3CW7A

Crystal structure of an alka host/guest complex 8oxoguanine:cytosine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
molecule keywords DNA-3-methyladenine glycosylase 2
molecule tags Hydrolase/dna
source organism Escherichia coli
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cw7A02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cw7A03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cw7A01
2JG6A 4DK9A 3CWAA 2OFIA 3FHFA 4E9EA 2JHNA 5AN4A 1KG7A 1PU8A 1YQKA 1M3HA 4EA4A 3IHOA 1MUDA 4EW0A 4YPHA 1LWYA 3N5NX 1KG6A 5DPKA 1LWVA 3OH9A 1YQMA 1PU7A 2YG9A 1KQJA 3S6IA 2NOEA 1EBMA 1HU0A 4E9FA 1P59A 3CVTA 1YQRA 3F0ZA 3OGDA 4PIIA 1KEAA 4B22A 2ABKA 2JHJA 3I0XA 1LMZA 4B24A 1PU6A 3D4VA 1KG2A 1N3AA 1VRLA 3CWSA 3CWTA 4AIAA 3IH7A 4UNFA 1YQLA 2NOLA 5KN9A 1DIZA 2OFKA 3OH6A 4EJYA 1RRQA 1PVSA 3I0WA 1WEFA 3FHGA 3KTUA 2NOIA 1WEIA 1N39A 4EVVA 1P7MA 1RRSA 2H56A 1MUYA 4OFAA 1ORNA 1MUNA 4HSBA 3G0QA 4EJZA 3FSPA 3F10A 1WEGA 4EW4A 4E9HA 2I5WA 1M3QA 5KN8A 4AI4A 4UOBA 4B21A 3CVSA 4OFHA 1MPGA 4E9GA 1FN7A 4YPRA 2XHIA 2NOFA 4B23A 3KNTA 2YG8A 4AI5A 1N3CA 2NOZA 1KG4A 3CWUA 1NGNA 1KO9A 1KG5A 5CHZA 1LWWA 1XQOA 1XQPA 3N0UA 1ORPA 4YOQA 4OFEA 1XG7A 4EA5A 1NKUA 1KG3A 2NOBA 2NOHA 3CW7A
chains in the Genus database with same CATH superfamily
1QN4A 4BDZA 1P5GX 1KFQA 3EIKA 3N5NX 2DKAA 2YG9A 1JDYA 2R5XA 2NLVA 3R2XC 3OYBA 5JMVD 2NOEA 2MJ7A 1P59A 3OS0A 2IV8A 5KL0A 2LAEA 3F0ZA 5BMPA 3OYDA 3TE5A 2ABKA 2JHJA 4B24A 3BKQX 3S3MA 4AIAA 3IH7A 2HZMA 2MZ8A 3OYEA 2W03A 1TBAB 2Y8QA 3ASMA 2FUVA 1WEFA 3I0WA 2V92A 4EAKA 1N39A 2D0BA 1P7MA 1RRSA 2D0AA 4E7KA 2IV9A 4EAGA 1QN3A 1UT4A 1NVPA 4TPSA 3F10A 4EW4A 3HS8A 5KN8A 3L2QA 4B21A 1PCJX 2NWVA 1KYFA 3NNQA 1V5SA 2XHIA 2NOFA 1E42A 3L2RA 3ENOC 3KRMA 1NH2A 4B0AA 4ZTFA 1TBPA 4PY5A 3PMGA 3OY9A 3OYGA 1MP9A 2NOBA 3C04A 2NOHA 4Q11A 3OYCA 2OFIA 3OYMA 4BACA 2PWWA 4E7IA 2JHNA 2QR1A 1M3HA 3L2VA 3NA5A 3IHOA 4EW0A 1QN8A 4YPHA 1LWYA 5DPKA 1KY6A 1LWVA 2O3OA 1YQMA 3D7QA 2Y8LA 3OCIA 2QREA 1C4GA 1KQJA 1NGMA 3ENCA 4MRQA 5FROA 1YQRA 3EAYA 3OYHA 4DULA 1QNBA 3S3OA 4E7JA 3I0XA 2W04A 1QTSA 3D4VA 1WQAA 2EHBD 1B9KA 