 4LO1C 5FLWA 1PC8B 3UDAA 1FMMS 3V0AA 2QQWA 1AVUA 3U75A 1HWOB 4OEFA 5GLQA 3V0BB 1YI7A 1BA7A 1RG8A 3B9UA 2EXIA 3NJ5A 1S0FA 1V6VA 4QBCA 1ILR1 3OM6A 2K4AB 1BASA 1Y9MA 3WMYA 1WD3A 1W3GA 3RMYA 3VWCA 1RMLA 4EFRA 3SC7X 5B6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GP0 A;  2FFU A;  3C7E A;  3D60 A;  3FJF A;  3ZXK A;  5JMC A;  1DQG A;  4MLG A;  2HWM A;  1YYN A;  3NBE A;  5A7V A;  4IQP A;  3H6Q A;  5AY9 A;  3C2U A;  1YXW A;  4ZLB B;  2P39 A;  2FDB M;  2OXB A;  3OM2 A;  4QBV A;  2D44 A;  1T9F A;  3QC2 A;  1R8O A;  2I1B A;  4ZKT B;  3AH1 A;  3QR5 A;  4EFQ A;  4JQ0 A;  4Q9G A;  1BFG A;  1CE7 B;  2D43 A;  3O4A A;  3N0K A;  4I96 A;  2XQR A;  1IJT A;  4KC8 A;  2RST A;  4XKI A;  3EF2 A;  2J3P A;  4N4B A;  1AVW B;  1YRZ A;  1MC9 A;  2UUS A;  1E0O A;  2YUG A;  3O49 A;  1JLX A;  1SR4 A;  2ZQO A;  2KKI A;  2WBC A;  1Q1U A;  1YBI A;  4LO7 C;  3PG0 A;  4G9M A;  3AKI A;  1BAR A;  1ISV A;  1W3A A;  3ZC9 A;  1NUN A;  4J2X A;  4A7Z A;  1V6W A;  1PUU B;  3FUQ A;  4IZX A;  4XFU A;  3BRD A;  2FO1 A;  4I4Y A;  2BEA A;  1JY0 A;  4JPZ A;  1Q04 A;  4HJJ A;  4LO3 C;  4OWK A;  1Q03 A;  1JLY A;  4DCK C;  2K8R A;  4ZFY B;  5B2H A;  5FIX A;  5FMB A;  3IM7 A;  3WMZ A;  4KCB A;  4KC7 A;  3CA4 A;  4FFG A;  3A07 A;  4I4Q A;  1HCD A;  2Y9X E;  3OGG A;  1PWA A;  2BFH A;  3BRF A;  3BRG C;  1SZ6 B;  2HZ9 A;  4AN7 B;  3VT2 A;  3A23 A;  1AXM A;  5AYC A;  1BFB A;  2ADE A;  4FFH A;  1V6U A;  1Z0H A;  3IM6 A;  3Q7W A;  3BTA A;  1HWM B;  2P23 A;  3LLP A;  1HWN B;  3PUB A;  4IYB A;  4USP A;  1I1E A;  5D63 A;  1UYP A;  1EV2 A;  3FJC A;  4IHZ A;  2NZ9 A;  3K1U A;  4KEI A;  4ION A;  3UJ0 A;  1PT2 A;  2AEZ A;  2L5X A;  4J2Y A;  4GOY A;  4J23 B;  2AQZ A;  41BI A;  5I1B A;  4OEG A;  4QQS A;  3IM5 A;  4UDI A;  5EG6 C;  3FJB A;  2LIQ A;  3BYK A;  2VLC A;  4II0 A;  5F8W A;  2F8X C;  2NVH A;  1TFM B;  4QKS A;  3ZXJ A;  4D47 A;  2ADD A;  3A22 A;  4PVA A;  2Y9F A;  4LO7 B;  4ZGR B;  3AKG A;  8I1B A;  1FV3 A;  3Q7X A;  1W3F A;  3CAH A;  1DJS B;  3O5W B;  3CA3 A;  1ISW A;  4G6M A;  1S0L A;  3OGF A;  1WD4 A;  7I1B A;  1G9B A;  3WIN A;  4I4X A;  4R6U B;  2F2F A;  4I4U A;  4KMI A;  5FKB A;  3WPU A;  2ET2 A;  3BAD A;  4I4R A;  3RTJ B;  3WN2 A;  1SR4 C;  3UGF A;  1JT4 A;  4EEE B;  3HN1 A;  2X8S A;  1PUM B;  2LIE A;  3R4S A;  1M2T B;  4QC4 A;  1TP0 A;  3WAT A;  1QQL A;  1TWE A;  5FZZ A;  3OM4 A;  3AKF A;  3N7L A;  3IIR A;  1ST8 A;  5FKC A;  3AJ5 A;  2DRE A;  4GP3 A;  3V0A B;  2IHO A;  3CA6 A;  1G9D A;  5F8Y A;  1GYD B;  2MLL B;  3JRR A;  5B6T A;  4A7Y A;  3CQA A;  1XZZ A;  1DFC A;  4O8N A;  1JT7 A;  3C7G A;  2FFV A;  4WBC A;  5BXT A;  3V0B A;  3D5Y A;  5GLM A;  1Z4S A;  1JQZ A;  3CA0 A;  3TAW A;  2HW9 A;  2XOA A;  2QQV A;  5JOZ A;  2KH2 A;  3HOM A;  3LIH A;  2Z49 A;  3WMV A;  3QED A;  3BX1 C;  4EQV A;  3BB2 A;  3LDK A;  2Y9W C;  3OJ2 A;  1Y9G A;  3WPZ A;  2R9K B;  3F62 B;  5A7V B;  2D20 A;  2VSE A;  2DRY