1DIZA

Crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA bending and a flip-out mechanism for base excision by the helix-hairpin-helix DNA glycosylase, Escherichia coli AlkA.
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*AP*CP*AP*TP*GP*AP*(NRI)P*TP*GP*CP*CP*T)-3')
molecule tags Hydrolase/dna
source organism Escherichia coli
total genus 93
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 1999-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1dizA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1dizA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 1dizA01
3CWAA 3CWSA 5KN8A 2NOBA 3N0UA 1KEAA 1VRLA 2NOZA 1KO9A 4AI4A 1KQJA 3CW7A 2ABKA 3D4VA 5DPKA 1N39A 4EJZA 3N5NX 1WEGA 4OFAA 3F0ZA 1HU0A 1KG6A 1LWVA 4YOQA 4EW0A 1LWWA 5CHZA 1KG2A 1YQMA 1N3AA 1NKUA 4B21A 3FSPA 3I0WA 2NOEA 3S6IA 1WEIA 2OFIA 1LWYA 2YG9A 1PU7A 2JG6A 3F10A 2I5WA 4E9GA 2JHNA 1XQPA 4E9FA 4B24A 1FN7A 1ORNA 4E9HA 2NOIA 2OFKA 1PU6A 4HSBA 1P7MA 1MUDA 4EA5A 1YQKA 2NOHA 2YG8A 3OH9A 4AI5A 4EJYA 3CVSA 2NOFA 3OGDA 2H56A 1MUNA 1M3HA 1N3CA 1M3QA 4OFHA 3CVTA 4UOBA 1NGNA 4DK9A 2XHIA 3FHGA 1KG5A 1PVSA 3OH6A 4AIAA 3IH7A 2JHJA 1XG7A 1P59A 5KN9A 4EVVA 1YQLA 3IHOA 1MPGA 1DIZA 4YPRA 1PU8A 4OFEA 4EW4A 1KG3A 1MUYA 3I0XA 1WEFA 4PIIA 5AN4A 4B23A 4YPHA 1RRSA 3CWUA 3G0QA 4UNFA 1XQOA 2NOLA 1KG4A 3KNTA 4EA4A 4B22A 1RRQA 1EBMA 1LMZA 1YQRA 3KTUA 4E9EA 1ORPA 1KG7A 3CWTA 3FHFA
chains in the Genus database with same CATH superfamily
3CWAA 3CWSA 2NVMA 1NVPA 1QNAA 3N0UA 2NOZA 1VOKA 3TE5A 2V92A 2FKMX 1Q9UA 4HJHA 1N39A 4EJZA 1WEGA 3ENCA 1KG6A 4EW0A 2YH5A 5JMVD 1VKLA 2NOEA 5F9CA 2QREA 1WEIA 1QN8A 3PDKA 2VJ0A 2Y8QA 2JHNA 1QN3A 3OS0A 4B24A 3OSTA 3I3WA 1ORNA 1TGHA 5IYDP 2QR1A 2V8QA 1TUOA 1LXTA 2V75A 2OOYA 3HS9A 4BDYA 4EA5A 3BKQX 2YG8A 3OH9A 4AI5A 2QLVA 1C4GA 2LAEA 1KFQA 3RPJA 4OFHA 3CVTA 3SNSA 2XHIA 1KY6A 1KYFA 4AIAA 1XG7A 5KN9A 3OSMA 1J3MA 3RSMA 1P5GX 3S3MA 2R5XA 4BJUA 1T6AA 2NWVA 4WXAA 3EIKA 4B23A 1RRSA 1KYUA 3OYEA 3OY9A 3TDHA 3OYBA 4ZTJA 4EALA 5BMNA 3OC3C 1MP9A 3KTUA 3NNQA 4E9EA 4C7PA 2Z0FA 3FHFA 2D0AA 1VOLB 1QTPA 2NOBA 2G30A 3OLPA 1M5Q1 1KQJA 2ZFDB 2ABKA 2JPIA 1K2YX 3N5NX 