3EW1A

Crystal structure of rhizavidin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
FDASNFKDFSSIASASSSWQNQSGSTMIIQVDSFGNVSGQYVNRAQGTGCQNSPYPLTGRVNGTFIAFSVGWNNSTENCNSATGWTGYAQVNGNNTEIVTSWNLAYEGGSGPAIEQGQDTFQYVPTTENKSLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords rhizavidin
publication title Crystal structure of rhizavidin: insights into the enigmatic high-affinity interaction of an innate biotin-binding protein dimer.
pubmed doi rcsb
source organism Rhizobium etli
total genus 28
structure length 134
sequence length 134
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3ew1A00
4Y5DA 2RTJA 1MEPA 2G5LA 1SWBA 1LCVA 4CPIA 3EW1A 1SWDA 1SRHA 1I9HA 1SWNA 4GD9A 2IZDB 1VWNB 2GH7A 4U46A 4I60A 3VHHA 4CPHB 4BX6A 4Z2VA 2RTLA 1STSB 1SLDB 2IZJA 1SRIA 1VWMB 2IZLB 5JD2A 4Z27A 1LDOA 3SZJA 1WBIA 2IZEB 2IZKA 5CHKA 4EKVA 1HY2A 1SLFB 4GGZA 1SWEA 5K67A 4GJVA 1SWSA 4Z2PA 2RTDB 4YVBA 1SRFA 4Z28A 4BX7B 3RDXA 1MM9A 1VWDB 3MM0A 1SWJA 2C4IA 2IZGB 1SRJA 2FHLA 2OFBA 1KL3A 1AVEA 2RTQB 3WZNA 3WYPA 1SWFA 1VWKB 4GGTA 2UYWA 1RAVA 2A5CA 1SLGB 2IZBA 1N9MA 2RTCB 3WZQA 2FHNX 2RTMA 2Y3FA 1Y53X 4BBOA 4BX5B 2RTGB 4Y59A 5B5FA 4CPFA 1SWKA 1RXJA 1NQNA 4BCSA 5B5GA 2RTNB 3WYQA 5IRWA 3PK2A 1LCZA 2RTHB 2RTEB 1LUQA 3RE5A 3VHIA 1VWJB 4JO6A 1AVDA 1VWBB 1VWRB 2QCBA 3RY1A 1VWPB 3RDSA 1PTSA 1SREA 1VWIB 4OKAA 3SZHA 1HXZA 1SWLA 4DNEA 1RXKA 2MF6A 1SWUA 4GGRA 4JNJA 4BX7A 4GJSA 2C1SA 4IRWA 2Y3EA 2UZ2A 3RDMA 4CPEA 5L3YA 2JGSA 3FDCA 3T2XA 2IZAA 1KL4A 1NQMA 5F2BA 2A8GA 2AVIA 3T6FA 1VWGB 3WZPA 2RTFB 1NDJA 1N4JA 1MK5A 1SWGA 3RDUA 5CSEA 1N9YA 3RE6A 5K68A 2RTKA 1VWLB 1SWRA 1VWAB 1HXLA 1MOYA 2Y32A 1VWEB 2RTRB 4CPHA 3T6LA 1RSTB 1SWQA 3VGWA 1IJ8A 5IRAA 2RTBB 1SRGA 2OFAA 2RTOB 1DF8A 1SWAA 1Y55X 2IZCB 3RDOA 4Z2OA 1NC9A 1RXHA 3RY2A 1NBXA 1STPA 1STRB 1N7YA 1LELA 4BX6B 4JHQA 1N43A 1KFFA 2RTPB 1VWHB 3EW2A 1SWOA 2WPUA 2RTIB 5IRUA 3SZIA 4BJ8A 1RSUB 2IZIA 1VWCB 1SWCA 2OF8A 2BC3A 2A5BA 1SWHA 1VWOB 3T2WA 4GDAA 2IZHB 1HQQA 1LDQA 1VYOA 1Y52X 3X00A 3WZOA 2OF9A 4Z6JA 1VWQB 2F01A 1SWTA 2ZSCA 1LCWA 2CAMA 3VHMA 4BX5A 3MG5A 2IZFB 1SWPA 2RTAA 1KL5A 1SLEB 3RDQA 1VWFB 2C1QA