A;  4GOV A;  4GAI A;  5EC5 A;  4U6B A;  1TWM A;  4UDK A;  3W9T A;  4OWL A;  5JOY A;  3BAO A;  2D23 A;  2M49 A;  4ZFU B;  2D7R A;  3N7M A;  5HPZ A;  3VSZ A;  3BAU A;  4ZA3 B;  2KI4 A;  1HKN A;  1QQK A;  5A8C A;  3LFI A;  5GLN A;  4IY8 A;  3LF7 A;  1ISY A;  4J2S A;  3FJJ A;  4ZFW B;  5D62 A;  5BP5 C;  1IT0 A;  3ZXL A;  3WA1 A;  1D0H A;  1S0C A;  4XFT A;  2B4W A;  1IRA X;  4I1E A;  4ZOT A;  4QD2 C;  4USO A;  4H9W A;  1EYL A;  2AXM A;  2YFR A;  3WN0 A;  5JOX A;  1EPW A;  3HAL A;  3AKH A;  4Z9W B;  3VT0 A;  1AVA C;  1GGP B;  2ZQN A;  3SNV A;  3KF3 A;  1PZZ A;  3O4C A;  1FMZ A;  4P0L A;  4N1I A;  1RY7 A;  3WIN C;  2NP0 A;  2VDT A;  3P2N A;  5GLO A;  3BYL A;  3Q7Y A;  1FWV A;  4LO1 A;  2NYY A;  5DZU A;  3WAU A;  2KLL A;  2WRY A;  1HIB A;  2E4M A;  4X3A A;  4QO3 A;  3UGG A;  1K5V A;  3AZW A;  3LV4 A;  4AK7 A;  6I1B A;  4ONZ A;  3N7K A;  1ONK B;  1AF9 A;  4I4V A;  1EVT A;  9ILB A;  3E8L C;  1TOO A;  1G82 A;  1YTO A;  2DRZ A;  1AVX B;  3BAH A;  4J2K A;  1G9C A;  1VKD A;  4AN6 A;  1FV2 A;  4LO8 B;  3C7H A;  3RTI B;  3CA5 A;  3NBN A;  1L2H A;  1XG6 A;  3FUO A;  1FWU A;  31BI A;  3H6R B;  1DZC A;  3OJV A;  4P6A A;  3C7O A;  4PVI A;  3BAQ A;  1BFC A;  2AC1 A;  3WPY A;  4P0K A;  5FNX A;  4Z8S B;  3OJM A;  2FGF A;  3UD9 A;  2GO2 A;  3ZC8 A;  1M16 A;  3NQH A;  4XFS A;  3FJH A;  3AJ6 A;  4YOL A;  3WO4 A;  3HSM A;  1DFQ A;  5FNW A;  2X2T A;  1F31 A;  1S0D A;  3FJD A;  3WMU A;  2VU9 A;  4EFP A;  4OWJ A;  2DS0 A;  1DZD A;  1IRP A;  1HWP B;  2D1Z A;  4FFF A;  1YF8 B;  4JAW A;  1GYH A;  2HWA A;  3VT1 A;  1S0E A;  3C9Z A;  3CRH A;  5E24 E;  1IIL A;  3VSR A;  2Z48 A;  3PHZ A;  4I3N A;  1G9A A;  4KBB A;  2D22 A;  5BXR A;  1DIW A;  4ZBV B;  4I7I A;  2VSA A;  2AAI B;  1BLD A;  3RSJ A;  4ISQ A;  5FK7 A;  3O4B A;  3BA4 A;  4FVV A;  1XHB A;  1DLL A;  3I29 B;  5BXP A;  4OUJ A;  21BI A;  4DEN A;  1UV4 A;  4P0J A;  4U6D A;  5GLL A;  1JT5 A;  3P53 A;  3LEM A;  3FJE A;  3CA1 A;  2QQU A;  3R4U A;  2AFG A;  4G6J A;  3VSF A;  1JT3 A;  3POK A;  3WO3 A;  4L4H A;  4IZE A;  2X8T A;  1WBC A;  1HCE A;  4OW4 A;  3FJA A;  5GLK A;  4COT A;  3AH4 A;  5DVH A;  3NBC A;  3D5Z A;  3P6J A;  2EXK A;  4I0Y A;  5BXS A;  4N2Z A;  3ZXD A;  1S0G A;  1TIE A;  3FJK A;  2E4M C;  3I2X A;  5FMD A;  5BQU A;  1FQ9 A;  2RG9 B;  1OYG A;  1WL7 A;  4F83 A;  5FMC A;  4I4P A;  2D24 A;  4KEK A;  4LO2 A;  3FJ8 A;  3QZ4 A;  4F34 A;  1Y4W A;  2VXT I;  3TC2 A;  3NBD A;  3BA5 A;  5GLP A;  3FJ9 A;  4QKR A;  1ISZ A;  4I8M A;  5F90 A;  2X8F A;  3UD8 A;  1AFC A;  2EXH A;  1V6X A;  5ANN A;  2IWT B;  1J0S A;  1K5U A;  5AYE A;  1MD6 A;  4G9N A;  4ISR A;  4I37 A;  2Q9X A;  3KF5 A;  3WAS A;  1RZO B;  4H04 A;  4JKQ A;  1N4K A;  3JUT A;  3D61 A;  2EXJ A;  2KI6 B;  2QN4 A;  3HBW A;  3O3Q A;  3S8J A;  3UJ4 A;  1Z2V A;  3RMX A;  4LO0 A;  1TTU A;  3LTQ A;  1W18 A;  2MIB A;  5FK8 A;  4Q9P A;  5F8S A;  5BVP I;  1Y7B A;  4HA2 A;  