2QRDA 5FROA 4OFAA 3F0ZA 3EAYA 1LWVA 2F7LA 1KG2A 3I0WA 4TPSA 1QN4A 3S6IA 1B9KA 1K35A 1E42A 3D7QA 1LWYA 2H5AX 1PU7A 3ULXA 4IKFA 1XQPA 3OS2A 4E9FA 1P5DX 4BE1A 5IYCP 2JPSA 2NOIA 2OFKA 1AISA 3DPUA 3S3OA 2IV9A 3OYIA 4Q11A 1P7MA 1MUDA 2NOFA 1CDWA 1QNCA 1JDYA 1KFIA 4ZTFA 4DK9A 3FHGA 1KG5A 3OH6A 3KRMA 1YTBA 3OYFA 1YQLA 4NZGA 4PY5A 1DIZA 1PU8A 4OFEA 4E7HA 5KL0A 1KG3A 5BMPA 1QN5A 3I0XA 2FUVA 4RODB 1XQOA 1RM1A 3KNTA 1WQAA 1KY7A 3L2QA 4BACA 3T4NA 3CWTA 4ROEB 2W03A 3OS1A 4D7QA 2MJ7A 2MZ8A 3OYLA 1NGMA 1KEAA 1VRLA 1KO9A 4AI4A 1V5SA 2OOXA 4EAKA 5DPKA 2FGTA 4IL8A 2V9JA 1HU0A 4YOQA 5FRMA 1EUVA 1LWWA 5CHZA 3R2XC 1YQMA 1N3AA 4B21A 1UL7A 4BDZA 2OFIA 2YG9A 3F10A 3L2RA 3OYHA 3OYCA 2Z8UA 4EAIA 3N89A 1PCZA 1FN7A 2PWWA 4E9HA 1PU6A 1PZDA 3OYGA 3L2WA 4E7LA 1YQKA 2NOHA 4WX8A 4E7JA 2D0BA 4EJYA 4MRQA 3H1ZA 3OGDA 1U84A 1N3CA 4WZSD 2DKAA 1NGNA 2D0CA 3OYNA 3DPTA 4EAGA 1D3UA 1PVSA 1QN6A 1P59A 4EVVA 1UT4A 4CFFA 3C04A 1C47A 3OYDA 4EW4A 2H4LX 3OSEA 4B0AA 5AN4A 4YPHA 1W80A 2HL9A 4UNFA 3ASMA 1VTOA 1KG4A 3ENOC 4B22A 1YQRA 4E7IA 2O3OA 3OYJA 2HKPA 5KN8A 3OYMA 4D7RA 1TBPA 3OCIA 2YA3A 4I8OA 2DKDA 3CW7A 3OYKA 1QNEA 1KYDA 3D4VA 1PCMX 2FKFA 1YTFA 1QN9A 2QRCA 3NA5A 3L2VA 1NKUA 3FSPA 3LCNA 4BE0A 2W04A 2DKCA 2JG6A 2I5WA 1R4XA 4E9GA 3VN5A 1NH2A 2NLVA 1XSZA 2Y8LA 2HZMA 2JOIA 1VTLE 4ROCB 5JN5A 3OYAA 4DULA 4HSBA 5FRNA 4EAJA 5HSHA 1TBAB 5IYBP 4E7KA 3CVSA 3HS8A 3UW2A 2H56A 2EHBD 2HL8A 1MUNA 1M3HA 2IV8A 1M3QA 4UOBA 1QN7A 1JFIC 3VW4A 3IH7A 2JHJA 3L2UA 4BE2A 3IHOA 1MPGA 2HZSA 4YPRA 3PMGA 1MUYA 1C9BB 1WEFA 4PIIA 1WJWA 1UT7A 3CWUA 3S3NA 3G0QA 2NOLA 1PCJX 1QNBA 4EA4A 1RRQA 1EBMA 1LMZA 1QTSA 1ORPA 1KG7A 5EPCA 4QG5A
chains in the Genus database with same CATH topology
3CWAA 3CWSA 5KN8A 2NOBA 3N0UA 1KEAA 1VRLA 2NOZA 1KO9A 4AI4A 1KQJA 3CW7A 2ABKA 3D4VA 5DPKA 1N39A 4EJZA 3N5NX 1WEGA 4OFAA 3F0ZA 1HU0A 1KG6A 1LWVA 4YOQA 4EW0A 1LWWA 5CHZA 1KG2A 1YQMA 1N3AA 1NKUA 4B21A 3FSPA 3I0WA 2NOEA 3S6IA 1WEIA 2OFIA 1LWYA 2YG9A 1PU7A 2JG6A 3F10A 2I5WA 4E9GA 2JHNA 1XQPA 4E9FA 4B24A 1FN7A 1ORNA 4E9HA 2NOIA 2OFKA 1PU6A 4HSBA 1P7MA 1MUDA 4EA5A 1YQKA 2NOHA 2YG8A 3OH9A 4AI5A 4EJYA 3CVSA 2NOFA 3OGDA 2H56A 1MUNA 