2WDTA

Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
Knots found
sequence length
222
structure length
204
Chain Sequence
DIWTPLESNPDSLYLYSCKLGQSKLKFVDIYGFNNDLLDMIPQPVQAVIFLYPVNFDNVWFIKQYIPNSCGTIALLHLYGNLRNKFELDKDSVLDDFFNKVNEMSAEKRGQELKNNKSIENLHHEFCGQVENRDDILDVDTHFIVFVQIEGKIIELDGRKDHPTVHCFTNGDNFLYDTGKIIQDKFIEKCKDDLRFSALAVIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE L3
publication title Characterization and Structural Studies of the Plasmodium Falciparum Ubiquitin and Nedd8 Hydrolase Uchl3.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 58
structure length 204
sequence length 222
chains with identical sequence C
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.418.80 Mainly Alpha Orthogonal Bundle Actin-binding Protein, T-fimbrin; domain 1 Actin-binding Protein, T-fimbrin; domain 1 2wdtA01
3.30.1490.420 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2wdtA02
2WDTA 2WE6A
chains in the Genus database with same CATH superfamily
5IYZF 2JEGA 5I47A 4HNVA 5FD6A 3RGXA 4ED1A 2KSWA 2WA7A 1Y1VG 2CQYA 5KT4A 2GPSA 4HQ6A 4JV0A 4RU9A 2R8IA 4EEYA 1I7LA 2YCHA 1JIHA 4GC7A 3BQ0A 5D1OA 2FPGB 4A3IG 2X0SA 2XGPA 4F4YA 4JI4H 3M9NB 1R9TA 1V5KA 1MZBA 4RZQA 3FMAA 5KG6A 2K2RA 5EZYF 3MR2A 5KFQA 4Q8FA 3VP7A 2OH2A 3KXYT 5KFPA 3RUPA 4ED0A 2FLPA 2IP4A 1TA8A 5EDWA 2J6UA 4A3LG 2VQDA 5KT5A 2VZDA 1J5EH 4ED2A 4IRKA 2JA6A 4LFCH 2D89A 1M0TA 1WYOA 2V4QA 2W8KA 3V6JA 4JI1H 5D8DA 2DIKA 4J9PA 1GYFA 1UC8A 3PW2A 3MWMA 4PWQA 2YZMA 4ED6A 3T1HH 4UCVA 2SCUB 2QK4A 2W57A 1BGWA 4BXXG 4LMYA 3H4BA 5HBRB 4J9MA 2R85A 4YHHH 4QW8A 1TAEA 1DGSA 4DR6H 1SH6A 5A37A 2W6QA 3J81W 3BQ2A 2WDTA 1UC9A 3BAAA 2DPJA 4IWYA 4A3KG 5CAEB 5D1PA 4ECTA 3QFFA 2FLLA 3GTKA 2CW8A 5C44G 4YQWA 3K3VA 3KHRA 3WO1A 4HNTA 2P0AA 5C8YF 4B3RH 4NXMH 1GO3E 2VOBA 2V59A 3K3PA 4FU0A 2B63G 2W9CB 3Q1KA 4B7LA 5IYCG 2Y0SE 2XD4A 4K0KH 3BG5A 1N34H 3TINA 3GIMA 4M7EA 4C5CA 3RIZA 2NU9B 4TV9F 3GV8B 3GTQA 5T14A 1S97A 4MA5A 3HOPA 2EE7A 5KFGA 5IWAH 1KJJA 1WYQA 5J2UF 2UVWA 4LVRA 5FMTA 5DQHA 3HOZG 2XCPA 3LWBA 2DWCA 4ECWA 4ECVA 2RGRA 2UXBH 1WCMA 2R8HA 2WFNA 4DLKA 5IP7G 5L0OA 1ULZA 4KHPH 2V58A 4R8UA 5LMNH 1KC7A 1JDBB 2IA6A 5A4BA 3BA9A 4ME6A 5KFBA 2UVUA 1RJQA 1IBMH 4O3RA 5LA6F 1GGOA 5LXTF 1VBGA 3MR3A 3HB9A 4Q43A 3J80W 4LF9H 4B3MH 2FK2A 1BJTA 1EYZA 2FB9A 2NU6B 1I3QA 2VZIB 4XYMB 3ORQA 3UFXB 2R8JA 1WYNA 3KAJA 3EAYA 5KT2A 1WH2A 3I4NG 3Q2OA 5DG8A 4AYBA 4YP3A 4WBNF 4X66H 2R7LA 2WYOA 4A3JG 1ZHQA 1KJQA 1WYLA 4FBTA 1CE8A 1N33H 1ZETA 1XNRH 3T5HA 3NGDA 2Q2UA 3Q8QB 1JDEA 5LYJF 5DGAA 5L9XA 3F7PA 4IR9A 1P8LA 3MR6A 1Y14B 5KFNA 2JA6G 3FKIA 4UCSA 2V5AA 4O3PA 1IOVA 2VUGA 3SE7A 1RJPA 5KFWA 3RB4A 5L1KA 3N40P 1S0OA 3KAKA 1E4FT 3MJFA 5KG2A 4DL2A 1E4EB 4QWAA 2JV9A 2W70A 5KFZA 3L4KA 3HKZE 5DLGA 2JEIA 2J9GA 1VAJA 4DR2H 2ATLA 1KBLA 2W8LA 4DV3H 