1HQQA

Miniprotein mp-2 (m9a) complex with streptavidin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-protein Complexes
rcsb
source organism Streptomyces avidinii
molecule tags Unknown function
total genus 25
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1hqqA00
2G5LA 1SLGB 1KFFA 1MOYA 1WBIA 4Y5DA 4BCSA 2OFBA 2IZJA 4JHQA 3SZJA 3T6LA 4GJSA 3T6FA 4U46A 4BX6B 2A5BA 1NQNA 1VWFB 4Z28A 1Y55X 1SWDA 1SWLA 1VWEB 5K68A 1VWKB 3WZOA 4BX7B 1N7YA 1SWFA 1AVEA 1MM9A 1STRB 4JNJA 2RTAA 5JD2A 3RDSA 1RXHA 3RY2A 2RTJA 1NDJA 3EW1A 1SWNA 4I60A 1SWAA 3T2WA 5K67A 1SWUA 1LDOA 2A8GA 2C1QA 4CPHB 2ZSCA 4GGZA 2RTDB 5L3YA 1SWCA 4BX6A 2Y32A 1RXKA 1SRHA 1VYOA 2IZIA 1MK5A 4OKAA 1SWPA 1VWMB 1SREA 1VWOB 3VHIA 1VWCB 4BX7A 4GGRA 5B5FA 1SWSA 2IZHB 1VWQB 1SWHA 4Z2VA 2C4IA 4GJVA 4EKVA 3VGWA 2QCBA 3WZQA 1STPA 3X00A 2FHLA 5F2BA 5B5GA 3RDUA 3SZIA 4Z2PA 1VWHB 2RTBB 1N4JA 4CPEA 4BJ8A 1KL4A 4IRWA 4BX5B 4CPHA 1HY2A 1N9YA 2IZBA 4CPFA 1LDQA 1SRFA 2AVIA 5CSEA 1SRIA 4YVBA 1LUQA 2RTKA 3EW2A 1SWRA 1RSUB 2FHNX 1SLDB 1VWIB 2RTHB 1SWOA 4GD9A 4Z2OA 1LCZA 1SWQA 1SLEB 1VWGB 3SZHA 2RTIB 3T2XA 1LELA 1VWAB 1N9MA 2GH7A 5IRUA 3WZNA 3WYPA 3RE6A 1Y52X 5CHKA 4Z6JA 1VWPB 3MM0A 1SRJA 2MF6A 2RTMA 4BBOA 2RTNB 4BX5A 1DF8A 1AVDA 3RDXA 1SRGA 2RTQB 3VHHA 1KL5A 3PK2A 1SWKA 2RTPB 2UZ2A 1LCVA 1VWLB 1SLFB 2IZGB 1I9HA 4JO6A 1HXZA 1NQMA 1Y53X 2RTEB 2RTFB 2F01A 2Y3EA 3RE5A 1STSB 2OF8A 4Z27A 1SWEA 4DNEA 2OF9A 3RY1A 1KL3A 1VWBB 1RXJA 3FDCA 2CAMA 1RAVA 2IZLB 2IZFB 2IZEB 3RDQA 1VWDB 2IZKA 2RTOB 1PTSA 2WPUA 5IRWA 1IJ8A 1VWNB 2RTGB 2RTLA 2UYWA 3MG5A 2IZDB 2C1SA 2IZAA 1VWJB 2JGSA 1SWGA 2Y3FA 1NC9A 1MEPA 1N43A 2A5CA 3WYQA 3VHMA 1SWBA 4GDAA 1SWTA 1NBXA 1LCWA 3WZPA 2IZCB 1SWJA 2BC3A 2RTCB 3RDOA 1HXLA 2OFAA 3RDMA 4Y59A 4GGTA 1VWRB 1HQQA 1RSTB 5IRAA 4CPIA 2RTRB
chains in the Genus database with same CATH superfamily
3FA9A 1W4TA 1KFFA 1WBIA 2XKLA 1CBSA 3T6LA 2VFBA 1KXOA 3PEDA 2RA6A 3SZJA 3ZW1A 1LIFA 2A5BA 3CBSA 4Z28A 4CDFA 1AVGI 2EU7X 4WHIA 1VWEB 4KC8A 3D9WA 3CQRA 5K68A 2AMMX 1SWFA 3APUA 1HQPA 1VPRA 1MM9A 4JNJA 1QY2A 1B8EA 2RTAA 4Y0RA 4YFPA 4WFUA 5JD2A 5HZ6A 1QFVA 1X8OA 1X8PA 1MDCA 3P6HA 4LKTA 3B2KA 5F1EA 4I60A 1SWAA 2ACOA 1KT5A 2WQAE 2AT5X 1HBQA 2HMBA 3MVFA 3HK1A 4O4XA 4HPAA 2L9CA 1LDOA 1K3BA 3D97A 1DFVA 2ZSCA 5F6BA 1DZKA 1QG5A 5HCEC 2JU3A 3BU9A 5HA0A 4AZQA 1BWYA 1X8NA 4IMNA 4M6SA 5L3YA 4BX6A 2Q4NA 1G5WA 1RXKA 3FLLA 3KFFA 5LJGA 3EMMA 2DJGA 4K19A 2R74A 4ORXA 1CBRA 4FQBB 1VWOB 1VWCB 2HNXA 1ZNDA 4GGRA 4B55A 5LKFA 1HMRA 2IZHB 3TF6A 3STMX 1K24A 3WJEA 1SWHA 3ZUIA 1KQWA 3P6EA 1HN2A 1EPBA 2ZAGA 4EKVA 4LQZA 3T1DA 5B5GA 1JMXA 1HMSA 3FEKA 4MVIA 4U8UM 3ZI8A 3SZIA 1IW2A 1IKEA 4CPEA 3IFBA 1YWCA 4HWMA 4ALBA 1KL4A 3U0DA 3B2LA 4CPHA 3FIQA 1N9YA 2HZRA 1D3SA 2X8SA 3APWA 1I78A 1ICMA 4GE1A 5CE4A 5CSEA 1S44A 3FENA 1LUQA 1O1VA 1X71A 2RTKA 1RSUB 2X8FA 2RTHB 3VG6A 3JSQA 2AH7X 3D4RA 1XCAA 1YIVA 2FR2A 3F9DA 1YP6A 1SWQA 1SLEB 2QMIA 2A2UA 2LBVA 3NP1A 3WOVA 1QWDA 3C78X 1YUPA 4FGIB 4GETA 5IRUA 4O3ZA 3WZNA 2KW1A 3RE6A 4C5PA 2X8TA 3I0AA 4GH7A 2AT8X 2RTMA 3B2IA 2MWHA 4CV7A 3RDXA 1AVDA 3WXQA 1B0OA 4HFOA 1GX3A 5EDBA 2OY7A 1KL5A 3UEWA 1EPAA 1FELA 5EEEA 1LIDA 4YDBA 2IZGB 5HA1A 1NP1A 1I9HA 2OY8A 4O3YA 5D4AA 5FENA 4FBVA 2RTEB 4ZHGA 2G7BA 1I06A 1N0SA 2OF8A 3P24A 3APVA 1SWEA 4ML7B 4OEMA 1KL3A 5HZ9A 1X8QA 1L6MA 4NNSA 1SY0A 2FR3A 