1M3HA 1N3CA 1M3QA 4OFHA 3CVTA 4UOBA 1NGNA 4DK9A 2XHIA 3FHGA 1KG5A 1PVSA 3OH6A 4AIAA 3IH7A 2JHJA 1XG7A 1P59A 5KN9A 4EVVA 1YQLA 3IHOA 1MPGA 1DIZA 4YPRA 1PU8A 4OFEA 4EW4A 1KG3A 1MUYA 3I0XA 1WEFA 4PIIA 5AN4A 4B23A 4YPHA 1RRSA 3CWUA 3G0QA 4UNFA 1XQOA 2NOLA 1KG4A 3KNTA 4EA4A 4B22A 1RRQA 1EBMA 1LMZA 1YQRA 3KTUA 4E9EA 1ORPA 1KG7A 3CWTA 3FHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWA A;  3CWS A;  5KN8 A;  2NOB A;  3N0U A;  1KEA A;  1VRL A;  2NOZ A;  1KO9 A;  4AI4 A;  1KQJ A;  3CW7 A;  2ABK A;  3D4V A;  5DPK A;  1N39 A;  4EJZ A;  3N5N X;  1WEG A;  4OFA A;  3F0Z A;  1HU0 A;  1KG6 A;  1LWV A;  4YOQ A;  4EW0 A;  1LWW A;  5CHZ A;  1KG2 A;  1YQM A;  1N3A A;  1NKU A;  4B21 A;  3FSP A;  3I0W A;  2NOE A;  3S6I A;  1WEI A;  2OFI A;  1LWY A;  2YG9 A;  1PU7 A;  2JG6 A;  3F10 A;  2I5W A;  4E9G A;  2JHN A;  1XQP A;  4E9F A;  4B24 A;  1FN7 A;  1ORN A;  4E9H A;  2NOI A;  2OFK A;  1PU6 A;  4HSB A;  1P7M A;  1MUD A;  4EA5 A;  1YQK A;  2NOH A;  2YG8 A;  3OH9 A;  4AI5 A;  4EJY A;  3CVS A;  2NOF A;  3OGD A;  2H56 A;  1MUN A;  1M3H A;  1N3C A;  1M3Q A;  4OFH A;  3CVT A;  4UOB A;  1NGN A;  4DK9 A;  2XHI A;  3FHG A;  1KG5 A;  1PVS A;  3OH6 A;  4AIA A;  3IH7 A;  2JHJ A;  1XG7 A;  1P59 A;  5KN9 A;  4EVV A;  1YQL A;  3IHO A;  1MPG A;  1DIZ A;  4YPR A;  1PU8 A;  4OFE A;  4EW4 A;  1KG3 A;  1MUY A;  3I0X A;  1WEF A;  4PII A;  5AN4 A;  4B23 A;  4YPH A;  1RRS A;  3CWU A;  3G0Q A;  4UNF A;  1XQO A;  2NOL A;  1KG4 A;  3KNT A;  4EA4 A;  4B22 A;  1RRQ A;  1EBM A;  1LMZ A;  1YQR A;  3KTU A;  4E9E A;  1ORP A;  1KG7 A;  3CWT A;  3FHF A; 
#chains in the Genus database with same CATH topology
 3CWA A;  3CWS A;  2NVM A;  1NVP A;  1QNA A;  3N0U A;  2NOZ A;  1VOK A;  3TE5 A;  2V92 A;  2FKM X;  1Q9U A;  4HJH A;  1N39 A;  4EJZ A;  1WEG A;  3ENC A;  1KG6 A;  4EW0 A;  2YH5 A;  5JMV D;  1VKL A;  2NOE A;  5F9C A;  2QRE A;  1WEI A;  1QN8 A;  3PDK A;  2VJ0 A;  2Y8Q A;  2JHN A;  1QN3 A;  3OS0 A;  4B24 A;  3OST A;  3I3W A;  1ORN A;  1TGH A;  5IYD P;  2QR1 A;  2V8Q A;  1TUO A;  1LXT A;  2V75 A;  2OOY A;  3HS9 A;  4BDY A;  4EA5 A;  3BKQ X;  2YG8 A;  3OH9 A;  4AI5 A;  2QLV