1VRLA 3OLPA 2NOLA 5KN9A 4EJYA 1RRQA 1PVSA 1PZDA 3FHGA 2F7LA 2NOIA 5HSHA 1R4XA 1MUYA 5IYBP 3H1ZA 1M5Q1 2D0CA 3OYFA 4EJZA 3FSPA 4CFFA 2OOYA 3OC3C 2HL8A 3OYLA 1WEGA 2I5WA 4E9HA 4NZGA 3VN5A 2HL9A 4ROEB 1C9BB 4OFHA 4EAIA 2VJ0A 2JPSA 2FGTA 3KNTA 4AI5A 3RSMA 2NOZA 1C47A 2G30A 1KG5A 2JPIA 2Z8UA 5CHZA 3DPTA 4QG5A 2DKCA 1XQOA 1ORPA 4YOQA 4EAJA 1NKUA 1VOKA 1RM1A 2V75A 2JG6A 3OYJA 4DK9A 3CWAA 3FHFA 3S3NA 1PCZA 1Q9UA 4E7LA 1YQKA 3PDKA 4BJUA 1KG6A 1QNAA 3N89A 3OH9A 1QTPA 5FRMA 1PU7A 3OSMA 3OSEA 5EPCA 3S6IA 1EBMA 1HU0A 1WJWA 4E9FA 3OS2A 3CVTA 2FKFA 1XSZA 3HS9A 4BE1A 5BMNA 1PU6A 2NVMA 3SNSA 3CWTA 1YQLA 3OS1A 4BE0A 1DIZA 2OFKA 5FRNA 2Z0FA 3OSTA 4ROCB 1LXTA 3KTUA 1WEIA 2ZFDB 1K35A 4EVVA 1QN5A 4OFAA 4IL8A 1KYDA 1ORNA 1MUNA 4HSBA 3OYIA 1W80A 1VTLE 1M3QA 1UT7A 1QNCA 1P5DX 2OOXA 3CVSA 4E9GA 1FN7A 4YPRA 1U84A 3RPJA 2YG8A 3UW2A 2YH5A 1NGNA 3TDHA 2H5AX 4D7RA 2QRCA 4WX8A 2V9JA 2H4LX 1T6AA 1YTBA 1K2YX 3L2WA 2DKDA 4OFEA 1XG7A 1KG3A 4WXAA 3CW7A 2JOIA 4E9EA 1EUVA 1CDWA 1TUOA 5AN4A 1KG7A 1PU8A 4E7HA 4EA4A 1MUDA 4IKFA 5JN5A 3L2UA 1QN9A 4RODB 1QN7A 4I8OA 4BDYA 1KY7A 4BE2A 3OGDA 5IYDP 4PIIA 1YTFA 1KEAA 4B22A 1PCMX 1LMZA 1KG2A 1N3AA 4WZSD 3OYKA 3CWSA 1QN6A 2HZSA 4D7QA 1JFIC 5IYCP 4UNFA 4ZTJA 3DPUA 1KYUA 3OH6A 2YA3A 4C7PA 3LCNA 1TGHA 1VKLA 4EALA 1VTOA 2H56A 2HKPA 1AISA 5F9CA 3G0QA 2FKMX 3T4NA 4HJHA 1QNEA 4AI4A 4UOBA 1MPGA 1UL7A 3OYNA 4B23A 1KFIA 1N3CA 3OYAA 1KG4A 3CWUA 1KO9A 3ULXA 2QLVA 1LWWA 1J3MA 1XQPA 3N0UA 2V8QA 3VW4A 1D3UA 4EA5A 1VOLB 3I3WA 2QRDA
chains in the Genus database with same CATH topology
2JG6A 4DK9A 3CWAA 2OFIA 3FHFA 4E9EA 2JHNA 5AN4A 1KG7A 1PU8A 1YQKA 1M3HA 4EA4A 3IHOA 1MUDA 4EW0A 4YPHA 1LWYA 3N5NX 1KG6A 5DPKA 1LWVA 3OH9A 1YQMA 1PU7A 2YG9A 1KQJA 3S6IA 2NOEA 1EBMA 1HU0A 4E9FA 1P59A 3CVTA 1YQRA 3F0ZA 3OGDA 4PIIA 1KEAA 4B22A 2ABKA 2JHJA 3I0XA 1LMZA 4B24A 1PU6A 3D4VA 1KG2A 1N3AA 1VRLA 3CWSA 3CWTA 4AIAA 3IH7A 4UNFA 1YQLA 2NOLA 5KN9A 1DIZA 2OFKA 3OH6A 4EJYA 1RRQA 1PVSA 3I0WA 1WEFA 3FHGA 3KTUA 2NOIA 1WEIA 1N39A 4EVVA 1P7MA 1RRSA 2H56A 1MUYA 4OFAA 1ORNA 1MUNA 4HSBA 3G0QA 4EJZA 3FSPA 3F10A 1WEGA 4EW4A 4E9HA 2I5WA 