2JEJA 4XX0B 4AQYH 3ETHA 4JI7H 2WAQA 2YS7A 3L2PA 4FS2A 2VUMA 2WB1A 3FERA 1PX2A 5DQIA 4MV9A 2R7KA 2Q2TA 2UXDH 2ASLA 4LF6H 3EYYA 4RNNA 2R87A 2W9BB 3KHHA 2UVRA 2FE3A 2E2HA 4J9KA 3RFCA 4HYKA 4FBUA 3FDSA 1GSAA 2IBKA 2FJZA 4Q57B 2NUAB 4MTEA 1EUDB 1BXRA 5KG3A 1S9FA 2E9KA 3CVZA 5EOYA 4ED3A 4A3BG 1BNCA 5KFRA 3OSPA 2JA5A 1BKRA 3LP8A 3OHAA 4YBZB 3AYHB 5KFHA 3OHBA 3GTLA 1BHDA 4LH6A 3H40A 2R84A 3TQTA 3PW4A 1N48A 4JV1A 1WCMG 3MFHA 1N32H 3VMMA 2XGQA 4MV7A 5L1JA 5A36A 4G3IA 2UXCH 5EWFA 3DF7A 2RDIA 3PO2G 4EG0A 2UVVA 2AQ4A 1RK6A 2R82A 2IGPA 3KHGA 4UCRA 4LSAA 1GSOA 5KT3A 5L1LA 3PW7A 2JA7A 2R7NA 4IRDA 2XCAA 4J0MA 4BBSG 5FPOA 2BQUA 1N36H 3OSNA 4RZRA 4UCOA 2FPIB 5LP6F 5LOVF 3KMWB 2DK9A 1KEEA 4DR4H 4BY1G 3TIGA 3E5NA 5KT7A 4GKJH 1W93A 1Z2OX 1I6UA 2I80A 1JLLB 5F9NA 2BR0A 1EHIA 4HR7A 3GILA 4WD3A 3GIPA 4J9QA 3H0GA 4PDBA 1JKJB 3R23A 5H80A 1ZHSA 1A9XA 4EYHB 4QIWE 3RBEA 1XMQH 1I94H 1RK5A 2C22A 3G6XA 3OTOH 1WR2A 4ED8A 5HV6A 3RV4A 3PN1A 1VS0A 3FKIG 3I4MG 4ZQIA 2R93A 5D1OB 1S68A 2Y0SA 4IHJF 5FJ8G 3TIIA 1N56A 2FPPB 4MV4A 3GTJA 1S0MA 1RT8A 4ECZA 1M6VA 5KFXA 3ETJA 1Y1WA 3RGZA 2E5LH 1M0WA 4TUYF 1ZQ7A 3G6VA 2PBZA 4O2AF 2NU8B 2VQFH 5KFOA 5C1OA 3PR5B 2VE7A 2FK1A 1KJ8A 4L1KA 2R7ZA 1I50A 4EBCA 2HJWA 4YJ3F 4RAYA 2VUMG 2QJXA 1IOWA 1GSHA 3BA8A 1GLVA 4C2MA 4QWEA 2GLTA 1B6SA 1H67A 1V51A 4JUZA 2V9WA 3GIIA 2QYZA 2XCLA 3SI8A 3GTPA 2IMWP 4ZI7F 1KJ9A 3REPB 3RAXA 1RYSA 4O2BF 3JRWA 4O4HF 3HOCA 1AN7A 1B04A 4DDPA 1T94A 4IZOA 3M9OB 5KT6A 1X9NA 2JA5G 4JI6H 4QJFA 2EQOA 5FLMG 2AGPA 3JZIA 3R5HA 2BQ3A 2W6OA 2R92A 1JX4A 3V6KA 4JI5H 1B6RA 3V6HA 2CKZB 4JI3H 2OWOA 3RJ0A 2ZDQA 4MV6A 5KFYA 3GV7B 3RBDA 2HVRA 1PXYA 2R7MA 3IN5A 3PW0A 5IT9W 1FJGH 2I8CA 3T5JA 2AGQA 2JA7G 2ZJTA 2MCTA 3N43B 3I12A 3HOVG 3LMLA 4MV8A 4ETSA 5LL6b 4GKKH 5FMUA 5BPHA 4EFEA 3RB3A 1Z2PX 2J6TA 2JA8G 5DG9A 5KFVA 5K2MA 3GIJA 4A3MG 3U9TA 4DR5H 4DV0H 4RNMA 5KFUA 4DL6A 1CQIB 4R8UB 3HKZA 3GLKA 2V4RA 2YYAA 4JYAH 5KFTA 5DGBA 1HR0H 4TV8F 1MB8A 2ZDGA 3OUUA 4XYLB 3I6XA 2PN1A 3H0GG 4ZOLF 1T3NA 4APMA 4EGQA 2VA2A 4A3GG 2W6MA 3MWDA 2VQEH 4DV2H 2RDJA 4UCUA 4F4ZA 3N8DA 2F4VH 4DL4A 4Q58A 2VE7C 1PK8A 2HL9A 4DUZH 1P2XA 3HOWG 2EYIA 3JARM 4YAJB 2RR8A 2GPWA 3Q8SB 2YU9A 4NXNH 2R93G 4YR3A 3IG0A 1UJOA 5GONF 2D87A 1SEIA 4O3NA 5KG4A 4EDMA 4LSXA 2W7PA 4ECRA 4Q59A 1QAGA 3R5FA 1EUVA 2R8GA 3JAMW 4GC6A 4EBDA 4C5BA 1CS0A 3K5IA 4MA0A 2VPQA 1WYPA 3F8NA 3BJYA 4MV3A 4DUYH 4ECYA 1Y1WG 4JI0H 3M9MB 4O3QA 5KFIA 4QW9A 5C3EG 1WJOA 4LFAH 4C5AA 3RAQA 1RYRA 2PVPA 2HVSA 2UU9H 4F50A 3CO1A 3Q8PB 3GTGA 3JALM 1TWCA 1XDNA 4YY3H 3KHLA 4JI8H 3T5KA 1B33N 1S0NA 2R7ZG 2D85A 3Q8RB 1W96A 1VKZA 5BPFA 4A93G 2HGSA 3RB6A 3JRXA 1O75A 1XMOH 4LFBH 4A3EG 5KFAA 2AU0A 4J9OA 2PMZE 4O3SA 4YR2A 5JUMA 2VA3A 2FKLA 2XIGA 5C1PA 5KG0A 4F4WA 2DZDA 3PW5A 2UUAH 2J6SA 1HNXH 1Z2NX 1SH5A 2FP4B 5CA1F 3GIKA 3GTOA 4EEQA 