4FBOA 4OS8A 4PJ2A 2IZFB 1HBPA 1DZJA 4AZNA 4DQ3A 4GZVA 4O3WA 3VPJE 1PTSA 2ALLX 3DSZA 4IB6A 4ALOA 4EXZA 1EUOA 2N93A 1GKAA 4OS0A 4QZUA 4YGZA 5IXGA 2JGSA 2WUTA 1LF7A 1SWGA 4O4SA 2Y3FA 3ZUOA 3HOEA 5D8JA 1OBQA 1TOUA 3L4RA 1EQDA 3LV4A 4L1NA 2A5CA 3EBKA 4BQUA 1UYOX 1TOWA 1BSOA 1GX9A 2CM9A 1NBXA 5HTDA 1BEBA 2RTCB 2X45A 3MX7A 3QQ2A 2FRSA 3CMPA 3LTWA 1U18A 3QKGA 1BSQA 1HQQA 1RSTB 1T8VA 2ASNX 2RQ0A 3FEPA 4CPIA 2X46A 4Z2VA 3BDRA 1TXLA 3AKNA 3FA6A 3KFHA 4RUUA 4EDEA 1MOYA 2F73A 1TW4A 2JW1A 2L67A 2RN4A 3F6ZB 4TNNA 5B3MO 4GJSA 2HKDA 1G7NA 2FT9A 2OZQA 2XSTA 3BS2A 4I3CA 4M7MA 4U46A 3SOTA 4D6BA 1EALA 4CDDA 1SWDA 2BS5A 4I95A 1MX8A 4TKJA 4ES7A 1JYDA 4ORYA 2FKGA 3SLTA 1IFBA 1MX7A 1ERXA 2AT6X 2FS6A 1EW3A 3WZOA 2MM3A 1AVEA 1STRB 1U17A 1LPJA 3RDSA 3RSWA 1LFOA 4IB7A 4HPCA 3B2HA 2Q39A 1PM1X 3EW1A 4IB8A 3D95A 5LJDA 3VE2A 4ZHCA 5HCCC 1GGLA 1SWNA 1Y9LA 1KT4A 5EEDA 3WJFA 5JR8A 3BX7A 4HPDA 3FELA 1AELA 1GM6A 2A8GA 1ADLA 2BLGA 2OL8O 4AZMA 4GGZA 2Q9SA 4AZRA 3OD9A 4NV8A 3CKFA 4ZHHA 1SA8A 1CBIA 3HTYA 1FJ1E 4I3BA 1JBHA 5BVQA 1VYOA 3FR2A 3RWXA 1ALBA 1MK5A 1SWPA 2ANSA 1ZNHA 4O4UA 1CJ5A 3NQKA 4UU3A 1I04A 4YH0A 1SREA 2JU7A 2OVEA 3UEXA 3VG7A 3VHIA 4BX7A 4YCHA 2LFOA 3G7XA 1SWSA 4TLJA 3V8UA 2QO4A 4TKBA 1A18A 3SLJA 1PBYA 1P6PA 1QABE 2C4IA 2X4MA 4GJVA 5H9LA 3WZQA 3O2YA 1D2UA 3K3LA 3FW5A 1OPAA 4Z2PA 1VWHB 4D6AA 1E00A 2GC9A 3AKMA 4Y0PA 4BJ8A 2BT9A 2Q2MA 4NLJA 4CPFA 1LDQA 1SRFA 5FQ8E 3TGAA 2JMBA 4MVKA 2R56A 1SWRA 2FHNX 2GTLO 1SLDB 1T0VA 2YG2A 3GE2A 4GNWA 4IAXA 4WFVA 2X34A 4Z2OA 4LKPA 1O8VA 1LCZA 3NBXX 1VWGB 4QGXA 3SZHA 3T2XA 3MBTA 1NP4A 3VG4A 5DPQA 1VWAB 2W2AA 3WYPA 1B56A 2LKKA 1QFTA 1DF3A 3ZQ3A 1ZNLA 3MM0A 1SRJA 2MF6A 5BVSA 4BBOA 3NX1A 4BX5A 1DV9A 4KH8A 1OEKA 2PI3O 2DJFA 5L8NA 3OJYC 1SY3A 4OS3A 2UZ2A 1LCVA 2M4LA 2A3FX 2POAA 3EBWA 4JO6A 3HOLA 4TKHA 1Y53X 2BHVA 1KT6A 3RE5A 4A60A 4EEJA 2WWPA 5H9AA 4Z27A 2RCQA 3KFGA 3EC5A 1VWBB 1RXJA 1FDQA 1KOIA 4MVEA 4U9CA 2IZLB 1IFCA 2FLJA 2NP1A 2CBSA 1T68X 3APXA 3WVMA 2RTOB 1LNMA 1SY2A 3Q34A 2VFCA 1E02A 2KD2A 4ZGUA 1YWBA 3ZW1B 3WJBA 5IRWA 1JZUA 1E06A 1VWNB 2CBRA 4I9SA 5LKEA 3MG5A 2GTFX 2I5ZO 1PMPA 1VWJB 4BOEA 3HWDA 1JIWI 3JQOA 4IABA 4ZHFA 2MHDA 1MEPA 2QM9A 4GK9A 1A3YA 2QOSC 3WYQA 4ZR2A 3VHMA 1SWBA 1B4MA 1LIEA 1SWTA 5FAZA 2WEXA 5HZQA 1TVQA 2BC3A 4YMYA 1OPBA 4JGLA 1KQXA 2OFAA 1X8UA 4Y59A 3CR6A 2IFBA 3C77X 4GGTA 5B10O 4NYRA 3STNA 1WUBA 2R73A 5FQ6E 4ZFXA 1FEMA 2CZTA 4ORUA 1QY1A 1BM5A 5HZ8A 4ORWA 3FYFA 3NQ3A 2OFBA 4KC7A 4JHQA 3S5XA 5D45A 3VE1A 1VYFA 4BX6B 5BVTA 1NQNA 3FIDA 3P02A 1BJ7A 2QOMA 4YGGA 4ZJ0A 2K23A 3UEVA 5FQ7E 5B29A 1VWKB 1DZMA 4U8UO 4FBRA 1N7YA 4QYNA 3PQSA 5IO7A 1JV4A 3I17A 3O19A 3PH5A 5EDCA 1RXHA 2KT4B 2WSJA 4IMOA 3RY2A 4OMWA 3VG3A 2RTJA 3N91A 2GTLN 1NDJA 1QQSA 1S7DA 3OBLA 5H9NA 4XMEA 1ZRYA 1E5PA 5H8TA 4ORRA 4COTA 1ZNEA 1SWUA 4CPHB 2C1QA 1RBPA 1FE3A 3B2JA 4KT5A 5H9KA 1PEEA 4MISA 2RTDB 3OE3A 1SWCA 5LJHA 1SRHA 4MEEA 4O49A 4YCEA 2F09A 1CRBA 3FMZA 4ORSA 4ON1A 4MIRA 1VWMB 1OEEA 4NNTA 4A8ZA 5F6ZA 3SAOA 2RCTA 1OSPO 2AKQA 2KTSA 1UYNX 2W2BA 1YP7A 4DCBA 4ZH9A 3CQNA 3HWEA 5L8IA 5HZ5A 3X00A 2FHLA 4ZHDA 4R0BA 2G78A 1JJUA 4ARHA 1SXYA 3FR5A 4NV7A 1ICNA 4GNYA 1SMPI 2FGSA 3DTQA 1GX8A 2IZBA 4IBAA 2FS7A 4CSBA 2AVIA 3C76X 3BRNA 5AQ6A 1SRIA 4YVBA 3RBYA 1GT5A 2WR6A 5B2AO 4QNIA 3VU1A 1VWIB 4ODDA 1SWOA 4YDAA 4HPBA 3ZW0B 5AEOA 4MVLA 4QRLA 