1M3QA 5KN8A 4AI4A 4UOBA 4B21A 3CVSA 4OFHA 1MPGA 4E9GA 1FN7A 4YPRA 2XHIA 2NOFA 4B23A 3KNTA 2YG8A 4AI5A 1N3CA 2NOZA 1KG4A 3CWUA 1NGNA 1KO9A 1KG5A 5CHZA 1LWWA 1XQOA 1XQPA 3N0UA 1ORPA 4YOQA 4OFEA 1XG7A 4EA5A 1NKUA 1KG3A 2NOBA 2NOHA 3CW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JG6 A;  4DK9 A;  3CWA A;  2OFI A;  3FHF A;  4E9E A;  2JHN A;  5AN4 A;  1KG7 A;  1PU8 A;  1YQK A;  1M3H A;  4EA4 A;  3IHO A;  1MUD A;  4EW0 A;  4YPH A;  1LWY A;  3N5N X;  1KG6 A;  5DPK A;  1LWV A;  3OH9 A;  1YQM A;  1PU7 A;  2YG9 A;  1KQJ A;  3S6I A;  2NOE A;  1EBM A;  1HU0 A;  4E9F A;  1P59 A;  3CVT A;  1YQR A;  3F0Z A;  3OGD A;  4PII A;  1KEA A;  4B22 A;  2ABK A;  2JHJ A;  3I0X A;  1LMZ A;  4B24 A;  1PU6 A;  3D4V A;  1KG2 A;  1N3A A;  1VRL A;  3CWS A;  3CWT A;  4AIA A;  3IH7 A;  4UNF A;  1YQL A;  2NOL A;  5KN9 A;  1DIZ A;  2OFK A;  3OH6 A;  4EJY A;  1RRQ A;  1PVS A;  3I0W A;  1WEF A;  3FHG A;  3KTU A;  2NOI A;  1WEI A;  1N39 A;  4EVV A;  1P7M A;  1RRS A;  2H56 A;  1MUY A;  4OFA A;  1ORN A;  1MUN A;  4HSB A;  3G0Q A;  4EJZ A;  3FSP A;  3F10 A;  1WEG A;  4EW4 A;  4E9H A;  2I5W A;  1M3Q A;  5KN8 A;  4AI4 A;  4UOB A;  4B21 A;  3CVS A;  4OFH A;  1MPG A;  4E9G A;  1FN7 A;  4YPR A;  2XHI A;  2NOF A;  4B23 A;  3KNT A;  2YG8 A;  4AI5 A;  1N3C A;  2NOZ A;  1KG4 A;  3CWU A;  1NGN A;  1KO9 A;  1KG5 A;  5CHZ A;  1LWW A;  1XQO A;  1XQP A;  3N0U A;  1ORP A;  4YOQ A;  4OFE A;  1XG7 A;  4EA5 A;  1NKU A;  1KG3 A;  2NOB A;  2NOH A;  3CW7 A; 
#chains in the Genus database with same CATH topology
 1QN4 A;  4BDZ A;  1P5G X;  1KFQ A;  3EIK A;  3N5N X;  2DKA A;  2YG9 A;  1JDY A;  2R5X A;  2NLV A;  3R2X C;  3OYB A;  5JMV D;  2NOE A;  2MJ7 A;  1P59 A;  3OS0 A;  2IV8 A;  5KL0 A;  2LAE A;  3F0Z A;  5BMP A;  3OYD A;  3TE5 A;  2ABK A;  2JHJ A;  4B24 A;  3BKQ X;  3S3M A;  4AIA A;  3IH7 A;  2HZM A;  2MZ8 A;  3OYE A;  2W03 A;  1TBA B;  2Y8Q A;  3ASM A;  2FUV A;  1WEF A;  3I0W A;  2V92 A;  4EAK A;  1N39 A;  2D0B A;  1P7M A;  1RRS A;  2D0A A;  4E7K A;  2IV9 A;  4EAG A;  1QN3 A;  1UT4 A;  1NVP A;  4TPS A;  3F10 A;  4EW4 A;  3HS8 A;  5KN8 A;  