A;  1C4G A;  2LAE A;  1KFQ A;  3RPJ A;  4OFH A;  3CVT A;  3SNS A;  2XHI A;  1KY6 A;  1KYF A;  4AIA A;  1XG7 A;  5KN9 A;  3OSM A;  1J3M A;  3RSM A;  1P5G X;  3S3M A;  2R5X A;  4BJU A;  1T6A A;  2NWV A;  4WXA A;  3EIK A;  4B23 A;  1RRS A;  1KYU A;  3OYE A;  3OY9 A;  3TDH A;  3OYB A;  4ZTJ A;  4EAL A;  5BMN A;  3OC3 C;  1MP9 A;  3KTU A;  3NNQ A;  4E9E A;  4C7P A;  2Z0F A;  3FHF A;  2D0A A;  1VOL B;  1QTP A;  2NOB A;  2G30 A;  3OLP A;  1M5Q 1;  1KQJ A;  2ZFD B;  2ABK A;  2JPI A;  1K2Y X;  3N5N X;  2QRD A;  5FRO A;  4OFA A;  3F0Z A;  3EAY A;  1LWV A;  2F7L A;  1KG2 A;  3I0W A;  4TPS A;  1QN4 A;  3S6I A;  1B9K A;  1K35 A;  1E42 A;  3D7Q A;  1LWY A;  2H5A X;  1PU7 A;  3ULX A;  4IKF A;  1XQP A;  3OS2 A;  4E9F A;  1P5D X;  4BE1 A;  5IYC P;  2JPS A;  2NOI A;  2OFK A;  1AIS A;  3DPU A;  3S3O A;  2IV9 A;  3OYI A;  4Q11 A;  1P7M A;  1MUD A;  2NOF A;  1CDW A;  1QNC A;  1JDY A;  1KFI A;  4ZTF A;  4DK9 A;  3FHG A;  1KG5 A;  3OH6 A;  3KRM A;  1YTB A;  3OYF A;  1YQL A;  4NZG A;  4PY5 A;  1DIZ A;  1PU8 A;  4OFE A;  4E7H A;  5KL0 A;  1KG3 A;  5BMP A;  1QN5 A;  3I0X A;  2FUV A;  4ROD B;  1XQO A;  1RM1 A;  3KNT A;  1WQA A;  1KY7 A;  3L2Q A;  4BAC A;  3T4N A;  3CWT A;  4ROE B;  2W03 A;  3OS1 A;  4D7Q A;  2MJ7 A;  2MZ8 A;  3OYL A;  1NGM A;  1KEA A;  1VRL A;  1KO9 A;  4AI4 A;  1V5S A;  2OOX A;  4EAK A;  5DPK A;  2FGT A;  4IL8 A;  2V9J A;  1HU0 A;  4YOQ A;  5FRM A;  1EUV A;  1LWW A;  5CHZ A;  3R2X C;  1YQM A;  1N3A A;  4B21 A;  1UL7 A;  4BDZ A;  2OFI A;  2YG9 A;  3F10 A;  3L2R A;  3OYH A;  3OYC A;  2Z8U A;  4EAI A;  3N89 A;  1PCZ A;  1FN7 A;  2PWW A;  4E9H A;  1PU6 A;  1PZD A;  3OYG A;  3L2W A;  4E7L A;  1YQK A;  2NOH A;  4WX8 A;  4E7J A;  2D0B A;  4EJY A;  4MRQ A;  3H1Z A;  3OGD A;  1U84 A;  1N3C A;  4WZS D;  2DKA A;  1NGN A;  2D0C A;  3OYN A;  3DPT A;  4EAG A;  1D3U A;  1PVS A;  1QN6 A;  1P59 A;  4EVV A;  1UT4 A;  4CFF A;  3C04 A;  1C47 A;  3OYD A;  4EW4 A;  2H4L X;  3OSE A;  4B0A A;  5AN4 A;  4YPH A;  1W80 A;  2HL9 A;  4UNF A;  3ASM A;  1VTO A;  1KG4 A;  3ENO C;  4B22 A;  1YQR A;  4E7I A;  2O3O A;  3OYJ A;  2HKP A;  5KN8 A;  3OYM A;  4D7R A;  