3AZV A;  1P63 A;  3VUO A;  4DEP A;  4I4S A;  3VSS A;  3OBR A;  3BYJ A;  4FGF A;  2Q3N B;  4HR6 C;  5JOW A;  3P6I A;  4I4O A;  3R4Z A;  2YFS A;  3WPV A;  3U14 A;  5D61 A;  3O4D A;  4I1B A;  5DSS B;  3OBT A;  4EB2 B;  2VXR A;  3BAV A;  2F2F C;  3IAG C;  2X2S A;  3OM7 A;  3PIG A;  3CU9 A;  4D0T A;  3A21 A;  4GAF A;  1XYF A;  4NOV A;  5FZY A;  1VCL A;  4I6I A;  3LIG A;  1JTC A;  3CU1 B;  1ISX A;  4JRA A;  4D0Z A;  2ESU A;  1ABR B;  3N7J A;  1QXM A;  4IY9 A;  2YFT A;  3HMY A;  1I1B A;  4A7K A;  3FGM A;  1S0B A;  1IOB A;  2BEB A;  3ZX7 A;  4X38 A;  3VEQ A;  1NZK A;  5C0P A;  4JP0 A;  1YIF A;  5FZU A;  4FFI A;  4KEJ A;  5G00 A;  4EKX B;  4Q91 A;  4END A;  2VUA A;  3RWK X;  3K1X A;  4O8O A;  3S8K A;  2ZR1 B;  3F1R A;  5AYD A;  3QYD A;  5A8D A;  4JKX B;  4UDJ A;  4PC4 A;  3AH2 A;  2MC2 A;  1BFF A;  1GYE B;  5GLR A;  4I2S A;  3C7F A;  3O44 A;  4OEE A;  2QYI B;  2RQ9 A;  5JLV A;  5BQU C;  2Y9G A;  3H6R A;  3ILA A;  4G1R A;  4N2R A;  4CJM A;  2GZB A;  4LO2 C;  4UDK E;  3H6S E;  4TLP A;  1T4Q A;  1A8D A;  4O8P A;  1OQL B;  4L4I A;  1DQO A;  3D7W B;  3KST A;  3I2A A;  4X39 A;  3R4Y A;  4D8H A;  4QD2 B;  3BYN A;  3CRG A;  1IHK A;  3LDR A;  3BA7 A;  3MPP G;  3V79 C;  3O4O A;  4KC3 A;  1WBA A;  5DUY A;  3R67 A;  3QEF A;  3ZXG A;  3CRI A;  4UDG A;  5EHA A;  3WO2 A;  1ITB A;  1FN0 A;  5BP5 A;  3UGH A;  3WN1 A;  2NM1 A;  4LO0 C;  1R8N A;  3PIJ A;  3UD7 A;  1II4 A;  1KNM A;  4QAL A;  3T8S A;  4X37 A;  5GAQ A;  1W2T A;  1FGA A;  3OM5 A;  4KCA A;  4LO3 A;  2D7I A;  2ERM A;  4AK6 A;  3FFZ A;  5BOW A;  3KMV A;  3QEE A;  3BAG A;  1UPS A;  3FJI A;  2AEY A;  2NTD A;  1BLA A;  3MAL A;  2K43 A;  4AK5 A;  3PME A;  1CVS A;  4LO1 C;  5FLW A;  1PC8 B;  3UDA A;  1FMM S;  3V0A A;  2QQW A;  1AVU A;  3U75 A;  1HWO B;  4OEF A;  5GLQ A;  3V0B B;  1YI7 A;  1BA7 A;  1RG8 A;  3B9U A;  2EXI A;  3NJ5 A;  1S0F A;  1V6V A;  4QBC A;  1ILR 1;  3OM6 A;  2K4A B;  1BAS A;  1Y9M A;  3WMY A;  1WD3 A;  1W3G A;  3RMY A;  3VWC A;  1RML A;  4EFR A;  3SC7 X;  5B6S A; 
#chains in the Genus database with same CATH topology
 4GP0 A;  2FFU A;  3C7E A;  3D60 A;  3FJF A;  3ZXK A;  5JMC A;  1DQG A;  4MLG A;  2HWM A;  1YYN A;  3NBE A;  5A7V A;  4IQP A;  3H6Q A;  5AY9 A;  3C2U A;  1YXW A;  4ZLB B;  2P39 A;  2FDB M;  2OXB A;  3OM2 A;  4QBV A;  2D44 A;  1T9F A;  3QC2 A;  1R8O A;  2I1B A;  4ZKT B;  3AH1 A;  3QR5 A;  4EFQ A;  4JQ0 A;  4Q9G A;  1BFG A;  1CE7 B;  2D43 A;  3O4A A;  3N0K A;  4I96 A;  2XQR A;  1IJT A;  4KC8 A;  2RST A;  4XKI A;  3EF2 A;  2J3P A;  4N4B A;  1AVW B;  1YRZ A;  1MC9 A;  2UUS A;  1E0O A;  2YUG A;  3O49 A;  1JLX A;  1SR4 A;  2ZQO A;  2KKI A;  2WBC A;  1Q1U A;  1YBI A;  4LO7 C;  3PG0 A;  4G9M A;  3AKI A;  1BAR A;  1ISV A;  1W3A A;  3ZC9 A;  1NUN A;  4J2X A;  4A7Z A;  1V6W A;  1PUU B;  3FUQ A;  4IZX A;  4XFU A;  3BRD A;  2FO1 A;  4I4Y A;  2BEA A;  1JY0 A;  4JPZ A;  1Q04 A;  4HJJ A;  4LO3 C;  