3HWFA 4PSQA 2OFRX 3WJCA 1R0UA 4YKMA 3PPTA 4ZCBA 1N9MA 2G79A 1E2TA 3P6FA 3FA7A 1Y52X 1MUPA 2BS6A 3F8AA 3PECA 4CK4A 4AZOA 1ACDA 2RTNB 1DF8A 5F7GA 1SRGA 1MVGA 2OY5O 3ZZVA 2OFMX 2RTQB 4IAWA 3PK2A 1Y9TA 1GT3A 2RTPB 1VWLB 3RZYA 2A0AA 2QO5A 4YBPA 5KIDA 4NW4A 2RTFB 2F01A 1PBOA 5EPQA 4AYHA 2O62A 5AJCA 4GUZA 4XMFA 4YKOA 1EXSA 2OF9A 3RY1A 3IA8A 3PDFA 1JMZA 4I9RA 3S5VA 2MJIA 4U8UN 3HPEA 5L8OA 4LZVA 2BSZA 4INNA 2K62A 3ELXA 2L68A 1ML7A 3NR3A 4LZUA 1YWDA 3NPOA 5HBSA 3BSZE 4KIIA 5EZ2A 1IJ8A 1G85A 2RTGB 1OBPA 2AT3X 2RTLA 2UYWA 3TZSA 1EIIA 2NNQA 3KFIA 4GKCA 5IO5A 4O9SA 2VDFA 3NQ9A 1U0XA 1NGLA 5F58A 2NNDA 2YMSA 4GDAA 1XKIA 1LCWA 1VYGA 4AW8A 3BU1A 2IZCB 2HYSA 1SWJA 3RDOA 2HZQA 2JU8A 1HXLA 5D48A 2X56A 2OL7A 1YWAA 1S2PA 1CBQA 1VWRB 3BX8A 3NADA 1BRPA 4O3XB 2RTRB 4GDZA 4CDEA 4YFRA 2Z4HA 2G5LA 1SLGB 3E3CA 1KZXA 4Y5DA 1BSYA 2P8GA 1LIBA 1UREA 3ELZA 2IZJA 4BCSA 1JJXA 3T6FA 3TGCA 1VWFB 5LJBA 3VG5A 1Y55X 3O22A 2PY1A 1SWLA 2OL6O 3BY0A 3KZAA 2FTBA 1A2DA 1ERBA 1BBPA 4KCAA 4BX7B 3GAQA 2ZAIA 3TGBA 3AUMO 1O1UA 2W2FA 3HWGA 1W6FA 4L3RA 1RLBE 4OELA 2HLVA 4A1HA 5HWZA 4ID2A 3T2WA 5K67A 3Q6LA 2CZUA 3CKGA 1LKEA 1GXAA 3D96A 3H3IA 1DZPA 1I4UA 4NYQA 4Y0QA 2ACPX 3AEHA 4UU2A 3SLOA 5HAEA 2Y32A 5B11O 3CBCA 2IZIA 4OKAA 4EQAC 1EI5A 3LHNA 4WBKA 5D47A 3P6CA 5C0NA 3U03A 1JJJA 5B5FA 5HTEA 4O4OA 5KHPA 2OYBO 1KZWA 4N7CA 1VWQB 1BRQA 2E4JA 3VGWA 2QCBA 4QGVA 1STPA 4DQ4A 4OMXA 5F2BA 3JS1A 3RDUA 5LJKA 1G74A 2FWVA 1GT1A 2RTBB 4U3QA 1N4JA 3UEUA 3FW4A 4TQ2A 3STKA 3NX2A 2WQ9A 4IRWA 4BX5B 2MO5A 5CYBA 1GT4A 1HY2A 3ZW0A 4GU8A 1HMTA 1I05A 1JYJA 3EW2A 5DG4A 1KT7A 3S60A 2L5PA 1JQPA 1SXXA 3FR4A 4GD9A 5LJCA 1AQBA 2DM5A 2CM4A 1AB0A 1SY1A 2JN3A 2KTDA 2QO6A 4N7DA 3WJGA 4A1YA 2RTIB 1X89A 1BLRA 1LELA 4I3DA 2GH7A 2OVDA 3BLGA 2LB6A 4YGHA 3ZWEA 4I6SA 4XMCA 3PH6A 5IO6A 1W5RA 1QY0A 3UAQA 4QZTA 5CHKA 1FTPA 1UZ2X 1Z24A 4ZH6A 4AZPA 4Z6JA 1VWPB 3P6DA 4XMDA 3RKGA 3S26A 1IKJA 5FFHA 4QAEA 2A13A 2AF5A 4NLIA 2WEWA 3PP6A 1Y0GA 4YBUA 3VHHA 1SWKA 5B27A 4GRJA 1SLFB 4XMHA 3U9PC 1HXZA 1NQMA 1SXUA 4QGWA 1KT3A 4Y0SA 4YFQA 4RUNA 2Y3EA 1STSB 2GJ5A 5KICA 1IIUA 4DNEA 5BYPA 3FDCA 1FENA 2CAMA 2GTLM 2Q2PA 4XMGA 1RAVA 2G8CO 2IZEB 3RDQA 1ZNKA 1VWDB 2I5VO 2IZKA 3KVNA 4TJZA 4ZGFA 2A2GA 4QYPA 3VG2A 2AL0X 3FA8A 2WPUA 2AT0X 4CDCA 3EM0A 4BGFA 4QQ1A 1LICA 1OBUA 2IZDB 2C1SA 2IZAA 4BVMA 2OY1O 5HCDC 2X32A 5LJEA 3P6GA 1NC9A 3PQUA 1KGLA 2NNEA 3KQ0A 1N43A 3WBGA 1GKAB 3EYCA 2X55A 1OEJA 2OVAA 5AJBA 1DC9A 2Z4IA 1H91A 2OVSA 2LA7A 2RD7C 1SXWA 2JOZA 3CWKA 3WZPA 2FKJA 1A57A 3ZW2A 1EIOA 3RDMA 4IB9A 3WJDA 4EFGA 5IRAA 1ZNGA 4NP1A 2LBAA 5K06A
chains in the Genus database with same CATH topology
2G5LA 1SLGB 1KFFA 1MOYA 1WBIA 4Y5DA 4BCSA 2OFBA 2IZJA 4JHQA 3SZJA 3T6LA 4GJSA 3T6FA 4U46A 4BX6B 2A5BA 1NQNA 1VWFB 4Z28A 1Y55X 1SWDA 1SWLA 1VWEB 5K68A 1VWKB 3WZOA 4BX7B 1N7YA 1SWFA 1AVEA 1MM9A 1STRB 4JNJA 2RTAA 5JD2A 3RDSA 1RXHA 3RY2A 2RTJA 1NDJA 3EW1A 1SWNA 4I60A 1SWAA 3T2WA 5K67A 1SWUA 1LDOA 2A8GA 2C1QA 4CPHB 2ZSCA 4GGZA 2RTDB 5L3YA 1SWCA 4BX6A 2Y32A 1RXKA 1SRHA 1VYOA 2IZIA 1MK5A 4OKAA 1SWPA 1VWMB 1SREA 1VWOB 3VHIA 1VWCB 4BX7A 4GGRA 5B5FA 1SWSA 2IZHB 1VWQB 1SWHA 4Z2VA 2C4IA 4GJVA 4EKVA 3VGWA 2QCBA 3WZQA 1STPA 3X00A 2FHLA 5F2BA 5B5GA 3RDUA 3SZIA 4Z2PA 1VWHB 2RTBB 1N4JA 4CPEA 4BJ8A 1KL4A 4IRWA 4BX5B 4CPHA 1HY2A 1N9YA 2IZBA 4CPFA 1LDQA 1SRFA 2AVIA 