3N6XA 3HOXG 2NVYA 2K3SA 5KFEA 5KG5A 1C3OA 2WB1E 4B3TH 1CQJB 2I87A 4U7CA 4Q44A 3JAKM 2R92G 4JI2H 3WNZA 2JEFA 3KY9A 3JSLA 4O4IF 3TQ1A 3J7AK 1K83A 3U9SA 4QIWA 4J9SA 1WSCA 2BQRA 1WKUA 4XZ3B 4I7HA 5L1IA 5LMUH 5JQWA 4YJ2F 4E4TA 3H4DA 5JVDF 1EUCB 4U6PA 4IR1A 4BY7G 1V4YA 2XC9A 4TXKA 2C2RA 4BBRG 4TQSA 1S10A 4UFZA 5KG7A 2R8KA 2WA5A 2DLNA 1XNQH 3ORRA 2WTFA 4GLXA 2W9CA 3G6YA 3MFIA 5EWGA 2E2IA 1KJIA 1K1QA 4LH7A 4OX9H 2ALZA 3GTMA 3V4ZA 4EYIB 4IAJA 2M05A 1TWHA 2DPIA 5IYBG 5FPRA 5DLFA 2QJZA 2ZM6H 1TJTA 4ED7A 1VKAA 2RF4A 5KG1A 4B3SH 5KFFA 4JV2A 4EFBA 3MWEA 1FVIA 5JVLA 1AUVA 1JXLA 4IRCA 4TQRA 4NLGA 2WE6A 5IP9G 2NU7B 3QZ8A 5KFKA 4RB2C 4ECSA 5KFLA 2C2EA 1VBHA 4A3DG 4J9NA 4A3CG 4CC5A 3UQ8A 3V4SA 2FMAA 2D88A 4EGJA 1K1SA 5KX5F 5CA0F 5C5JA 4R7RA 4ECUA 2HKPA 3GIDA 2UUCH 4DV7H 4DR1H 2FK3A 3GIQA 1UNNC 1L2ZA 2W6PA 4QWBA 2ASJA 3M4IA 4RB0A 5KFMA 4JV5H 5BVRA 2OLSA 1V9PA 5KFJA 1M7JA 2C35B 2W6NA 4EDLA 3N41B 4IWXA 4O3OA 3N44B 3R5XA 3QZ7A 4J9LA 3RB0A 1DV2A 1OWTA 4YB8B 3RTXA 3RV3A 4RNOA 1IBLH 2UUBH 1HNZH 3HOYG 4LF5H 2YL2A 3RF2A 1TWFA 3WO0A 2YRWA 2YZGA 5C4XG 1E4GT 4DV4H 2W71A 2CW7A 1Y1VA 5JH7F 4X65H 4DL5A 5J8EA 2R6FA 4HNUA 5EWEA 3G8CA 1I7NA 4UCTA 2HHHH 4A2BA 3T5LA 1WYRA 2EYNA 2ZDHA 4QWDA 3PVXA 4LF8H 1P5SA 4Q0YA 3BQ1A 1WYMA 1E4EA 4X64H 1WIXA 4Y8VB 3HOUG 4YR0A 1TWGA 4EBEA 4Q8EA 4RUCA 1HNWH 4Q45A 3VPDA 1PA7A 4I55F 2YRNA 2D86A 3KALA 4RB1A 2O03A 5A38A 1UEGA 4YAKB 1C30A 4LF7H 4ECQA 4DV1H 1EZ1A 1TWAA 1DIKA 1A0IA 2C00A 2W6ZA 2YS6A 4LF4H 2NVXA 4A3FG 4EDNA 1DV1A 1AOAA 5CB4F 1T36A 1IBKH 2W9BA 5IYDG 4TXIA 2YW2A 3CQZA 2W9AA 2FLNA 4MTDA 4FS1A 4I50F 3HBLA 2ASDA 5BR8H 5FLXW 3KMUB 2HL8A 3H20A 4AYBE 2VR1A 2HVQA 4DL7A 5DG7A 3T1YH 3GQCA 3PR4A 3KTMA 2WA6A 2VPSA 3VPBA 3PO3G 3HORA 4RB3C 4DV6H 3C0FB 2CZGA 5KFCA 4DV5H 3K5HA 3MR5A 3EPIA 3L4JA 2R0OA 2B63A 4MV1A 1DXXA 4X62H 2R86A 2PMZA 4QWCA 4FM9A 3N42B 2R8UA 1FKAH 1AUXA 2YRXA 4A2AA 4RUAA 4F4XA 3OUZA 3HXLA 2C2DA 5A2QW 1AA2A 4BWSC 4CC6A 4MAMA 1SCUB 5J2TF 4DR3H 3H3VH 4LVPA 5BMVF 3JSNA 1SYXB 5KFDA 1SFOA 3VPCA 1S03G 3BABA 4J9RA 2YZNA 5FD5A 5DQGA 2VZCA 2RGVA 3GV5B 2C28A 5KKNB 4M9UA 2L3GA 1RJRA 4ECXA 4DL3A 4RAZA 3PZPA 2AGOA 2WAQE 4I4TF 4DR7H 4O4LF 4ZHQF 5F9LA 5KFSA 3EPGA 2VZGB 2W7OA
chains in the Genus database with same CATH topology
1FVIA 3N40P 3KAKA 1E4FT 2WE6A 5FD6A 3RGXA 4JI5H 2KSWA 4RB2C 3L4KA 4JI3H 4CC5A 2OWOA 3RJ0A 3UQ8A 4DR2H 2YCHA 2HVRA 5D1OA 5IT9W 4DV3H 1FJGH 4R7RA 2HKPA 4JI4H 2UUCH 4AQYH 2ZJTA 2MCTA 4DV7H 3N43B 4JI7H 1MZBA 3LMLA 5LL6b 4RZQA 4ETSA 3L2PA 4DR1H 5FMUA 3FMAA 4GKKH 1L2ZA 4MV9A 4EFEA 2Q2TA 2UXDH 4LF6H 1Z2PX 3M4IA 3EYYA 4RB0A 4JV5H 3VP7A 3KXYT 1V9PA 4DR5H 4DV0H 2FE3A 1TA8A 3N41B 1N32H 3N44B 1J5EH 3RTXA 4LFCH 4JYAH 1M0TA 4MTEA 1IBLH 3CVZA 5EOYA 1HNZH 1HR0H 2UUBH 4LF5H 4JI1H 3RF2A 1GYFA 3MWMA 4APMA 1E4GT 4DV4H 3T1HH 4LH6A 4UCVA 2CW7A 