chains in the Genus database with same CATH superfamily
2OY8A 4Y5DA 3RWXA 4U8UN 1BRQA 4I95A 1LCVA 2R73A 5LKEA 1LIFA 1SRHA 4GH7A 4NNSA 5HWZA 1DV9A 1GX8A 1L6MA 3AUMO 1O1VA 1VWNB 2QO5A 2W2BA 4U46A 1G7NA 3S26A 3S5VA 5C0NA 1IFCA 4XMHA 4LZVA 4Z2VA 2XKLA 1A18A 1SLDB 2PY1A 4FQBB 5IO5A 2FS7A 1JJJA 2K62A 5IXGA 2OFMX 4YKOA 2MM3A 2IZEB 4EKVA 5CHKA 1HY2A 4ID2A 1LNMA 1EXSA 1GM6A 1SWEA 1QQSA 4ZJ0A 1E02A 4TNNA 1DZJA 4YVBA 1G85A 1PM1X 3RDXA 5F1EA 1O1UA 1DZPA 1B8EA 3BS2A 3P6CA 1XKIA 4WFUA 1DFVA 2FHLA 4I3DA 4O49A 4QGXA 4YGZA 5HZ6A 2JU7A 4RUUA 1EALA 2O62A 4CSBA 4MVLA 1KT7A 2OYBO 2UYWA 4NYQA 4QGWA 1YIVA 4MVEA 3WZQA 2WUTA 4YFQA 3DSZA 2RTMA 1SY3A 3JS1A 4PSQA 2Y3FA 3CMPA 3ZZVA 4QAEA 4BBOA 3MBTA 5B5FA 4CPFA 1RXJA 4CV7A 4BCSA 4A1HA 3KFFA 2RTNB 4N7DA 4YDAA 4ML7B 4RUNA 2RA6A 2RTHB 3RE5A 1JIWI 2JOZA 3CWKA 2FWVA 1VWPB 3RDSA 1PTSA 3I17A 5L8OA 1PMPA 1KGLA 1I05A 4Y0QA 3VE2A 1SXUA 3I0AA 4HPCA 1GX9A 1OBQA 1SWUA 3JSQA 4JNJA 1DC9A 1KQXA 2FT9A 4GJSA 1TVQA 2MWHA 3HOEA 4D6AA 2X32A 2R56A 2QO6A 1PEEA 3L4RA 2P8GA 3PQSA 1OEKA 4B55A 1HBPA 2JW1A 1NQMA 1PBOA 1R0UA 2A8GA 3KZAA 3STMX 3STKA 2W2FA 1K3BA 1LF7A 4NNTA 1VWGB 1HQPA 3N91A 1NDJA 5CSEA 1A3YA 1N9YA 1X8UA 2HMBA 4GU8A 4HPBA 4KT5A 1SWRA 4AZNA 1VWAB 1HXLA 2Q2MA 1H91A 2ZAIA 3SLTA 4C5PA 3TF6A 1GKAA 3UAQA 1Y9TA 2NNDA 2Q39A 2VFBA 5H8TA 3HWEA 3VG6A 3OJYC 5L8NA 3TGCA 4EFGA 2OFAA 1ICMA 1DF8A 1SWAA 2PI3O 2X4MA 3B2KA 2AL0X 3OBLA 4QZUA 5BVQA 1NBXA 2MO5A 1VPRA 1ZNKA 1LELA 1CJ5A 2QMIA 1FELA 1ADLA 2I5ZO 1ERBA 4ALOA 1GT4A 4KC7A 5HA1A 4GKCA 4HPAA 1SWOA 3FEPA 4CK4A 1GT3A 4YBUA 2OVDA 2CBSA 2WPUA 4YBPA 4BJ8A 3NPOA 1OSPO 4AZOA 1JMZA 1SXYA 2A5BA 4IBAA 4TLJA 5KICA 2GTLM 4GDAA 3ZW2A 4I3CA 4IAWA 3OE3A 1HN2A 1SY2A 2GC9A 3QQ2A 1VYOA 1Y52X 2AT0X 3BRNA 3D95A 1AVGI 2X8SA 3DTQA 4QNIA 2G7BA 5DG4A 1LCWA 2G78A 5LJDA 2ACOA 4OMWA 1FTPA 1KZWA 3D4RA 3ZWEA 4BGFA 4WFVA 2AT3X 3BX8A 1EW3A 1MEPA 1SWBA 3FENA 4IMOA 2F09A 1JYJA 3RSWA 1GT1A 1I9HA 1SWNA 4U3QA 2LBVA 4N7CA 5H9AA 1OEJA 4BOEA 4GD9A 2IZDB 1NP1A 4GUZA 1FE3A 4FGIB 4L1NA 3WJGA 3VHHA 4Y0SA 