5CSEA 1SRIA 4YVBA 1LUQA 2RTKA 3EW2A 1SWRA 1RSUB 2FHNX 1SLDB 1VWIB 2RTHB 1SWOA 4GD9A 4Z2OA 1LCZA 1SWQA 1SLEB 1VWGB 3SZHA 2RTIB 3T2XA 1LELA 1VWAB 1N9MA 2GH7A 5IRUA 3WZNA 3WYPA 3RE6A 1Y52X 5CHKA 4Z6JA 1VWPB 3MM0A 1SRJA 2MF6A 2RTMA 4BBOA 2RTNB 4BX5A 1DF8A 1AVDA 3RDXA 1SRGA 2RTQB 3VHHA 1KL5A 3PK2A 1SWKA 2RTPB 2UZ2A 1LCVA 1VWLB 1SLFB 2IZGB 1I9HA 4JO6A 1HXZA 1NQMA 1Y53X 2RTEB 2RTFB 2F01A 2Y3EA 3RE5A 1STSB 2OF8A 4Z27A 1SWEA 4DNEA 2OF9A 3RY1A 1KL3A 1VWBB 1RXJA 3FDCA 2CAMA 1RAVA 2IZLB 2IZFB 2IZEB 3RDQA 1VWDB 2IZKA 2RTOB 1PTSA 2WPUA 5IRWA 1IJ8A 1VWNB 2RTGB 2RTLA 2UYWA 3MG5A 2IZDB 2C1SA 2IZAA 1VWJB 2JGSA 1SWGA 2Y3FA 1NC9A 1MEPA 1N43A 2A5CA 3WYQA 3VHMA 1SWBA 4GDAA 1SWTA 1NBXA 1LCWA 3WZPA 2IZCB 1SWJA 2BC3A 2RTCB 3RDOA 1HXLA 2OFAA 3RDMA 4Y59A 4GGTA 1VWRB 1HQQA 1RSTB 5IRAA 4CPIA 2RTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G5L A;  1SLG B;  1KFF A;  1MOY A;  1WBI A;  4Y5D A;  4BCS A;  2OFB A;  2IZJ A;  4JHQ A;  3SZJ A;  3T6L A;  4GJS A;  3T6F A;  4U46 A;  4BX6 B;  2A5B A;  1NQN A;  1VWF B;  4Z28 A;  1Y55 X;  1SWD A;  1SWL A;  1VWE B;  5K68 A;  1VWK B;  3WZO A;  4BX7 B;  1N7Y A;  1SWF A;  1AVE A;  1MM9 A;  1STR B;  4JNJ A;  2RTA A;  5JD2 A;  3RDS A;  1RXH A;  3RY2 A;  2RTJ A;  1NDJ A;  3EW1 A;  1SWN A;  4I60 A;  1SWA A;  3T2W A;  5K67 A;  1SWU A;  1LDO A;  2A8G A;  2C1Q A;  4CPH B;  2ZSC A;  4GGZ A;  2RTD B;  5L3Y A;  1SWC A;  4BX6 A;  2Y32 A;  1RXK A;  1SRH A;  1VYO A;  2IZI A;  1MK5 A;  4OKA A;  1SWP A;  1VWM B;  1SRE A;  1VWO B;  3VHI A;  1VWC B;  4BX7 A;  4GGR A;  5B5F A;  1SWS A;  2IZH B;  1VWQ B;  1SWH A;  4Z2V A;  2C4I A;  4GJV A;  4EKV A;  3VGW A;  2QCB A;  3WZQ A;  1STP A;  3X00 A;  2FHL A;  5F2B A;  5B5G A;  3RDU A;  3SZI A;  4Z2P A;  1VWH B;  2RTB B;  1N4J A;  4CPE A;  4BJ8 A;  1KL4 A;  4IRW A;  4BX5 B;  4CPH A;  1HY2 A;  1N9Y A;  2IZB A;  4CPF A;  1LDQ A;  1SRF A;  2AVI A;  5CSE A;  1SRI A;  4YVB A;  1LUQ A;  2RTK A;  3EW2 A;  1SWR A;  1RSU B;  2FHN X;  1SLD B;  1VWI B;  2RTH B;  1SWO A;  4GD9 A;  4Z2O A;  1LCZ A;  1SWQ A;  1SLE B;  1VWG B;  3SZH A;  2RTI B;  3T2X A;  1LEL A;  1VWA B;  1N9M A;  2GH7 A;  5IRU A;  3WZN A;  3WYP A;  3RE6 A;  1Y52 X;  5CHK A;  4Z6J A;  1VWP B;  3MM0 A;  1SRJ A;  2MF6 A;  2RTM A;  4BBO A;  2RTN B;  4BX5 A;  1DF8 A;  1AVD A;  3RDX A;  1SRG A;  2RTQ B;  3VHH A;  1KL5 A;  3PK2 A;  1SWK A;  2RTP B;  2UZ2 A;  1LCV A;  1VWL B;  1SLF B;  2IZG B;  1I9H A;  4JO6 A;  1HXZ A;  1NQM A;  1Y53 X;  2RTE B;  2RTF B;  2F01 A;  2Y3E A;  3RE5 A;  1STS B;  2OF8 A;  4Z27 A;  1SWE A;  4DNE A;  2OF9 A;  3RY1 A;  1KL3 A;  1VWB B;  1RXJ A;  3FDC A;  2CAM A;  1RAV A;  2IZL B;  2IZF B;  2IZE B;  3RDQ A;  1VWD B;  2IZK A;  2RTO B;  1PTS A;  2WPU A;  5IRW A;  1IJ8 A;  1VWN B;  2RTG B;  2RTL A;  2UYW A;  3MG5 A;  2IZD B;  2C1S A;  2IZA A;  1VWJ B;  2JGS A;  1SWG A;  2Y3F A;  1NC9 A;  1MEP A;  1N43 A;  2A5C A;  3WYQ A;  3VHM A;  1SWB A;  4GDA A;  1SWT A;  1NBX A;  1LCW A;  3WZP A;  2IZC B;  1SWJ A;  2BC3 A;  2RTC B;  3RDO A;  1HXL A;  2OFA A;  3RDM A;  4Y59 A;  4GGT A;  1VWR B;  1HQQ A;  1RST B;  5IRA A;  4CPI A;  2RTR B; 
#chains in the Genus database with same CATH topology