2W57A 2VQEH 4DV2H 1BGWA 4UCUA 4X65H 4LMYA 4MV7A 2F4VH 2UXCH 2VE7C 4YHHH 3DF7A 2HL9A 1TAEA 4DUZH 1DGSA 4DR6H 4NXNH 4UCTA 3J81W 2IGPA 2WDTA 3BAAA 3IG0A 4UCRA 4A2BA 1SEIA 4LSXA 4LSAA 2HHHH 5D1PA 4J0MA 1EUVA 2CW8A 4B3SH 4LF8H 3JAMW 4Q0YA 3K3VA 5FPOA 1N36H 4B3RH 4X64H 3F8NA 2VOBA 4UCOA 4DUYH 4JI0H 4NXMH 4LFAH 4DR4H 1HNWH 2UU9H 2HVSA 4K0KH 3KALA 4GKJH 4RB1A 1Z2OX 1I6UA 2O03A 1N34H 4M7EA 1XDNA 4YY3H 3RIZA 4JI8H 4LF7H 4DV1H 1A0IA 4LF4H 5IWAH 2HGSA 4PDBA 4LVRA 5FMTA 1XMOH 1O75A 4LFBH 1ZHSA 1XMQH 1IBKH 2RGRA 1I94H 2UXBH 2XIGA 2UUAH 4KHPH 4MTDA 3OTOH 1Z2NX 5BR8H 5FLXW 1HNXH 5LMNH 4EEQA 2HL8A 1VS0A 3H20A 3BA9A 2HVQA 3N6XA 3PN1A 3T1YH 5D1OB 1S68A 2VPSA 1IBMH 4RB3C 4B3TH 4DV6H 3C0FB 4JI2H 4DV5H 3J80W 4LF9H 3RGZA 2E5LH 3JSLA 4B3MH 1BJTA 1M0WA 3L4JA 3J7AK 4X62H 4FM9A 3KAJA 2VQFH 3EAYA 3N42B 4I7HA 1FKAH 5LMUH 4A2AA 1WH2A 2VE7A 3HXLA 5A2QW 4CC6A 4BWSC 4DR3H 4RAYA 4X66H 3BA8A 4LVPA 2WYOA 1ZHQA 4UFZA 1N33H 3JSNA 1SYXB 1XNQH 1XNRH 2Q2UA 1S03G 3BABA 4GLXA 5FD5A 2RGVA 1P8LA 4LH7A 4OX9H 4RAZA 4UCSA 4IAJA 5FPRA 1B04A 1AN7A 4DR7H 4DDPA 1X9NA 2ZM6H 4JI6H 2VUGA 2EQOA 4EFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WDT A;  2WE6 A; 
#chains in the Genus database with same CATH topology
 5IYZ F;  2JEG A;  5I47 A;  4HNV A;  5FD6 A;  3RGX A;  4ED1 A;  2KSW A;  2WA7 A;  1Y1V G;  2CQY A;  5KT4 A;  2GPS A;  4HQ6 A;  4JV0 A;  4RU9 A;  2R8I A;  4EEY A;  1I7L A;  2YCH A;  1JIH A;  4GC7 A;  3BQ0 A;  5D1O A;  2FPG B;  4A3I G;  2X0S A;  2XGP A;  4F4Y A;  4JI4 H;  3M9N B;  1R9T A;  1V5K A;  1MZB A;  4RZQ A;  3FMA A;  5KG6 A;  2K2R A;  5EZY F;  3MR2 A;  5KFQ A;  4Q8F A;  3VP7 A;  2OH2 A;  3KXY T;  5KFP A;  3RUP A;  4ED0 A;  2FLP A;  2IP4 A;  1TA8 A;  5EDW A;  2J6U A;  4A3L G;  2VQD A;  5KT5 A;  2VZD A;  1J5E H;  4ED2 A;  4IRK A;  2JA6 A;  4LFC H;  2D89 A;  1M0T A;  1WYO A;  2V4Q A;  2W8K A;  3V6J A;  4JI1 H;  5D8D A;  2DIK A;  4J9P A;  1GYF A;  1UC8 A;  3PW2 A;  3MWM A;  4PWQ A;  2YZM A;  4ED6 A;  3T1H H;  4UCV A;  2SCU B;  2QK4 A;  2W57 A;  1BGW A;  4BXX G;  4LMY A;  3H4B A;  5HBR B;  4J9M A;  2R85 A;  4YHH H;  4QW8 A;  1TAE A;  1DGS A;  4DR6 H;  1SH6 A;  5A37 A;  2W6Q A;  3J81 W;  3BQ2 A;  2WDT A;  1UC9 A;  3BAA A;  2DPJ A;  4IWY A;  4A3K G;  5CAE B;  5D1P A;  4ECT A;  3QFF A;  2FLL A;  3GTK A;  2CW8 A;  5C44 G;  4YQW A;  3K3V A;  3KHR A;  3WO1 A;  4HNT A;  2P0A A;  5C8Y F;  4B3R H;  4NXM H;  1GO3 E;  2VOB A;  2V59 A;  3K3P A;  4FU0 A;  2B63 G;  2W9C B;  3Q1K A;  4B7L A;  5IYC G;  2Y0S E;  2XD4 A;  4K0K H;  3BG5 A;  1N34 H;  3TIN A;  3GIM A;  4M7E A;  4C5C A;  3RIZ A;  2NU9 B;  4TV9 F;  3GV8 B;  3GTQ A;  5T14 A;  1S97 A;  4MA5 A;  3HOP A;  2EE7 A;  5KFG A;  5IWA H;  1KJJ A;  1WYQ A;  5J2U F;  2UVW A;  4LVR A;  5FMT A;  5DQH A;  3HOZ G;  2XCP A;  3LWB A;  2DWC A;  4ECW