3L2Q A;  4B21 A;  1PCJ X;  2NWV A;  1KYF A;  3NNQ A;  1V5S A;  2XHI A;  2NOF A;  1E42 A;  3L2R A;  3ENO C;  3KRM A;  1NH2 A;  4B0A A;  4ZTF A;  1TBP A;  4PY5 A;  3PMG A;  3OY9 A;  3OYG A;  1MP9 A;  2NOB A;  3C04 A;  2NOH A;  4Q11 A;  3OYC A;  2OFI A;  3OYM A;  4BAC A;  2PWW A;  4E7I A;  2JHN A;  2QR1 A;  1M3H A;  3L2V A;  3NA5 A;  3IHO A;  4EW0 A;  1QN8 A;  4YPH A;  1LWY A;  5DPK A;  1KY6 A;  1LWV A;  2O3O A;  1YQM A;  3D7Q A;  2Y8L A;  3OCI A;  2QRE A;  1C4G A;  1KQJ A;  1NGM A;  3ENC A;  4MRQ A;  5FRO A;  1YQR A;  3EAY A;  3OYH A;  4DUL A;  1QNB A;  3S3O A;  4E7J A;  3I0X A;  2W04 A;  1QTS A;  3D4V A;  1WQA A;  2EHB D;  1B9K A;  1VRL A;  3OLP A;  2NOL A;  5KN9 A;  4EJY A;  1RRQ A;  1PVS A;  1PZD A;  3FHG A;  2F7L A;  2NOI A;  5HSH A;  1R4X A;  1MUY A;  5IYB P;  3H1Z A;  1M5Q 1;  2D0C A;  3OYF A;  4EJZ A;  3FSP A;  4CFF A;  2OOY A;  3OC3 C;  2HL8 A;  3OYL A;  1WEG A;  2I5W A;  4E9H A;  4NZG A;  3VN5 A;  2HL9 A;  4ROE B;  1C9B B;  4OFH A;  4EAI A;  2VJ0 A;  2JPS A;  2FGT A;  3KNT A;  4AI5 A;  3RSM A;  2NOZ A;  1C47 A;  2G30 A;  1KG5 A;  2JPI A;  2Z8U A;  5CHZ A;  3DPT A;  4QG5 A;  2DKC A;  1XQO A;  1ORP A;  4YOQ A;  4EAJ A;  1NKU A;  1VOK A;  1RM1 A;  2V75 A;  2JG6 A;  3OYJ A;  4DK9 A;  3CWA A;  3FHF A;  3S3N A;  1PCZ A;  1Q9U A;  4E7L A;  1YQK A;  3PDK A;  4BJU A;  1KG6 A;  1QNA A;  3N89 A;  3OH9 A;  1QTP A;  5FRM A;  1PU7 A;  3OSM A;  3OSE A;  5EPC A;  3S6I A;  1EBM A;  1HU0 A;  1WJW A;  4E9F A;  3OS2 A;  3CVT A;  2FKF A;  1XSZ A;  3HS9 A;  4BE1 A;  5BMN A;  1PU6 A;  2NVM A;  3SNS A;  3CWT A;  1YQL A;  3OS1 A;  4BE0 A;  1DIZ A;  2OFK A;  5FRN A;  2Z0F A;  3OST A;  4ROC B;  1LXT A;  3KTU A;  1WEI A;  2ZFD B;  1K35 A;  4EVV A;  1QN5 A;  4OFA A;  4IL8 A;  1KYD A;  1ORN A;  1MUN A;  4HSB A;  3OYI A;  1W80 A;  1VTL E;  1M3Q A;  1UT7 A;  1QNC A;  1P5D X;  2OOX A;  3CVS A;  4E9G A;  1FN7 A;  4YPR A;  1U84 A;  3RPJ A;  2YG8 A;  3UW2 A;  2YH5 A;  1NGN A;  3TDH A;  2H5A X;  4D7R A;  2QRC A;  4WX8 A;  2V9J A;  2H4L X;  1T6A A;  1YTB A;  1K2Y X;  3L2W A;  2DKD A;  4OFE A;  1XG7 A;  1KG3 A;  4WXA A;  