3HWGA 5HZQA 2OY1O 1I04A 2G79A 2IZLB 2WEWA 4MEEA 5JD2A 2OL6O 3SZJA 3VG5A 3ZI8A 1D3SA 1W6FA 1A57A 3FLLA 5DPQA 3F6ZB 4DCBA 1I4UA 4NW4A 5K67A 4GJVA 1JYDA 2FS6A 3GE2A 5F7GA 1SWSA 5HCEC 3FIQA 3LV4A 4Z28A 1JZUA 2POAA 1SWJA 2FLJA 5LJKA 4AZRA 5HCDC 2JU8A 3Q34A 1AVEA 3ZUIA 1HBQA 4O3YA 1TOUA 2BSZA 3WYPA 1EPAA 1B0OA 1X8NA 4O4XA 1SWFA 1EPBA 1VWKB 5F58A 3H3IA 4CDCA 3V8UA 3P6HA 2FR3A 3VPJE 1ZNEA 2OZQA 1KXOA 4QZTA 4YMYA 1X8PA 1ZNDA 4TKHA 1W5RA 1X71A 3FIDA 1KZXA 1W4TA 5FENA 4A60A 2ZAGA 4D6BA 4Y59A 4ZR2A 1B4MA 3E3CA 2CBRA 2NNQA 3APVA 4XMFA 5B5GA 1JJUA 1VWJB 4JO6A 1AVDA 2QCBA 1CBRA 4OS3A 4ZHGA 1EIIA 2BS6A 5EDCA 4EDEA 1VWIB 3WJDA 4OKAA 4FBOA 1LIDA 4IAXA 3ZW1B 2AT6X 2MF6A 2CM4A 1QG5A 3K3LA 4BX7A 3T1DA 3BSZE 4JGLA 5BYPA 5KIDA 4IRWA 4ZHCA 2GJ5A 2UZ2A 4YFPA 3RDMA 1YUPA 5LJCA 3FDCA 3STNA 2CZTA 3T2XA 1K24A 5F2BA 3PEDA 1S44A 5HCCC 3P02A 4LZUA 4KH8A 3FA8A 5CE4A 4O9SA 1SWGA 2L68A 2X55A 2A2GA 3RE6A 4XMGA 4ES7A 2YMSA 1MOYA 3FR2A 1E00A 2LB6A 3FW5A 3HK1A 4CPHA 1QY2A 1U0XA 1JBHA 1SWQA 3APXA 1T8VA 1CBSA 3FR5A 3P6EA 4YFRA 1BSQA 2AT5X 2Q9SA 1SRGA 4MVIA 1OBUA 1Y55X 2ACPX 3VG7A 4ORYA 4WBKA 1RXHA 2BS5A 2AMMX 1O8VA 1RLBE 2BHVA 3PDFA 3RY2A 3P6GA 2Z4IA 4ZHDA 1Y0GA 4L3RA 3BDRA 1YWCA 1ICNA 2X45A 3EC5A 1RBPA 1KFFA 2LBAA 2OVEA 3P6DA 5EEDA 2FGSA 5FQ6E 3EW2A 3NQ9A 1U17A 4YH0A 5AJCA 2EU7X 5LJEA 2RTIB 3FYFA 4O3XB 1RSUB 2F73A 2OF8A 1DZMA 2BC3A 4IMNA 1SWHA 3FA9A 3C78X 2A0AA 3T2WA 2IZHB 4AZPA 1G5WA 1I78A 4LQZA 4OMXA 1T0VA 3NP1A 1QFVA 2W2AA 1FDQA 1LKEA 4OELA 2R74A 1VWQB 2KTSA 2HNXA 3O2YA 1SWTA 3APUA 1HMSA 4M7MA 3B2HA 2LFOA 1YP6A 4QRLA 2CAMA 3VE1A 3CKGA 1YWAA 1SA8A 2OL8O 2HLVA 2IZFB 3BLGA 4A8ZA 2RTAA 4KC8A 3UEUA 3IFBA 2WSJA 4ORUA 3RDQA 4A1YA 1U18A 1E2TA 1FEMA 3P6FA 4GRJA 4MIRA 1LICA 1JV4A 3QKGA 2G5LA 3BU1A 1BSYA 3NBXX 1UYNX 4COTA 1GX3A 1QY1A 1MDCA 1NGLA 4YGGA 5FAZA 2X8FA 5D48A 4I9RA 1GT5A 4CPHB 4MVKA 1BLRA 4BX6A 2RTLA 1STSB 1G74A 5IO6A 3P24A 4Y0PA 5EZ2A 1LDOA 2Q2PA 1KQWA 3OD9A 3AKMA 5F6ZA 2DJFA 3UEWA 4GGZA 3SLJA 1B56A 2DJGA 4XMEA 2YG2A 1Y9LA 1SRFA 4Z2PA 1MM9A 3BU9A 4U9CA 2JN3A 3MM0A 4LKTA 3FA6A 2C4IA 2IZGB 1IFBA 