A;  4ECV A;  2RGR A;  2UXB H;  1WCM A;  2R8H A;  2WFN A;  4DLK A;  5IP7 G;  5L0O A;  1ULZ A;  4KHP H;  2V58 A;  4R8U A;  5LMN H;  1KC7 A;  1JDB B;  2IA6 A;  5A4B A;  3BA9 A;  4ME6 A;  5KFB A;  2UVU A;  1RJQ A;  1IBM H;  4O3R A;  5LA6 F;  1GGO A;  5LXT F;  1VBG A;  3MR3 A;  3HB9 A;  4Q43 A;  3J80 W;  4LF9 H;  4B3M H;  2FK2 A;  1BJT A;  1EYZ A;  2FB9 A;  2NU6 B;  1I3Q A;  2VZI B;  4XYM B;  3ORQ A;  3UFX B;  2R8J A;  1WYN A;  3KAJ A;  3EAY A;  5KT2 A;  1WH2 A;  3I4N G;  3Q2O A;  5DG8 A;  4AYB A;  4YP3 A;  4WBN F;  4X66 H;  2R7L A;  2WYO A;  4A3J G;  1ZHQ A;  1KJQ A;  1WYL A;  4FBT A;  1CE8 A;  1N33 H;  1ZET A;  1XNR H;  3T5H A;  3NGD A;  2Q2U A;  3Q8Q B;  1JDE A;  5LYJ F;  5DGA A;  5L9X A;  3F7P A;  4IR9 A;  1P8L A;  3MR6 A;  1Y14 B;  5KFN A;  2JA6 G;  3FKI A;  4UCS A;  2V5A A;  4O3P A;  1IOV A;  2VUG A;  3SE7 A;  1RJP A;  5KFW A;  3RB4 A;  5L1K A;  3N40 P;  1S0O A;  3KAK A;  1E4F T;  3MJF A;  5KG2 A;  4DL2 A;  1E4E B;  4QWA A;  2JV9 A;  2W70 A;  5KFZ A;  3L4K A;  3HKZ E;  5DLG A;  2JEI A;  2J9G A;  1VAJ A;  4DR2 H;  2ATL A;  1KBL A;  2W8L A;  4DV3 H;  2JEJ A;  4XX0 B;  4AQY H;  3ETH A;  4JI7 H;  2WAQ A;  2YS7 A;  3L2P A;  4FS2 A;  2VUM A;  2WB1 A;  3FER A;  1PX2 A;  5DQI A;  4MV9 A;  2R7K A;  2Q2T A;  2UXD H;  2ASL A;  4LF6 H;  3EYY A;  4RNN A;  2R87 A;  2W9B B;  3KHH A;  2UVR A;  2FE3 A;  2E2H A;  4J9K A;  3RFC A;  4HYK A;  4FBU A;  3FDS A;  1GSA A;  2IBK A;  2FJZ A;  4Q57 B;  2NUA B;  4MTE A;  1EUD B;  1BXR A;  5KG3 A;  1S9F A;  2E9K A;  3CVZ A;  5EOY A;  4ED3 A;  4A3B G;  1BNC A;  5KFR A;  3OSP A;  2JA5 A;  1BKR A;  3LP8 A;  3OHA A;  4YBZ B;  3AYH B;  5KFH A;  3OHB A;  3GTL A;  1BHD A;  4LH6 A;  3H40 A;  2R84 A;  3TQT A;  3PW4 A;  1N48 A;  4JV1 A;  1WCM G;  3MFH A;  1N32 H;  3VMM A;  2XGQ A;  4MV7 A;  5L1J A;  5A36 A;  4G3I A;  2UXC H;  5EWF A;  3DF7 A;  2RDI A;  3PO2 G;  4EG0 A;  2UVV A;  2AQ4 A;  1RK6 A;  2R82 A;  2IGP A;  3KHG A;  4UCR A;  4LSA A;  1GSO A;  5KT3 A;  5L1L A;  3PW7 A;  2JA7 A;  2R7N A;  4IRD A;  2XCA A;  4J0M A;  4BBS G;  5FPO A;  2BQU A;  1N36 H;  3OSN A;  4RZR A;  4UCO A;  2FPI B;  5LP6 F;  5LOV F;  3KMW B;  2DK9 A;  1KEE A;  4DR4 H;  4BY1 G;  3TIG A;  3E5N A;  5KT7 A;  4GKJ H;  1W93 A;  1Z2O X;  1I6U A;  2I80 A;  1JLL B;  5F9N A;  2BR0 A;  1EHI A;  4HR7 A;  3GIL A;  4WD3 A;  3GIP A;  4J9Q A;  3H0G A;  4PDB A;  1JKJ B;  3R23 A;  5H80 A;  1ZHS A;  1A9X A;  4EYH B;  4QIW E;  3RBE A;  1XMQ H;  1I94 H;  1RK5 A;  2C22 A;  3G6X A;  3OTO H;  1WR2 A;  4ED8 A;  5HV6 A;  3RV4 A;  3PN1 A;  1VS0 A;  3FKI G;  3I4M G;  4ZQI A;  2R93 A;  5D1O B;  1S68 A;  2Y0S A;  4IHJ F;  5FJ8 G;  3TII A;  1N56 A;  2FPP B;  4MV4 A;  3GTJ A;  1S0M A;  1RT8 A;  4ECZ A;  1M6V A;  5KFX A;  3ETJ A;  1Y1W A;  3RGZ A;  2E5L H;  1M0W A;  4TUY F;  1ZQ7 