 3FA9 A;  1W4T A;  1KFF A;  1WBI A;  2XKL A;  1CBS A;  3T6L A;  2VFB A;  1KXO A;  3PED A;  2RA6 A;  3SZJ A;  3ZW1 A;  1LIF A;  2A5B A;  3CBS A;  4Z28 A;  4CDF A;  1AVG I;  2EU7 X;  4WHI A;  1VWE B;  4KC8 A;  3D9W A;  3CQR A;  5K68 A;  2AMM X;  1SWF A;  3APU A;  1HQP A;  1VPR A;  1MM9 A;  4JNJ A;  1QY2 A;  1B8E A;  2RTA A;  4Y0R A;  4YFP A;  4WFU A;  5JD2 A;  5HZ6 A;  1QFV A;  1X8O A;  1X8P A;  1MDC A;  3P6H A;  4LKT A;  3B2K A;  5F1E A;  4I60 A;  1SWA A;  2ACO A;  1KT5 A;  2WQA E;  2AT5 X;  1HBQ A;  2HMB A;  3MVF A;  3HK1 A;  4O4X A;  4HPA A;  2L9C A;  1LDO A;  1K3B A;  3D97 A;  1DFV A;  2ZSC A;  5F6B A;  1DZK A;  1QG5 A;  5HCE C;  2JU3 A;  3BU9 A;  5HA0 A;  4AZQ A;  1BWY A;  1X8N A;  4IMN A;  4M6S A;  5L3Y A;  4BX6 A;  2Q4N A;  1G5W A;  1RXK A;  3FLL A;  3KFF A;  5LJG A;  3EMM A;  2DJG A;  4K19 A;  2R74 A;  4ORX A;  1CBR A;  4FQB B;  1VWO B;  1VWC B;  2HNX A;  1ZND A;  4GGR A;  4B55 A;  5LKF A;  1HMR A;  2IZH B;  3TF6 A;  3STM X;  1K24 A;  3WJE A;  1SWH A;  3ZUI A;  1KQW A;  3P6E A;  1HN2 A;  1EPB A;  2ZAG A;  4EKV A;  4LQZ A;  3T1D A;  5B5G A;  1JMX A;  1HMS A;  3FEK A;  4MVI A;  4U8U M;  3ZI8 A;  3SZI A;  1IW2 A;  1IKE A;  4CPE A;  3IFB A;  1YWC A;  4HWM A;  4ALB A;  1KL4 A;  3U0D A;  3B2L A;  4CPH A;  3FIQ A;  1N9Y A;  2HZR A;  1D3S A;  2X8S A;  3APW A;  1I78 A;  1ICM A;  4GE1 A;  5CE4 A;  5CSE A;  1S44 A;  3FEN A;  1LUQ A;  1O1V A;  1X71 A;  2RTK A;  1RSU B;  2X8F A;  2RTH B;  3VG6 A;  3JSQ A;  2AH7 X;  3D4R A;  1XCA A;  1YIV A;  2FR2 A;  3F9D A;  1YP6 A;  1SWQ A;  1SLE B;  2QMI A;  2A2U A;  2LBV A;  3NP1 A;  3WOV A;  1QWD A;  3C78 X;  1YUP A;  4FGI B;  4GET A;  5IRU A;  4O3Z A;  3WZN A;  2KW1 A;  3RE6 A;  4C5P A;  2X8T A;  3I0A A;  4GH7 A;  2AT8 X;  2RTM A;  3B2I A;  2MWH A;  4CV7 A;  3RDX A;  1AVD A;  3WXQ A;  1B0O A;  4HFO A;  1GX3 A;  5EDB A;  2OY7 A;  1KL5 A;  3UEW A;  1EPA A;  1FEL A;  5EEE A;  1LID A;  4YDB A;  2IZG B;  5HA1 A;  1NP1 A;  1I9H A;  2OY8 A;  4O3Y A;  5D4A A;  5FEN A;  4FBV A;  2RTE B;  4ZHG A;  2G7B A;  1I06 A;  1N0S A;  2OF8 A;  3P24 A;  3APV A;  1SWE A;  4ML7 B;  4OEM A;  1KL3 A;  5HZ9 A;  1X8Q A;  1L6M A;  4NNS A;  1SY0 A;  2FR3 A;  4FBO A;  4OS8 A;  4PJ2 A;  2IZF B;  1HBP A;  1DZJ A;  4AZN A;  4DQ3 A;  4GZV A;  4O3W A;  3VPJ E;  1PTS A;  2ALL X;  3DSZ A;  4IB6 A;  4ALO A;  4EXZ A;  1EUO A;  2N93 A;  1GKA A;  4OS0 A;  4QZU A;  4YGZ A;  5IXG A;  2JGS A;  2WUT A;  1LF7 A;  1SWG A;  4O4S A;  2Y3F A;  3ZUO A;  3HOE A;  5D8J A;  1OBQ A;  1TOU A;  3L4R A;  1EQD A;  3LV4 A;  4L1N A;  2A5C A;  3EBK A;  4BQU A;  1UYO X;  1TOW A;  1BSO A;  1GX9 A;  2CM9 A;  1NBX A;  5HTD A;  1BEB A;  2RTC B;  2X45 A;  3MX7 A;  3QQ2 A;  2FRS A;  3CMP A;  3LTW A;  1U18 A;  3QKG A;  1BSQ A;  1HQQ A;  1RST B;  1T8V A;  2ASN X;  2RQ0 A;  3FEP A;  4CPI A;  2X46 A;  4Z2V A;  3BDR A;  1TXL A;  3AKN A;  3FA6 A;  3KFH A;  4RUU A;  4EDE A;  1MOY A;  2F73 A;  1TW4 A;  2JW1 A;  2L67 A;  2RN4 A;  3F6Z B;  4TNN A;  5B3M O;  4GJS A;  2HKD A;  1G7N A;  2FT9 A;  2OZQ A;  2XST A;  3BS2 A;  4I3C A;  4M7M A;  4U46 A;  3SOT A;  4D6B A;  1EAL A;  4CDD A;  1SWD A;  2BS5 A;  4I95 A;  1MX8 A;  4TKJ A;  4ES7 A;  1JYD A;  4ORY A;  2FKG A;  3SLT A;  1IFB A;  1MX7 A;  1ERX A;  2AT6 X;  2FS6 A;  1EW3 A;  3WZO A;  2MM3 A;  1AVE A;  1STR B;  1U17 A;  1LPJ A;  3RDS A;  3RSW A;  1LFO A;  4IB7 A;  4HPC A;  3B2H A;  2Q39 A;  1PM1 X;  3EW1 A;  4IB8 A;  3D95 A;  5LJD