4OWK A;  1Q03 A;  1JLY A;  4DCK C;  2K8R A;  4ZFY B;  5B2H A;  5FIX A;  5FMB A;  3IM7 A;  3WMZ A;  4KCB A;  4KC7 A;  3CA4 A;  4FFG A;  3A07 A;  4I4Q A;  1HCD A;  2Y9X E;  3OGG A;  1PWA A;  2BFH A;  3BRF A;  3BRG C;  1SZ6 B;  2HZ9 A;  4AN7 B;  3VT2 A;  3A23 A;  1AXM A;  5AYC A;  1BFB A;  2ADE A;  4FFH A;  1V6U A;  1Z0H A;  3IM6 A;  3Q7W A;  3BTA A;  1HWM B;  2P23 A;  3LLP A;  1HWN B;  3PUB A;  4IYB A;  4USP A;  1I1E A;  5D63 A;  1UYP A;  1EV2 A;  3FJC A;  4IHZ A;  2NZ9 A;  3K1U A;  4KEI A;  4ION A;  3UJ0 A;  1PT2 A;  2AEZ A;  2L5X A;  4J2Y A;  4GOY A;  4J23 B;  2AQZ A;  41BI A;  5I1B A;  4OEG A;  4QQS A;  3IM5 A;  4UDI A;  5EG6 C;  3FJB A;  2LIQ A;  3BYK A;  2VLC A;  4II0 A;  5F8W A;  2F8X C;  2NVH A;  1TFM B;  4QKS A;  3ZXJ A;  4D47 A;  4UY4 A;  2ADD A;  3A22 A;  4PVA A;  2Y9F A;  4LO7 B;  4ZGR B;  3AKG A;  8I1B A;  1FV3 A;  3Q7X A;  1W3F A;  3CAH A;  1DJS B;  5C2M A;  3O5W B;  3CA3 A;  1ISW A;  4G6M A;  1S0L A;  3OGF A;  1WD4 A;  7I1B A;  1G9B A;  3WIN A;  4I4X A;  4R6U B;  2F2F A;  4I4U A;  4KMI A;  5FKB A;  3WPU A;  2ET2 A;  3BAD A;  4I4R A;  3RTJ B;  3WN2 A;  1SR4 C;  3UGF A;  1JT4 A;  4EEE B;  3HN1 A;  2X8S A;  1PUM B;  2LIE A;  3R4S A;  1M2T B;  4H75 A;  4QC4 A;  1TP0 A;  3WAT A;  1QQL A;  1TWE A;  5FZZ A;  3OM4 A;  3AKF A;  3N7L A;  3IIR A;  1ST8 A;  5FKC A;  3AJ5 A;  2DRE A;  4GP3 A;  3V0A B;  2IHO A;  3CA6 A;  1G9D A;  5F8Y A;  1GYD B;  2MLL B;  3JRR A;  5B6T A;  4A7Y A;  3CQA A;  4MZF B;  1XZZ A;  1DFC A;  4O8N A;  1JT7 A;  3C7G A;  2FFV A;  4WBC A;  5BXT A;  3V0B A;  3D5Y A;  5GLM A;  1Z4S A;  1JQZ A;  3CA0 A;  3TAW A;  2HW9 A;  2XOA A;  2QQV A;  5JOZ A;  2KH2 A;  3HOM A;  3LIH A;  2Z49 A;  3WMV A;  3QED A;  3BX1 C;  4EQV A;  3BB2 A;  3LDK A;  2Y9W C;  3OJ2 A;  1Y9G A;  3WPZ A;  2R9K B;  3F62 B;  5A7V B;  2D20 A;  2VSE A;  2DRY A;  4GOV A;  4GAI A;  5EC5 A;  4U6B A;  1TWM A;  4UDK A;  3W9T A;  4OWL A;  5JOY A;  3BAO A;  2D23 A;  2M49 A;  4ZFU B;  2D7R A;  3N7M A;  5HPZ A;  3VSZ A;  3BAU A;  4ZA3 B;  2KI4 A;  1HKN A;  1QQK A;  5A8C A;  3LFI A;  5GLN A;  4IY8 A;  3LF7 A;  4MZH A;  1ISY A;  4J2S A;  3FJJ A;  4ZFW B;  5D62 A;  5BP5 C;  1IT0 A;  3ZXL A;  3WA1 A;  1D0H A;  1S0C A;  4XFT A;  2B4W A;  1IRA X;  4I1E A;  4ZOT A;  4QD2 C;  4USO A;  4H9W A;  1EYL A;  2AXM A;  2YFR A;  3WN0 A;  5JOX A;  1EPW A;  3HAL A;  3AKH A;  4Z9W B;  3VT0 A;  1AVA C;  1GGP B;  2ZQN A;  3SNV A;  3KF3 A;  1PZZ A;  3O4C A;  1FMZ A;  4P0L A;  4N1I A;  1RY7 A;  3WIN C;  2NP0 A;  2VDT A;  3P2N A;  5GLO A;  3BYL A;  3Q7Y A;  1FWV A;  4LO1 A;  2NYY A;  5DZU A;  3WAU A;  2KLL A;  2WRY A;  1HIB A;  2E4M A;  4X3A A;  4QO3 A;  3UGG A;  1K5V A;  3AZW A;  3LV4 A;  4AK7 A;  6I1B A;  4ONZ A;  3N7K A;  1ONK B;  1AF9 A;  4I4V A;  1EVT A;  9ILB A;  3E8L C;  1TOO A;  1G82 A;  1YTO A;  2DRZ A;  1AVX B;  3BAH A;  4J2K A;  1G9C A;  1VKD A;  4AN6 A;  1FV2 A;  4LO8 B;  3C7H A;  