A;  3G6V A;  2PBZ A;  4O2A F;  2NU8 B;  2VQF H;  5KFO A;  5C1O A;  3PR5 B;  2VE7 A;  2FK1 A;  1KJ8 A;  4L1K A;  2R7Z A;  1I50 A;  4EBC A;  2HJW A;  4YJ3 F;  4RAY A;  2VUM G;  2QJX A;  1IOW A;  1GSH A;  3BA8 A;  1GLV A;  4C2M A;  4QWE A;  2GLT A;  1B6S A;  1H67 A;  1V51 A;  4JUZ A;  2V9W A;  3GII A;  2QYZ A;  2XCL A;  3SI8 A;  3GTP A;  2IMW P;  4ZI7 F;  1KJ9 A;  3REP B;  3RAX A;  1RYS A;  4O2B F;  3JRW A;  4O4H F;  3HOC A;  1AN7 A;  1B04 A;  4DDP A;  1T94 A;  4IZO A;  3M9O B;  5KT6 A;  1X9N A;  2JA5 G;  4JI6 H;  4QJF A;  2EQO A;  5FLM G;  2AGP A;  3JZI A;  3R5H A;  2BQ3 A;  2W6O A;  2R92 A;  1JX4 A;  3V6K A;  4JI5 H;  1B6R A;  3V6H A;  2CKZ B;  4JI3 H;  2OWO A;  3RJ0 A;  2ZDQ A;  4MV6 A;  5KFY A;  3GV7 B;  3RBD A;  2HVR A;  1PXY A;  2R7M A;  3IN5 A;  3PW0 A;  5IT9 W;  1FJG H;  2I8C A;  3T5J A;  2AGQ A;  2JA7 G;  2ZJT A;  2MCT A;  3N43 B;  3I12 A;  3HOV G;  3LML A;  4MV8 A;  4ETS A;  5LL6 b;  4GKK H;  5FMU A;  5BPH A;  4EFE A;  3RB3 A;  1Z2P X;  2J6T A;  2JA8 G;  5DG9 A;  5KFV A;  5K2M A;  3GIJ A;  4A3M G;  3U9T A;  4DR5 H;  4DV0 H;  4RNM A;  5KFU A;  4DL6 A;  1CQI B;  4R8U B;  3HKZ A;  3GLK A;  2V4R A;  2YYA A;  4JYA H;  5KFT A;  5DGB A;  1HR0 H;  4TV8 F;  1MB8 A;  2ZDG A;  3OUU A;  4XYL B;  3I6X A;  2PN1 A;  3H0G G;  4ZOL F;  1T3N A;  4APM A;  4EGQ A;  2VA2 A;  4A3G G;  2W6M A;  3MWD A;  2VQE H;  4DV2 H;  2RDJ A;  4UCU A;  4F4Z A;  3N8D A;  2F4V H;  4DL4 A;  4Q58 A;  2VE7 C;  1PK8 A;  2HL9 A;  4DUZ H;  1P2X A;  3HOW G;  2EYI A;  3JAR M;  4YAJ B;  2RR8 A;  2GPW A;  3Q8S B;  2YU9 A;  4NXN H;  2R93 G;  4YR3 A;  3IG0 A;  1UJO A;  5GON F;  2D87 A;  1SEI A;  4O3N A;  5KG4 A;  4EDM A;  4LSX A;  2W7P A;  4ECR A;  4Q59 A;  1QAG A;  3R5F A;  1EUV A;  2R8G A;  3JAM W;  4GC6 A;  4EBD A;  4C5B A;  1CS0 A;  3K5I A;  4MA0 A;  2VPQ A;  1WYP A;  3F8N A;  3BJY A;  4MV3 A;  4DUY H;  4ECY A;  1Y1W G;  4JI0 H;  3M9M B;  4O3Q A;  5KFI A;  4QW9 A;  5C3E G;  1WJO A;  4LFA H;  4C5A A;  3RAQ A;  1RYR A;  2PVP A;  2HVS A;  2UU9 H;  4F50 A;  3CO1 A;  3Q8P B;  3GTG A;  3JAL M;  1TWC A;  1XDN A;  4YY3 H;  3KHL A;  4JI8 H;  3T5K A;  1B33 N;  1S0N A;  2R7Z G;  2D85 A;  3Q8R B;  1W96 A;  1VKZ A;  5BPF A;  4A93 G;  2HGS A;  3RB6 A;  3JRX A;  1O75 A;  1XMO H;  4LFB H;  4A3E G;  5KFA A;  2AU0 A;  4J9O A;  2PMZ E;  4O3S A;  4YR2 A;  5JUM A;  2VA3 A;  2FKL A;  2XIG A;  5C1P A;  5KG0 A;  4F4W A;  2DZD A;  3PW5 A;  2UUA H;  2J6S A;  1HNX H;  1Z2N X;  1SH5 A;  2FP4 B;  5CA1 F;  3GIK A;  3GTO A;  4EEQ A;  3N6X A;  3HOX G;  2NVY A;  2K3S A;  5KFE A;  5KG5 A;  1C3O A;  2WB1 E;  4B3T H;  1CQJ B;  2I87 A;  4U7C A;  4Q44 A;  3JAK M;  2R92 G;  4JI2 H;  3WNZ A;  2JEF A;  3KY9 A;  3JSL A;  4O4I F;  3TQ1 A;  3J7A K;  1K83 A;  3U9S A;  4QIW A;  4J9S A;  1WSC A;  2BQR A;  1WKU A;  4XZ3 