A;  3VE2 A;  4ZHC A;  5HCC C;  1GGL A;  1SWN A;  1Y9L A;  1KT4 A;  5EED A;  3WJF A;  5JR8 A;  3BX7 A;  4HPD A;  3FEL A;  1AEL A;  1GM6 A;  2A8G A;  1ADL A;  2BLG A;  2OL8 O;  4AZM A;  4GGZ A;  2Q9S A;  4AZR A;  3OD9 A;  4NV8 A;  3CKF A;  4ZHH A;  1SA8 A;  1CBI A;  3HTY A;  1FJ1 E;  4I3B A;  1JBH A;  5BVQ A;  1VYO A;  3FR2 A;  3RWX A;  1ALB A;  1MK5 A;  1SWP A;  2ANS A;  1ZNH A;  4O4U A;  1CJ5 A;  3NQK A;  4UU3 A;  1I04 A;  4YH0 A;  1SRE A;  2JU7 A;  2OVE A;  3UEX A;  3VG7 A;  3VHI A;  4BX7 A;  4YCH A;  2LFO A;  3G7X A;  1SWS A;  4TLJ A;  3V8U A;  2QO4 A;  4TKB A;  1A18 A;  3SLJ A;  1PBY A;  1P6P A;  1QAB E;  2C4I A;  2X4M A;  4GJV A;  5H9L A;  3WZQ A;  3O2Y A;  1D2U A;  3K3L A;  3FW5 A;  1OPA A;  4Z2P A;  1VWH B;  4D6A A;  1E00 A;  2GC9 A;  3AKM A;  4Y0P A;  4BJ8 A;  2BT9 A;  2Q2M A;  4NLJ A;  4CPF A;  1LDQ A;  1SRF A;  5FQ8 E;  3TGA A;  2JMB A;  4MVK A;  2R56 A;  1SWR A;  2FHN X;  2GTL O;  1SLD B;  1T0V A;  2YG2 A;  3GE2 A;  4GNW A;  4IAX A;  4WFV A;  2X34 A;  4Z2O A;  4LKP A;  1O8V A;  1LCZ A;  3NBX X;  1VWG B;  4QGX A;  3SZH A;  3T2X A;  3MBT A;  1NP4 A;  3VG4 A;  5DPQ A;  1VWA B;  2W2A A;  3WYP A;  1B56 A;  2LKK A;  1QFT A;  1DF3 A;  3ZQ3 A;  1ZNL A;  3MM0 A;  1SRJ A;  2MF6 A;  5BVS A;  4BBO A;  3NX1 A;  4BX5 A;  1DV9 A;  4KH8 A;  1OEK A;  2PI3 O;  2DJF A;  5L8N A;  3OJY C;  1SY3 A;  4OS3 A;  2UZ2 A;  1LCV A;  2M4L A;  2A3F X;  2POA A;  3EBW A;  4JO6 A;  3HOL A;  4TKH A;  1Y53 X;  2BHV A;  1KT6 A;  3RE5 A;  4A60 A;  4EEJ A;  2WWP A;  5H9A A;  4Z27 A;  2RCQ A;  3KFG A;  3EC5 A;  1VWB B;  1RXJ A;  1FDQ A;  1KOI A;  4MVE A;  4U9C A;  2IZL B;  1IFC A;  2FLJ A;  2NP1 A;  2CBS A;  1T68 X;  3APX A;  3WVM A;  2RTO B;  1LNM A;  1SY2 A;  3Q34 A;  2VFC A;  1E02 A;  2KD2 A;  4ZGU A;  1YWB A;  3ZW1 B;  3WJB A;  5IRW A;  1JZU A;  1E06 A;  1VWN B;  2CBR A;  4I9S A;  5LKE A;  3MG5 A;  2GTF X;  2I5Z O;  1PMP A;  1VWJ B;  4BOE A;  3HWD A;  1JIW I;  3JQO A;  4IAB A;  4ZHF A;  2MHD A;  1MEP A;  2QM9 A;  4GK9 A;  1A3Y A;  2QOS C;  3WYQ A;  4ZR2 A;  3VHM A;  1SWB A;  1B4M A;  1LIE A;  1SWT A;  5FAZ A;  2WEX A;  5HZQ A;  1TVQ A;  2BC3 A;  4YMY A;  1OPB A;  4JGL A;  1KQX A;  2OFA A;  1X8U A;  4Y59 A;  3CR6 A;  2IFB A;  3C77 X;  4GGT A;  5B10 O;  4NYR A;  3STN A;  1WUB A;  2R73 A;  5FQ6 E;  4ZFX A;  1FEM A;  2CZT A;  4ORU A;  1QY1 A;  1BM5 A;  5HZ8 A;  4ORW A;  3FYF A;  3NQ3 A;  2OFB A;  4KC7 A;  4JHQ A;  3S5X A;  5D45 A;  3VE1 A;  1VYF A;  4BX6 B;  5BVT A;  1NQN A;  3FID A;  3P02 A;  1BJ7 A;  2QOM A;  4YGG A;  4ZJ0 A;  2K23 A;  3UEV A;  5FQ7 E;  5B29 A;  1VWK B;  1DZM A;  4U8U O;  4FBR A;  1N7Y A;  4QYN A;  3PQS A;  5IO7 A;  1JV4 A;  3I17 A;  3O19 A;  3PH5 A;  5EDC A;  1RXH A;  2KT4 B;  2WSJ A;  4IMO A;  3RY2 A;  4OMW A;  3VG3 A;  2RTJ A;  3N91 A;  2GTL N;  1NDJ A;  1QQS A;  1S7D A;  3OBL A;  5H9N A;  4XME A;  1ZRY A;  1E5P A;  5H8T A;  4ORR A;  4COT A;  1ZNE A;  1SWU A;  4CPH B;  2C1Q A;  1RBP A;  1FE3 A;  3B2J A;  4KT5 A;  5H9K A;  1PEE A;  4MIS A;  2RTD B;  3OE3 A;  1SWC A;  5LJH A;  1SRH A;  4MEE A;  4O49 A;  4YCE A;  2F09 A;  1CRB A;  3FMZ A;  4ORS A;  4ON1 A;  4MIR A;  1VWM B;  1OEE A;  4NNT A;  4A8Z A;  5F6Z A;  3SAO A;  2RCT A;  1OSP O;  2AKQ A;  2KTS A;  1UYN X;  2W2B A;  1YP7 A;  4DCB A;  4ZH9 A;  3CQN A;  3HWE A;  