3RTI B;  3CA5 A;  3NBN A;  1L2H A;  1XG6 A;  1FWU A;  31BI A;  3FUO A;  3H6R B;  1DZC A;  3OJV A;  4P6A A;  1TL2 A;  3C7O A;  3BAQ A;  1BFC A;  2AC1 A;  4PVI A;  3WPY A;  4P0K A;  5FNX A;  4Z8S B;  3OJM A;  2FGF A;  3UD9 A;  2GO2 A;  3ZC8 A;  1M16 A;  3NQH A;  4XFS A;  3FJH A;  3AJ6 A;  4YOL A;  3WO4 A;  3HSM A;  1DFQ A;  5FNW A;  2X2T A;  1F31 A;  1S0D A;  3FJD A;  3WMU A;  2VU9 A;  4EFP A;  4OWJ A;  2DS0 A;  1DZD A;  1IRP A;  1HWP B;  2D1Z A;  4FFF A;  1YF8 B;  4JAW A;  1GYH A;  2HWA A;  3VT1 A;  1S0E A;  3C9Z A;  2NS2 A;  3CRH A;  5E24 E;  1IIL A;  3VSR A;  2Z48 A;  3PHZ A;  4I3N A;  1G9A A;  4KBB A;  2D22 A;  5BXR A;  1DIW A;  4ZBV B;  4I7I A;  2VSA A;  2AAI B;  1BLD A;  3RSJ A;  4ISQ A;  5FK7 A;  3O4B A;  3BA4 A;  4FVV A;  1XHB A;  1DLL A;  3I29 B;  5BXP A;  4OUJ A;  21BI A;  4DEN A;  1UV4 A;  4P0J A;  4U6D A;  5GLL A;  1JT5 A;  3P53 A;  3LEM A;  3FJE A;  3CA1 A;  2QQU A;  3R4U A;  2AFG A;  4G6J A;  3VSF A;  1JT3 A;  3POK A;  3WO3 A;  4L4H A;  4IZE A;  2X8T A;  1WBC A;  1HCE A;  4OW4 A;  3FJA A;  5GLK A;  4COT A;  3AH4 A;  5DVH A;  3NBC A;  3D5Z A;  3P6J A;  2EXK A;  4I0Y A;  5BXS A;  4N2Z A;  3ZXD A;  1S0G A;  1TIE A;  3FJK A;  2E4M C;  3I2X A;  5FMD A;  5BQU A;  1FQ9 A;  2RG9 B;  1OYG A;  1WL7 A;  4F83 A;  5FMC A;  4I4P A;  2D24 A;  4KEK A;  4LO2 A;  3FJ8 A;  3QZ4 A;  4F34 A;  1Y4W A;  2VXT I;  3TC2 A;  3NBD A;  3BA5 A;  5GLP A;  3FJ9 A;  4QKR A;  1ISZ A;  4I8M A;  5F90 A;  2X8F A;  3UD8 A;  1AFC A;  2EXH A;  1V6X A;  5ANN A;  2IWT B;  1J0S A;  1K5U A;  5AYE A;  1MD6 A;  4G9N A;  4ISR A;  4I37 A;  2Q9X A;  3KF5 A;  3WAS A;  1RZO B;  4H04 A;  4JKQ A;  1N4K A;  3JUT A;  3D61 A;  2EXJ A;  2KI6 B;  2QN4 A;  3HBW A;  3O3Q A;  3S8J A;  3UJ4 A;  1Z2V A;  3RMX A;  4LO0 A;  1TTU A;  3LTQ A;  1W18 A;  2MIB A;  5FK8 A;  4Q9P A;  5F8S A;  5BVP I;  1Y7B A;  4HA2 A;  3AZV A;  1P63 A;  3VUO A;  4DEP A;  4I4S A;  3VSS A;  3OBR A;  3BYJ A;  4FGF A;  2Q3N B;  4HR6 C;  5JOW A;  3P6I A;  4I4O A;  3R4Z A;  2YFS A;  3WPV A;  3U14 A;  5D61 A;  3O4D A;  4I1B A;  5DSS B;  3OBT A;  4EB2 B;  2VXR A;  3BAV A;  2F2F C;  3IAG C;  2X2S A;  3OM7 A;  3PIG A;  3CU9 A;  4D0T A;  3A21 A;  4GAF A;  1XYF A;  4NOV A;  5FZY A;  1VCL A;  4I6I A;  3LIG A;  1JTC A;  3CU1 B;  1ISX A;  4JRA A;  4D0Z A;  2ESU A;  1ABR B;  3N7J A;  1QXM A;  4IY9 A;  2YFT A;  3HMY A;  1I1B A;  4A7K A;  3FGM A;  1S0B A;  1IOB A;  2BEB A;  3ZX7 A;  4X38 A;  3VEQ A;  1NZK A;  5C0P A;  4JP0 A;  1YIF A;  5FZU A;  4FFI A;  4KEJ A;  5G00 A;  4EKX B;  4Q91 A;  4END A;  2VUA A;  3RWK X;  3K1X A;  4O8O A;  3S8K A;  2ZR1 B;  3F1R A;  5AYD A;  3QYD A;  5A8D A;  4JKX B;  4UDJ A;  4PC4 A;  3AH2 A;  2MC2 A;  1BFF A;  1GYE B;  5GLR A;  4I2S A;  3C7F A;  3O44 A;  4OEE A;  2QYI B;  2RQ9 A;  5JLV A;  5BQU C;  2Y9G A;  3H6R A;  3ILA A;  4G1R A;  4N2R A;  4CJM A;  2GZB A;  4LO2 C;  4UDK E;  3H6S E;  4TLP A;  1T4Q A;  