B;  4I7H A;  5L1I A;  5LMU H;  5JQW A;  4YJ2 F;  4E4T A;  3H4D A;  5JVD F;  1EUC B;  4U6P A;  4IR1 A;  4BY7 G;  1V4Y A;  2XC9 A;  4TXK A;  2C2R A;  4BBR G;  4TQS A;  1S10 A;  4UFZ A;  5KG7 A;  2R8K A;  2WA5 A;  2DLN A;  1XNQ H;  3ORR A;  2WTF A;  4GLX A;  2W9C A;  3G6Y A;  3MFI A;  5EWG A;  2E2I A;  1KJI A;  1K1Q A;  4LH7 A;  4OX9 H;  2ALZ A;  3GTM A;  3V4Z A;  4EYI B;  4IAJ A;  2M05 A;  1TWH A;  2DPI A;  5IYB G;  5FPR A;  5DLF A;  2QJZ A;  2ZM6 H;  1TJT A;  4ED7 A;  1VKA A;  2RF4 A;  5KG1 A;  4B3S H;  5KFF A;  4JV2 A;  4EFB A;  3MWE A;  1FVI A;  5JVL A;  1AUV A;  1JXL A;  4IRC A;  4TQR A;  4NLG A;  2WE6 A;  5IP9 G;  2NU7 B;  3QZ8 A;  5KFK A;  4RB2 C;  4ECS A;  5KFL A;  2C2E A;  1VBH A;  4A3D G;  4J9N A;  4A3C G;  4CC5 A;  3UQ8 A;  3V4S A;  2FMA A;  2D88 A;  4EGJ A;  1K1S A;  5KX5 F;  5CA0 F;  5C5J A;  4R7R A;  4ECU A;  2HKP A;  3GID A;  2UUC H;  4DV7 H;  4DR1 H;  2FK3 A;  3GIQ A;  1UNN C;  1L2Z A;  2W6P A;  4QWB A;  2ASJ A;  3M4I A;  4RB0 A;  5KFM A;  4JV5 H;  5BVR A;  2OLS A;  1V9P A;  5KFJ A;  1M7J A;  2C35 B;  2W6N A;  4EDL A;  3N41 B;  4IWX A;  4O3O A;  3N44 B;  3R5X A;  3QZ7 A;  4J9L A;  3RB0 A;  1DV2 A;  1OWT A;  4YB8 B;  3RTX A;  3RV3 A;  4RNO A;  1IBL H;  2UUB H;  1HNZ H;  3HOY G;  4LF5 H;  2YL2 A;  3RF2 A;  1TWF A;  3WO0 A;  2YRW A;  2YZG A;  5C4X G;  1E4G T;  4DV4 H;  2W71 A;  2CW7 A;  1Y1V A;  5JH7 F;  4X65 H;  4DL5 A;  5J8E A;  2R6F A;  4HNU A;  5EWE A;  3G8C A;  1I7N A;  4UCT A;  2HHH H;  4A2B A;  3T5L A;  1WYR A;  2EYN A;  2ZDH A;  4QWD A;  3PVX A;  4LF8 H;  1P5S A;  4Q0Y A;  3BQ1 A;  1WYM A;  1E4E A;  4X64 H;  1WIX A;  4Y8V B;  3HOU G;  4YR0 A;  1TWG A;  4EBE A;  4Q8E A;  4RUC A;  1HNW H;  4Q45 A;  3VPD A;  1PA7 A;  4I55 F;  2YRN A;  2D86 A;  3KAL A;  4RB1 A;  2O03 A;  5A38 A;  1UEG A;  4YAK B;  1C30 A;  4LF7 H;  4ECQ A;  4DV1 H;  1EZ1 A;  1TWA A;  1DIK A;  1A0I A;  2C00 A;  2W6Z A;  2YS6 A;  4LF4 H;  2NVX A;  4A3F G;  4EDN A;  1DV1 A;  1AOA A;  5CB4 F;  1T36 A;  1IBK H;  2W9B A;  5IYD G;  4TXI A;  2YW2 A;  3CQZ A;  2W9A A;  2FLN A;  4MTD A;  4FS1 A;  4I50 F;  3HBL A;  2ASD A;  5BR8 H;  5FLX W;  3KMU B;  2HL8 A;  3H20 A;  4AYB E;  2VR1 A;  2HVQ A;  4DL7 A;  5DG7 A;  3T1Y H;  3GQC A;  3PR4 A;  3KTM A;  2WA6 A;  2VPS A;  3VPB A;  3PO3 G;  3HOR A;  4RB3 C;  4DV6 H;  3C0F B;  2CZG A;  5KFC A;  4DV5 H;  3K5H A;  3MR5 A;  3EPI A;  3L4J A;  2R0O A;  2B63 A;  4MV1 A;  1DXX A;  4X62 H;  2R86 A;  2PMZ A;  4QWC A;  4FM9 A;  3N42 B;  2R8U A;  1FKA H;  1AUX A;  2YRX A;  4A2A A;  4RUA A;  4F4X A;  3OUZ A;  3HXL A;  2C2D A;  5A2Q W;  1AA2 A;  4BWS C;  4CC6 A;  4MAM A;  1SCU B;  5J2T F;  4DR3 H;  3H3V H;  4LVP A;  5BMV F;  3JSN A;  1SYX B;  5KFD A;  1SFO A;  3VPC A;  1S03 G;  3BAB A;  4J9R A;  2YZN A;  5FD5 A;  5DQG A;  2VZC A;  2RGV A;  3GV5 B;  2C28 A;  5KKN B;  4M9U A;  2L3G A;  1RJR A;  4ECX A;  4DL3 A;  4RAZ A;  3PZP A;  2AGO A;  2WAQ E;  4I4T F;  4DR7 H;  4O4L F;  4ZHQ F;  5F9L A;  5KFS A;  3EPG A;  2VZG B;  2W7O A; 