5L8I A;  5HZ5 A;  3X00 A;  2FHL A;  4ZHD A;  4R0B A;  2G78 A;  1JJU A;  4ARH A;  1SXY A;  3FR5 A;  4NV7 A;  1ICN A;  4GNY A;  1SMP I;  2FGS A;  3DTQ A;  1GX8 A;  2IZB A;  4IBA A;  2FS7 A;  4CSB A;  2AVI A;  3C76 X;  3BRN A;  5AQ6 A;  1SRI A;  4YVB A;  3RBY A;  1GT5 A;  2WR6 A;  5B2A O;  4QNI A;  3VU1 A;  1VWI B;  4ODD A;  1SWO A;  4YDA A;  4HPB A;  3ZW0 B;  5AEO A;  4MVL A;  4QRL A;  3HWF A;  4PSQ A;  2OFR X;  3WJC A;  1R0U A;  4YKM A;  3PPT A;  4ZCB A;  1N9M A;  2G79 A;  1E2T A;  3P6F A;  3FA7 A;  1Y52 X;  1MUP A;  2BS6 A;  3F8A A;  3PEC A;  4CK4 A;  4AZO A;  1ACD A;  2RTN B;  1DF8 A;  5F7G A;  1SRG A;  1MVG A;  2OY5 O;  3ZZV A;  2OFM X;  2RTQ B;  4IAW A;  3PK2 A;  1Y9T A;  1GT3 A;  2RTP B;  1VWL B;  3RZY A;  2A0A A;  2QO5 A;  4YBP A;  5KID A;  4NW4 A;  2RTF B;  2F01 A;  1PBO A;  5EPQ A;  4AYH A;  2O62 A;  5AJC A;  4GUZ A;  4XMF A;  4YKO A;  1EXS A;  2OF9 A;  3RY1 A;  3IA8 A;  3PDF A;  1JMZ A;  4I9R A;  3S5V A;  2MJI A;  4U8U N;  3HPE A;  5L8O A;  4LZV A;  2BSZ A;  4INN A;  2K62 A;  3ELX A;  2L68 A;  1ML7 A;  3NR3 A;  4LZU A;  1YWD A;  3NPO A;  5HBS A;  3BSZ E;  4KII A;  5EZ2 A;  1IJ8 A;  1G85 A;  2RTG B;  1OBP A;  2AT3 X;  2RTL A;  2UYW A;  3TZS A;  1EII A;  2NNQ A;  3KFI A;  4GKC A;  5IO5 A;  4O9S A;  2VDF A;  3NQ9 A;  1U0X A;  1NGL A;  5F58 A;  2NND A;  2YMS A;  4GDA A;  1XKI A;  1LCW A;  1VYG A;  4AW8 A;  3BU1 A;  2IZC B;  2HYS A;  1SWJ A;  3RDO A;  2HZQ A;  2JU8 A;  1HXL A;  5D48 A;  2X56 A;  2OL7 A;  1YWA A;  1S2P A;  1CBQ A;  1VWR B;  3BX8 A;  3NAD A;  1BRP A;  4O3X B;  2RTR B;  4GDZ A;  4CDE A;  4YFR A;  2Z4H A;  2G5L A;  1SLG B;  3E3C A;  1KZX A;  4Y5D A;  1BSY A;  2P8G A;  1LIB A;  1URE A;  3ELZ A;  2IZJ A;  4BCS A;  1JJX A;  3T6F A;  3TGC A;  1VWF B;  5LJB A;  3VG5 A;  1Y55 X;  3O22 A;  2PY1 A;  1SWL A;  2OL6 O;  3BY0 A;  3KZA A;  2FTB A;  1A2D A;  1ERB A;  1BBP A;  4KCA A;  4BX7 B;  3GAQ A;  2ZAI A;  3TGB A;  3AUM O;  1O1U A;  2W2F A;  3HWG A;  1W6F A;  4L3R A;  1RLB E;  4OEL A;  2HLV A;  4A1H A;  5HWZ A;  4ID2 A;  3T2W A;  5K67 A;  3Q6L A;  2CZU A;  3CKG A;  1LKE A;  1GXA A;  3D96 A;  3H3I A;  1DZP A;  1I4U A;  4NYQ A;  4Y0Q A;  2ACP X;  3AEH A;  4UU2 A;  3SLO A;  5HAE A;  2Y32 A;  5B11 O;  3CBC A;  2IZI A;  4OKA A;  4EQA C;  1EI5 A;  3LHN A;  4WBK A;  5D47 A;  3P6C A;  5C0N A;  3U03 A;  1JJJ A;  5B5F A;  5HTE A;  4O4O A;  5KHP A;  2OYB O;  1KZW A;  4N7C A;  1VWQ B;  1BRQ A;  2E4J A;  3VGW A;  2QCB A;  4QGV A;  1STP A;  4DQ4 A;  4OMX A;  5F2B A;  3JS1 A;  3RDU A;  5LJK A;  1G74 A;  2FWV A;  1GT1 A;  2RTB B;  4U3Q A;  1N4J A;  3UEU A;  3FW4 A;  4TQ2 A;  3STK A;  3NX2 A;  2WQ9 A;  4IRW A;  4BX5 B;  2MO5 A;  5CYB A;  1GT4 A;  1HY2 A;  3ZW0 A;  4GU8 A;  1HMT A;  1I05 A;  1JYJ A;  3EW2 A;  5DG4 A;  1KT7 A;  3S60 A;  2L5P A;  1JQP A;  1SXX A;  3FR4 A;  4GD9 A;  5LJC A;  1AQB A;  2DM5 A;  2CM4 A;  1AB0 A;  1SY1 A;  2JN3 A;  2KTD A;  2QO6 A;  4N7D A;  3WJG A;  4A1Y A;  2RTI B;  1X89 A;  1BLR A;  1LEL A;  4I3D A;  2GH7 A;  2OVD A;  3BLG A;  2LB6 A;  4YGH A;  3ZWE A;  4I6S A;  4XMC A;  3PH6 A;  5IO6 A;  1W5R A;  1QY0 A;  3UAQ A;  4QZT A;  5CHK A;  1FTP A;  1UZ2 X;  1Z24 A;  4ZH6 A;  4AZP A;  4Z6J A;  1VWP B;  3P6D A;  4XMD A;  3RKG A;  3S26 A;  1IKJ A;  5FFH A;  4QAE A;  2A13 A;  2AF5 A;  4NLI A;  