1A8D A;  4O8P A;  1OQL B;  4L4I A;  1DQO A;  3D7W B;  3KST A;  3I2A A;  4X39 A;  3R4Y A;  4D8H A;  4QD2 B;  3BYN A;  3CRG A;  1IHK A;  3LDR A;  3BA7 A;  3MPP G;  3V79 C;  3O4O A;  4KC3 A;  1WBA A;  5DUY A;  3R67 A;  3QEF A;  3ZXG A;  3CRI A;  4UDG A;  5EHA A;  3WO2 A;  1ITB A;  1FN0 A;  5BP5 A;  3UGH A;  3WN1 A;  2NM1 A;  4LO0 C;  1R8N A;  3PIJ A;  3UD7 A;  4MZG B;  1II4 A;  1KNM A;  4QAL A;  3T8S A;  4X37 A;  5GAQ A;  1W2T A;  1FGA A;  3OM5 A;  4KCA A;  4LO3 A;  2D7I A;  2ERM A;  4AK6 A;  3FFZ A;  5BOW A;  3KMV A;  3QEE A;  3BAG A;  1UPS A;  3FJI A;  2AEY A;  2NTD A;  1BLA A;  3MAL A;  2K43 A;  4AK5 A;  3PME A;  1CVS A;  4LO1 C;  5FLW A;  1PC8 B;  3UDA A;  1FMM S;  3V0A A;  2QQW A;  1AVU A;  3U75 A;  1HWO B;  4OEF A;  5GLQ A;  3V0B B;  1YI7 A;  1BA7 A;  1RG8 A;  3B9U A;  2EXI A;  3NJ5 A;  1S0F A;  1V6V A;  4QBC A;  1ILR 1;  3OM6 A;  2K4A B;  1BAS A;  1Y9M A;  3WMY A;  1WD3 A;  1W3G A;  3RMY A;  3VWC A;  1RML A;  4EFR A;  3SC7 X;  5B6S A; 
#chains in the Genus database with same CATH homology
 4GP0 A;  2FFU A;  3C7E A;  3D60 A;  3FJF A;  3ZXK A;  5JMC A;  1DQG A;  4MLG A;  2HWM A;  1YYN A;  3NBE A;  5A7V A;  4IQP A;  3H6Q A;  5AY9 A;  3C2U A;  1YXW A;  4ZLB B;  2P39 A;  2FDB M;  2OXB A;  3OM2 A;  4QBV A;  2D44 A;  1T9F A;  3QC2 A;  1R8O A;  2I1B A;  4ZKT B;  3AH1 A;  3QR5 A;  4EFQ A;  4JQ0 A;  4Q9G A;  1BFG A;  1CE7 B;  2D43 A;  3O4A A;  3N0K A;  4I96 A;  2XQR A;  1IJT A;  4KC8 A;  2RST A;  4XKI A;  3EF2 A;  2J3P A;  4N4B A;  1AVW B;  1YRZ A;  1MC9 A;  2UUS A;  1E0O A;  2YUG A;  3O49 A;  1JLX A;  1SR4 A;  2ZQO A;  2KKI A;  2WBC A;  1Q1U A;  1YBI A;  4LO7 C;  3PG0 A;  4G9M A;  3AKI A;  1BAR A;  1ISV A;  1W3A A;  3ZC9 A;  1NUN A;  4J2X A;  4A7Z A;  1V6W A;  1PUU B;  3FUQ A;  4IZX A;  4XFU A;  3BRD A;  2FO1 A;  4I4Y A;  2BEA A;  1JY0 A;  4JPZ A;  1Q04 A;  4HJJ A;  4LO3 C;  4OWK A;  1Q03 A;  1JLY A;  4DCK C;  2K8R A;  4ZFY B;  5B2H A;  5FIX A;  5FMB A;  3IM7 A;  3WMZ A;  4KCB A;  4KC7 A;  3CA4 A;  4FFG A;  3A07 A;  4I4Q A;  1HCD A;  2Y9X E;  3OGG A;  1PWA A;  2BFH A;  3BRF A;  3BRG C;  1SZ6 B;  2HZ9 A;  4AN7 B;  3VT2 A;  3A23 A;  1AXM A;  5AYC A;  1BFB A;  2ADE A;  4FFH A;  1V6U A;  1Z0H A;  3IM6 A;  3Q7W A;  3BTA A;  1HWM B;  2P23 A;  3LLP A;  1HWN B;  3PUB A;  4IYB A;  4USP A;  1I1E A;  5D63 A;  1UYP A;  1EV2 A;  3FJC A;  4IHZ A;  2NZ9 A;  3K1U A;  4KEI A;  4ION A;  3UJ0 A;  1PT2 A;  2AEZ A;  2L5X A;  4J2Y A;  4GOY A;  4J23 B;  2AQZ A;  41BI A;  5I1B A;  4OEG A;  4QQS A;  3IM5 A;  4UDI A;  5EG6 C;  3FJB A;  2LIQ A;  3BYK A;  2VLC A;  4II0 A;  5F8W A;  2F8X C;  2NVH A;  1TFM B;  4QKS A;  3ZXJ A;  4D47 A;  4UY4 A;  2ADD A;  3A22 A;  4PVA A;  2Y9F A;  4LO7 B;  4ZGR B;  3AKG A;  8I1B A;  1FV3 A;  3Q7X A;  1W3F A;  3CAH A;  1DJS B;  3O5W B;  3CA3 A;  1ISW A;  4G6M A;  1S0L A;  3OGF A;  1WD4 A;  7I1B A;  1G9B A;  3WIN A;  4I4X A;  4R6U B;  2F2F