1TBP A;  3OCI A;  2YA3 A;  4I8O A;  2DKD A;  3CW7 A;  3OYK A;  1QNE A;  1KYD A;  3D4V A;  1PCM X;  2FKF A;  1YTF A;  1QN9 A;  2QRC A;  3NA5 A;  3L2V A;  1NKU A;  3FSP A;  3LCN A;  4BE0 A;  2W04 A;  2DKC A;  2JG6 A;  2I5W A;  1R4X A;  4E9G A;  3VN5 A;  1NH2 A;  2NLV A;  1XSZ A;  2Y8L A;  2HZM A;  2JOI A;  1VTL E;  4ROC B;  5JN5 A;  3OYA A;  4DUL A;  4HSB A;  5FRN A;  4EAJ A;  5HSH A;  1TBA B;  5IYB P;  4E7K A;  3CVS A;  3HS8 A;  3UW2 A;  2H56 A;  2EHB D;  2HL8 A;  1MUN A;  1M3H A;  2IV8 A;  1M3Q A;  4UOB A;  1QN7 A;  1JFI C;  3VW4 A;  3IH7 A;  2JHJ A;  3L2U A;  4BE2 A;  3IHO A;  1MPG A;  2HZS A;  4YPR A;  3PMG A;  1MUY A;  1C9B B;  1WEF A;  4PII A;  1WJW A;  1UT7 A;  3CWU A;  3S3N A;  3G0Q A;  2NOL A;  1PCJ X;  1QNB A;  4EA4 A;  1RRQ A;  1EBM A;  1LMZ A;  1QTS A;  1ORP A;  1KG7 A;  5EPC A;  4QG5 A; 
#chains in the Genus database with same CATH homology
 3CWA A;  3CWS A;  5KN8 A;  2NOB A;  3N0U A;  1KEA A;  1VRL A;  2NOZ A;  1KO9 A;  4AI4 A;  1KQJ A;  3CW7 A;  2ABK A;  3D4V A;  5DPK A;  1N39 A;  4EJZ A;  3N5N X;  1WEG A;  4OFA A;  3F0Z A;  1HU0 A;  1KG6 A;  1LWV A;  4YOQ A;  4EW0 A;  1LWW A;  5CHZ A;  1KG2 A;  1YQM A;  1N3A A;  1NKU A;  4B21 A;  3FSP A;  3I0W A;  2NOE A;  3S6I A;  1WEI A;  2OFI A;  1LWY A;  2YG9 A;  1PU7 A;  2JG6 A;  3F10 A;  2I5W A;  4E9G A;  2JHN A;  1XQP A;  4E9F A;  4B24 A;  1FN7 A;  1ORN A;  4E9H A;  2NOI A;  2OFK A;  1PU6 A;  4HSB A;  1P7M A;  1MUD A;  4EA5 A;  1YQK A;  2NOH A;  2YG8 A;  3OH9 A;  4AI5 A;  4EJY A;  3CVS A;  2NOF A;  3OGD A;  2H56 A;  1MUN A;  1M3H A;  1N3C A;  1M3Q A;  4OFH A;  3CVT A;  4UOB A;  1NGN A;  4DK9 A;  2XHI A;  3FHG A;  1KG5 A;  1PVS A;  3OH6 A;  4AIA A;  3IH7 A;  2JHJ A;  1XG7 A;  1P59 A;  5KN9 A;  4EVV A;  1YQL A;  3IHO A;  1MPG A;  1DIZ A;  4YPR A;  1PU8 A;  4OFE A;  4EW4 A;  1KG3 A;  1MUY A;  3I0X A;  1WEF A;  4PII A;  5AN4 A;  4B23 A;  4YPH A;  1RRS A;  3CWU A;  3G0Q A;  4UNF A;  1XQO A;  2NOL A;  1KG4 A;  3KNT A;  4EA4 A;  4B22 A;  1RRQ A;  1EBM A;  1LMZ A;  1YQR A;  3KTU A;  4E9E A;  1ORP A;  1KG7 A;  3CWT A;  3FHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...