2WEW A;  3PP6 A;  1Y0G A;  4YBU A;  3VHH A;  1SWK A;  5B27 A;  4GRJ A;  1SLF B;  4XMH A;  3U9P C;  1HXZ A;  1NQM A;  1SXU A;  4QGW A;  1KT3 A;  4Y0S A;  4YFQ A;  4RUN A;  2Y3E A;  1STS B;  2GJ5 A;  5KIC A;  1IIU A;  4DNE A;  5BYP A;  3FDC A;  1FEN A;  2CAM A;  2GTL M;  2Q2P A;  4XMG A;  1RAV A;  2G8C O;  2IZE B;  3RDQ A;  1ZNK A;  1VWD B;  2I5V O;  2IZK A;  3KVN A;  4TJZ A;  4ZGF A;  2A2G A;  4QYP A;  3VG2 A;  2AL0 X;  3FA8 A;  2WPU A;  2AT0 X;  4CDC A;  3EM0 A;  4BGF A;  4QQ1 A;  1LIC A;  1OBU A;  2IZD B;  2C1S A;  2IZA A;  4BVM A;  2OY1 O;  5HCD C;  2X32 A;  5LJE A;  3P6G A;  1NC9 A;  3PQU A;  1KGL A;  2NNE A;  3KQ0 A;  1N43 A;  3WBG A;  1GKA B;  3EYC A;  2X55 A;  1OEJ A;  2OVA A;  5AJB A;  1DC9 A;  2Z4I A;  1H91 A;  2OVS A;  2LA7 A;  2RD7 C;  1SXW A;  2JOZ A;  3CWK A;  3WZP A;  2FKJ A;  1A57 A;  3ZW2 A;  1EIO A;  3RDM A;  4IB9 A;  3WJD A;  4EFG A;  5IRA A;  1ZNG A;  4NP1 A;  2LBA A;  5K06 A; 
#chains in the Genus database with same CATH homology
 2G5L A;  1SLG B;  1KFF A;  1MOY A;  1WBI A;  4Y5D A;  4BCS A;  2OFB A;  2IZJ A;  4JHQ A;  3SZJ A;  3T6L A;  4GJS A;  3T6F A;  4U46 A;  4BX6 B;  2A5B A;  1NQN A;  1VWF B;  4Z28 A;  1Y55 X;  1SWD A;  1SWL A;  1VWE B;  5K68 A;  1VWK B;  3WZO A;  4BX7 B;  1N7Y A;  1SWF A;  1AVE A;  1MM9 A;  1STR B;  4JNJ A;  2RTA A;  5JD2 A;  3RDS A;  1RXH A;  3RY2 A;  2RTJ A;  1NDJ A;  3EW1 A;  1SWN A;  4I60 A;  1SWA A;  3T2W A;  5K67 A;  1SWU A;  1LDO A;  2A8G A;  2C1Q A;  4CPH B;  2ZSC A;  4GGZ A;  2RTD B;  5L3Y A;  1SWC A;  4BX6 A;  2Y32 A;  1RXK A;  1SRH A;  1VYO A;  2IZI A;  1MK5 A;  4OKA A;  1SWP A;  1VWM B;  1SRE A;  1VWO B;  3VHI A;  1VWC B;  4BX7 A;  4GGR A;  5B5F A;  1SWS A;  2IZH B;  1VWQ B;  1SWH A;  4Z2V A;  2C4I A;  4GJV A;  4EKV A;  3VGW A;  2QCB A;  3WZQ A;  1STP A;  3X00 A;  2FHL A;  5F2B A;  5B5G A;  3RDU A;  3SZI A;  4Z2P A;  1VWH B;  2RTB B;  1N4J A;  4CPE A;  4BJ8 A;  1KL4 A;  4IRW A;  4BX5 B;  4CPH A;  1HY2 A;  1N9Y A;  2IZB A;  4CPF A;  1LDQ A;  1SRF A;  2AVI A;  5CSE A;  1SRI A;  4YVB A;  1LUQ A;  2RTK A;  3EW2 A;  1SWR A;  1RSU B;  2FHN X;  1SLD B;  1VWI B;  2RTH B;  1SWO A;  4GD9 A;  4Z2O A;  1LCZ A;  1SWQ A;  1SLE B;  1VWG B;  3SZH A;  2RTI B;  3T2X A;  1LEL A;  1VWA B;  1N9M A;  2GH7 A;  5IRU A;  3WZN A;  3WYP A;  3RE6 A;  1Y52 X;  5CHK A;  4Z6J A;  1VWP B;  3MM0 A;  1SRJ A;  2MF6 A;  2RTM A;  4BBO A;  2RTN B;  4BX5 A;  1DF8 A;  1AVD A;  3RDX A;  1SRG A;  2RTQ B;  3VHH A;  1KL5 A;  3PK2 A;  1SWK A;  2RTP B;  2UZ2 A;  1LCV A;  1VWL B;  1SLF B;  2IZG B;  1I9H A;  4JO6 A;  1HXZ A;  1NQM A;  1Y53 X;  2RTE B;  2RTF B;  2F01 A;  2Y3E A;  3RE5 A;  1STS B;  2OF8 A;  4Z27 A;  1SWE A;  4DNE A;  2OF9 A;  3RY1 A;  1KL3 A;  1VWB B;  1RXJ A;  3FDC A;  2CAM A;  1RAV A;  2IZL B;  2IZF B;  2IZE B;  3RDQ A;  1VWD B;  2IZK A;  2RTO B;  1PTS A;  2WPU A;  5IRW A;  1IJ8 A;  1VWN B;  2RTG B;  2RTL A;  2UYW A;  3MG5 A;  2IZD B;  2C1S A;  2IZA A;  1VWJ B;  2JGS A;  1SWG A;  2Y3F A;  1NC9 A;  1MEP A;  1N43 A;  2A5C A;  3WYQ A;  3VHM A;  1SWB A;  4GDA A;  1SWT A;  1NBX A;  1LCW A;  3WZP A;  2IZC B;  1SWJ A;  2BC3 A;  2RTC B;  3RDO A;  1HXL A;  2OFA A;  3RDM A;  4Y59 A;  4GGT A;  1VWR B;  1HQQ A;  1RST B;  5IRA A;  4CPI A;  2RTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...