#chains in the Genus database with same CATH homology
 1FVI A;  3N40 P;  3KAK A;  1E4F T;  2WE6 A;  5FD6 A;  3RGX A;  4JI5 H;  2KSW A;  4RB2 C;  3L4K A;  4JI3 H;  4CC5 A;  2OWO A;  3RJ0 A;  3UQ8 A;  4DR2 H;  2YCH A;  2HVR A;  5D1O A;  5IT9 W;  4DV3 H;  1FJG H;  4R7R A;  2HKP A;  4JI4 H;  2UUC H;  4AQY H;  2ZJT A;  2MCT A;  4DV7 H;  3N43 B;  4JI7 H;  1MZB A;  3LML A;  5LL6 b;  4RZQ A;  4ETS A;  3L2P A;  4DR1 H;  5FMU A;  3FMA A;  4GKK H;  1L2Z A;  4MV9 A;  4EFE A;  2Q2T A;  2UXD H;  4LF6 H;  1Z2P X;  3M4I A;  3EYY A;  4RB0 A;  4JV5 H;  3VP7 A;  3KXY T;  1V9P A;  4DR5 H;  4DV0 H;  2FE3 A;  1TA8 A;  3N41 B;  1N32 H;  3N44 B;  1J5E H;  3RTX A;  4LFC H;  4JYA H;  1M0T A;  4MTE A;  1IBL H;  3CVZ A;  5EOY A;  1HNZ H;  1HR0 H;  2UUB H;  4LF5 H;  4JI1 H;  3RF2 A;  1GYF A;  3MWM A;  4APM A;  1E4G T;  4DV4 H;  3T1H H;  4LH6 A;  4UCV A;  2CW7 A;  2W57 A;  2VQE H;  4DV2 H;  1BGW A;  4UCU A;  4X65 H;  4LMY A;  4MV7 A;  2F4V H;  2UXC H;  2VE7 C;  4YHH H;  3DF7 A;  2HL9 A;  1TAE A;  4DUZ H;  1DGS A;  4DR6 H;  4NXN H;  4UCT A;  3J81 W;  2IGP A;  2WDT A;  3BAA A;  3IG0 A;  4UCR A;  4A2B A;  1SEI A;  4LSX A;  4LSA A;  2HHH H;  5D1P A;  4J0M A;  1EUV A;  2CW8 A;  4B3S H;  4LF8 H;  3JAM W;  4Q0Y A;  3K3V A;  5FPO A;  1N36 H;  4B3R H;  4X64 H;  3F8N A;  2VOB A;  4UCO A;  4DUY H;  4JI0 H;  4NXM H;  4LFA H;  4DR4 H;  1HNW H;  2UU9 H;  2HVS A;  4K0K H;  3KAL A;  4GKJ H;  4RB1 A;  1Z2O X;  1I6U A;  2O03 A;  1N34 H;  4M7E A;  1XDN A;  4YY3 H;  3RIZ A;  4JI8 H;  4LF7 H;  4DV1 H;  1A0I A;  4LF4 H;  5IWA H;  2HGS A;  4PDB A;  4LVR A;  5FMT A;  1XMO H;  1O75 A;  4LFB H;  1ZHS A;  1XMQ H;  1IBK H;  2RGR A;  1I94 H;  2UXB H;  2XIG A;  2UUA H;  4KHP H;  4MTD A;  3OTO H;  1Z2N X;  5BR8 H;  5FLX W;  1HNX H;  5LMN H;  4EEQ A;  2HL8 A;  1VS0 A;  3H20 A;  3BA9 A;  2HVQ A;  3N6X A;  3PN1 A;  3T1Y H;  5D1O B;  1S68 A;  2VPS A;  1IBM H;  4RB3 C;  4B3T H;  4DV6 H;  3C0F B;  4JI2 H;  4DV5 H;  3J80 W;  4LF9 H;  3RGZ A;  2E5L H;  3JSL A;  4B3M H;  1BJT A;  1M0W A;  3L4J A;  3J7A K;  4X62 H;  4FM9 A;  3KAJ A;  2VQF H;  3EAY A;  3N42 B;  4I7H A;  1FKA H;  5LMU H;  4A2A A;  1WH2 A;  2VE7 A;  3HXL A;  5A2Q W;  4CC6 A;  4BWS C;  4DR3 H;  4RAY A;  4X66 H;  3BA8 A;  4LVP A;  2WYO A;  1ZHQ A;  4UFZ A;  1N33 H;  3JSN A;  1SYX B;  1XNQ H;  1XNR H;  2Q2U A;  1S03 G;  3BAB A;  4GLX A;  5FD5 A;  2RGV A;  1P8L A;  4LH7 A;  4OX9 H;  4RAZ A;  4UCS A;  4IAJ A;  5FPR A;  1B04 A;  1AN7 A;  4DR7 H;  4DDP A;  1X9N A;  2ZM6 H;  4JI6 H;  2VUG A;  2EQO A;  4EFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...