3CW7 A;  2JOI A;  4E9E A;  1EUV A;  1CDW A;  1TUO A;  5AN4 A;  1KG7 A;  1PU8 A;  4E7H A;  4EA4 A;  1MUD A;  4IKF A;  5JN5 A;  3L2U A;  1QN9 A;  4ROD B;  1QN7 A;  4I8O A;  4BDY A;  1KY7 A;  4BE2 A;  3OGD A;  5IYD P;  4PII A;  1YTF A;  1KEA A;  4B22 A;  1PCM X;  1LMZ A;  1KG2 A;  1N3A A;  4WZS D;  3OYK A;  3CWS A;  1QN6 A;  2HZS A;  4D7Q A;  1JFI C;  5IYC P;  4UNF A;  4ZTJ A;  3DPU A;  1KYU A;  3OH6 A;  2YA3 A;  4C7P A;  3LCN A;  1TGH A;  1VKL A;  4EAL A;  1VTO A;  2H56 A;  2HKP A;  1AIS A;  5F9C A;  3G0Q A;  2FKM X;  3T4N A;  4HJH A;  1QNE A;  4AI4 A;  4UOB A;  1MPG A;  1UL7 A;  3OYN A;  4B23 A;  1KFI A;  1N3C A;  3OYA A;  1KG4 A;  3CWU A;  1KO9 A;  3ULX A;  2QLV A;  1LWW A;  1J3M A;  1XQP A;  3N0U A;  2V8Q A;  3VW4 A;  1D3U A;  4EA5 A;  1VOL B;  3I3W A;  2QRD A; 
#chains in the Genus database with same CATH homology
 2JG6 A;  4DK9 A;  3CWA A;  2OFI A;  3FHF A;  4E9E A;  2JHN A;  5AN4 A;  1KG7 A;  1PU8 A;  1YQK A;  1M3H A;  4EA4 A;  3IHO A;  1MUD A;  4EW0 A;  4YPH A;  1LWY A;  3N5N X;  1KG6 A;  5DPK A;  1LWV A;  3OH9 A;  1YQM A;  1PU7 A;  2YG9 A;  1KQJ A;  3S6I A;  2NOE A;  1EBM A;  1HU0 A;  4E9F A;  1P59 A;  3CVT A;  1YQR A;  3F0Z A;  3OGD A;  4PII A;  1KEA A;  4B22 A;  2ABK A;  2JHJ A;  3I0X A;  1LMZ A;  4B24 A;  1PU6 A;  3D4V A;  1KG2 A;  1N3A A;  1VRL A;  3CWS A;  3CWT A;  4AIA A;  3IH7 A;  4UNF A;  1YQL A;  2NOL A;  5KN9 A;  1DIZ A;  2OFK A;  3OH6 A;  4EJY A;  1RRQ A;  1PVS A;  3I0W A;  1WEF A;  3FHG A;  3KTU A;  2NOI A;  1WEI A;  1N39 A;  4EVV A;  1P7M A;  1RRS A;  2H56 A;  1MUY A;  4OFA A;  1ORN A;  1MUN A;  4HSB A;  3G0Q A;  4EJZ A;  3FSP A;  3F10 A;  1WEG A;  4EW4 A;  4E9H A;  2I5W A;  1M3Q A;  5KN8 A;  4AI4 A;  4UOB A;  4B21 A;  3CVS A;  4OFH A;  1MPG A;  4E9G A;  1FN7 A;  4YPR A;  2XHI A;  2NOF A;  4B23 A;  3KNT A;  2YG8 A;  4AI5 A;  1N3C A;  2NOZ A;  1KG4 A;  3CWU A;  1NGN A;  1KO9 A;  1KG5 A;  5CHZ A;  1LWW A;  1XQO A;  1XQP A;  3N0U A;  1ORP A;  4YOQ A;  4OFE A;  1XG7 A;  4EA5 A;  1NKU A;  1KG3 A;  2NOB A;  2NOH A;  3CW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...