A;  4I4U A;  4KMI A;  5FKB A;  3WPU A;  2ET2 A;  3BAD A;  4I4R A;  3RTJ B;  3WN2 A;  1SR4 C;  3UGF A;  1JT4 A;  4EEE B;  3HN1 A;  2X8S A;  1PUM B;  2LIE A;  3R4S A;  1M2T B;  4H75 A;  4QC4 A;  1TP0 A;  3WAT A;  1QQL A;  1TWE A;  5FZZ A;  3OM4 A;  3AKF A;  3N7L A;  3IIR A;  1ST8 A;  5FKC A;  3AJ5 A;  2DRE A;  4GP3 A;  3V0A B;  2IHO A;  3CA6 A;  1G9D A;  5F8Y A;  1GYD B;  2MLL B;  3JRR A;  5B6T A;  4A7Y A;  3CQA A;  4MZF B;  1XZZ A;  1DFC A;  4O8N A;  1JT7 A;  3C7G A;  2FFV A;  4WBC A;  5BXT A;  3V0B A;  3D5Y A;  5GLM A;  1Z4S A;  1JQZ A;  3CA0 A;  3TAW A;  2HW9 A;  2XOA A;  2QQV A;  5JOZ A;  2KH2 A;  3HOM A;  3LIH A;  2Z49 A;  3WMV A;  3QED A;  3BX1 C;  4EQV A;  3BB2 A;  3LDK A;  2Y9W C;  3OJ2 A;  1Y9G A;  3WPZ A;  2R9K B;  3F62 B;  5A7V B;  2D20 A;  2VSE A;  2DRY A;  4GOV A;  4GAI A;  5EC5 A;  4U6B A;  1TWM A;  4UDK A;  3W9T A;  4OWL A;  5JOY A;  3BAO A;  2D23 A;  2M49 A;  4ZFU B;  2D7R A;  3N7M A;  5HPZ A;  3VSZ A;  3BAU A;  4ZA3 B;  2KI4 A;  1HKN A;  1QQK A;  5A8C A;  3LFI A;  5GLN A;  4IY8 A;  3LF7 A;  4MZH A;  1ISY A;  4J2S A;  3FJJ A;  4ZFW B;  5D62 A;  5BP5 C;  1IT0 A;  3ZXL A;  3WA1 A;  1D0H A;  1S0C A;  4XFT A;  2B4W A;  1IRA X;  4I1E A;  4ZOT A;  4QD2 C;  4USO A;  4H9W A;  1EYL A;  2AXM A;  2YFR A;  3WN0 A;  5JOX A;  1EPW A;  3HAL A;  3AKH A;  4Z9W B;  3VT0 A;  1AVA C;  1GGP B;  2ZQN A;  3SNV A;  3KF3 A;  1PZZ A;  3O4C A;  1FMZ A;  4P0L A;  4N1I A;  1RY7 A;  3WIN C;  2NP0 A;  2VDT A;  3P2N A;  5GLO A;  3BYL A;  3Q7Y A;  1FWV A;  4LO1 A;  2NYY A;  5DZU A;  3WAU A;  2KLL A;  2WRY A;  1HIB A;  2E4M A;  4X3A A;  4QO3 A;  3UGG A;  1K5V A;  3AZW A;  3LV4 A;  4AK7 A;  6I1B A;  4ONZ A;  3N7K A;  1ONK B;  1AF9 A;  4I4V A;  1EVT A;  9ILB A;  3E8L C;  1TOO A;  1G82 A;  1YTO A;  2DRZ A;  1AVX B;  3BAH A;  4J2K A;  1G9C A;  1VKD A;  4AN6 A;  1FV2 A;  4LO8 B;  3C7H A;  3RTI B;  3CA5 A;  3NBN A;  1L2H A;  1XG6 A;  1FWU A;  31BI A;  3FUO A;  3H6R B;  1DZC A;  3OJV A;  4P6A A;  3C7O A;  4PVI A;  3BAQ A;  1BFC A;  2AC1 A;  3WPY A;  4P0K A;  5FNX A;  4Z8S B;  3OJM A;  2FGF A;  3UD9 A;  2GO2 A;  3ZC8 A;  1M16 A;  3NQH A;  4XFS A;  3FJH A;  3AJ6 A;  4YOL A;  3WO4 A;  3HSM A;  1DFQ A;  5FNW A;  2X2T A;  1F31 A;  1S0D A;  3FJD A;  3WMU A;  2VU9 A;  4EFP A;  4OWJ A;  2DS0 A;  1DZD A;  1IRP A;  1HWP B;  2D1Z A;  4FFF A;  1YF8 B;  4JAW A;  1GYH A;  2HWA A;  3VT1 A;  1S0E A;  3C9Z A;  2NS2 A;  3CRH A;  5E24 E;  1IIL A;  3VSR A;  2Z48 A;  3PHZ A;  4I3N A;  1G9A A;  4KBB A;  2D22 A;  5BXR A;  1DIW A;  4ZBV B;  4I7I A;  2VSA A;  2AAI B;  1BLD A;  3RSJ A;  4ISQ A;  5FK7 A;  3O4B A;  3BA4 A;  4FVV A;  1XHB A;  1DLL A;  3I29 B;  5BXP A;  4OUJ A;  21BI A;  4DEN A;  1UV4 A;  4P0J A;  4U6D A;  5GLL A;  1JT5 A;  3P53 A;  3LEM A;  3FJE A;  3CA1 A;  2QQU A;  3R4U A;  2AFG A;  4G6J A;  3VSF A;  1JT3 A;  3POK A;  3WO3 A;  4L4H A;  4IZE A;  2X8T A;  1WBC A;  1HCE A;  4OW4 A;  3FJA A;  5GLK A;  4COT A;  3AH4 A;  5DVH A;  3NBC A;  3D5Z A;  3P6J A;  2EXK A;  4I0Y A;  5BXS A;  4N2Z A;  3ZXD A;  1S0G A;  1TIE A;  3FJK A;  2E4M C;  3I2X A;  5FMD A;  5BQU A;  1FQ9 A;  2RG9 B;  1OYG A;  1WL7 A;  4F83 A;  5FMC A;  4I4P A;  2D24 A;  4KEK A;  4LO2 A;  3FJ8 A;  3QZ4 A;  4F34 A;  1Y4W A;  2VXT I;  3TC2 A;  3NBD A;  3BA5 A;  5GLP A;  3FJ9 A;  4QKR A;  1ISZ A;  4I8M A;  5F90 A;  2X8F A;  3UD8 A;  1AFC A;  2EXH A;  1V6X A;  5ANN A;  2IWT B;  1J0S A;  1K5U A;  5AYE A;  1MD6 A;  4G9N A;  4ISR A;  4I37 A;  2Q9X A;  3KF5 A;  3WAS A;  1RZO B;  4H04 A;  4JKQ A;  1N4K A;  3JUT A;  3D61 A;  2EXJ A;  2KI6 B;  2QN4 A;  3HBW A;  3O3Q A;  3S8J A;  3UJ4 A;  1Z2V A;  3RMX A;  4LO0 A;  1TTU A;  3LTQ A;  1W18 A;  2MIB A;  5FK8 A;  4Q9P A;  5F8S A;  5BVP I;  1Y7B A;  4HA2 A;  3AZV A;  1P63 A;  3VUO A;  4DEP A;  4I4S A;  3VSS A;  3OBR A;  3BYJ A;  4FGF A;  2Q3N B;  4HR6 C;  5JOW A;  3P6I A;  4I4O A;  3R4Z A;  2YFS A;  3WPV A;  3U14 A;  5D61 A;  3O4D A;  4I1B A;  5DSS B;  3OBT A;  4EB2 B;  2VXR A;  3BAV A;  2F2F C;  3IAG C;  2X2S A;  3OM7 A;  3PIG A;  3CU9 A;  4D0T A;  3A21 A;  4GAF A;  1XYF A;  4NOV A;  5FZY A;  1VCL A;  4I6I A;  3LIG A;  1JTC A;  3CU1 B;  1ISX A;  4JRA A;  4D0Z A;  2ESU A;  1ABR B;  3N7J A;  1QXM A;  4IY9 A;  2YFT A;  3HMY A;  1I1B A;  4A7K A;  3FGM A;  1S0B A;  1IOB A;  2BEB A;  3ZX7 A;  4X38 A;  3VEQ A;  1NZK A;  5C0P A;  4JP0 A;  1YIF A;  5FZU A;  4FFI A;  4KEJ A;  5G00 A;  4EKX B;  4Q91 A;  4END A;  2VUA A;  3RWK X;  3K1X A;  4O8O A;  3S8K A;  2ZR1 B;  3F1R A;  5AYD A;  3QYD A;  5A8D A;  4JKX B;  4UDJ A;  4PC4 A;  3AH2 A;  2MC2 A;  1BFF A;  1GYE B;  5GLR A;  4I2S A;  3C7F A;  3O44 A;  4OEE A;  2QYI B;  2RQ9 A;  5JLV A;  5BQU C;  2Y9G A;  3H6R A;  3ILA A;  4G1R A;  4N2R A;  4CJM A;  2GZB A;  4LO2 C;  4UDK E;  3H6S E;  4TLP A;  1T4Q A;  1A8D A;  4O8P A;  1OQL B;  4L4I A;  1DQO A;  3D7W B;  3KST A;  3I2A A;  4X39 A;  3R4Y A;  4D8H A;  4QD2 B;  3BYN A;  3CRG A;  1IHK A;  3LDR A;  3BA7 A;  3MPP G;  3V79 C;  3O4O A;  4KC3 A;  1WBA A;  5DUY A;  3R67 A;  3QEF A;  3ZXG A;  3CRI A;  4UDG A;  5EHA A;  3WO2 A;  1ITB A;  1FN0 A;  5BP5 A;  3UGH A;  3WN1 A;  2NM1 A;  4LO0 C;  1R8N A;  3PIJ A;  3UD7 A;  4MZG B;  1II4 A;  1KNM A;  4QAL A;  3T8S A;  4X37 A;  5GAQ A;  1W2T A;  1FGA A;  3OM5 A;  4KCA A;  4LO3 A;  2D7I A;  2ERM A;  4AK6 A;  3FFZ A;  5BOW A;  3KMV A;  3QEE A;  3BAG A;  1UPS A;  3FJI A;  2AEY A;  2NTD A;  1BLA A;  3MAL A;  2K43 A;  4AK5 A;  3PME A;  1CVS A;  4LO1 C;  5FLW A;  1PC8 B;  3UDA A;  1FMM S;  3V0A A;  2QQW A;  1AVU A;  3U75 A;  1HWO B;  4OEF A;  5GLQ A;  3V0B B;  1YI7 A;  1BA7 A;  1RG8 A;  3B9U A;  2EXI A;  3NJ5 A;  1S0F A;  1V6V A;  4QBC A;  1ILR 1;  3OM6 A;  2K4A B;  1BAS A;  1Y9M A;  3WMY A;  1WD3 A;  1W3G A;  3RMY A;  3VWC A;  1RML A;  4EFR A;  3SC7 X;  5B6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...