1KT3A 2OFBA 2RQ0A 4XMCA 2NNEA 4GE1A 1EI5A 3EBWA 5H9LA 4EEJA 3FEKA 5HTEA 3WZNA 3NX1A 3NR3A 1CBQA 4AZQA 4DQ4A 2A3FX 1MX7A 1RAVA 3CBCA 1TXLA 2A5CA 3ELXA 2IZBA 4ODDA 1N9MA 2CZUA 3NADA 4YKMA 2FHNX 4XMDA 4QQ1A 1T68X 3ZW0A 1Y53X 1FJ1E 2K23A 3KFGA 1GKAB 3HWFA 2RTGB 1KT5A 1WUBA 4ORSA 5HTDA 1NQNA 1E06A 1I06A 4I9SA 5KHPA 2X34A 4QYPA 4ZHHA 3CR6A 3B2LA 4QYNA 4GK9A 5IO7A 1VYGA 2WR6A 1ZNHA 1LUQA 3VHIA 1E5PA 1VWBB 1X89A 1YWDA 4GZVA 4O3WA 1MUPA 4HWMA 1SREA 2GTLO 4DNEA 1HXZA 1TW4A 1Z24A 2Z4HA 4GGRA 3PH5A 4I6SA 1QWDA 2C1SA 5B2AO 4HFOA 2LKKA 3MX7A 4IB9A 2Y3EA 3TGAA 3WBGA 2DM5A 1BRPA 5HA0A 3FELA 4CPEA 1AELA 2JGSA 3PH6A 4ZCBA 2IZAA 2X46A 1HMTA 4PJ2A 1DF3A 3APWA 2AVIA 1SXXA 4NV7A 2RTFB 2HYSA 4OS0A 1CRBA 1JJXA 5H9KA 5K68A 3D9WA 5HZ8A 4IABA 5CYBA 2HKDA 3WVMA 1MX8A 5HZ5A 1KT6A 1VWEB 5EDBA 4ZGFA 1BEBA 3ZQ3A 4YDBA 2CM9A 1RSTB 2WEXA 2XSTA 3VGWA 1BM5A 5D4AA 4NV8A 1EIOA 2RTBB 5HAEA 3CQNA 2IZCB 3RDOA 3U9PC 4Z2OA 1NC9A 4ZH6A 2GTLN 5B3MO 5FFHA 1STPA 4O4SA 1BBPA 2ANSA 4TKJA 4EXZA 3ZW0B 4ORRA 3BX7A 3MVFA 3AEHA 3HOLA 1N43A 2RTPB 1IW2A 2ASNX 2Q4NA 3B2JA 2BLGA 2IFBA 2WQ9A 2KD2A 3WOVA 2A2UA 3EM0A 2G8CO 5B29A 5LJBA 2QO4A 4AW8A 5IRUA 3KVNA 1NP4A 3SZIA 4AYHA 2LA7A 5D8JA 4R0BA 5L8IA 1X8OA 4Z27A 1ZNGA 5LKFA 1XCAA 5EPQA 2KTDA 3NQKA 2L5PA 3SAOA 1HQQA 1LDQA 3UEXA 3WZOA 1MVGA 2L9CA 2OF9A 3PPTA 3LTWA 1LIEA 2OFRX 4I3BA 4BX5A 3MG5A 2HZRA 4OS8A 4ARHA 2AF5A 1KL5A 1D2UA 1S7DA 1SLEB 3CKFA 1ZRYA 2MHDA 2C1QA 3ZUOA 4CDEA 5H9NA 3KFHA 2RTJA 1BSOA 4CPIA 2JU3A 4GNYA 3RBYA 4MISA 3EW1A 1SWDA 3HPEA 3WJFA 4ORWA 1GXAA 1JMXA 3BY0A 3FMZA 3WJBA 2GH7A 1UREA 2FTBA 2QM9A 4I60A 4INNA 2FKGA 3SLOA 4FBVA 4FBRA 1SRIA 1VWMB 4ON1A 2KT4B 1WBIA 3G7XA 1ERXA 2IZKA 1SLFB 1AB0A 4M6SA 4KCAA 2X56A 4ZFXA 3WJEA 3EMMA 1SY0A 4BVMA 2RTDB 4ORXA 4BX7B 1BJ7A 1VWDB 2KW1A 4NLIA 3TGBA 2BT9A 4KIIA 1UZ2X 2AKQA 2X8TA 5EEEA 1ZNLA 5BVSA 1IKJA 1SRJA 1EQDA 3B2IA 4GDZA 1KL3A 4AZMA 2FKJA 1SMPI 2RTQB 4IB7A 4ZH9A 1S2PA 1OEEA 3NQ3A 3ELZA 3C76X 1SXWA 3FR4A 4GGTA 4ZHFA 1BWYA 3KQ0A 1SLGB 2FRSA 2RTCB 1QFTA 3GAQA 4GETA 4NYRA 4UU2A 4YCEA 3AKNA 5AEOA 1QY0A 4TJZA 2I5VO 3TZSA 1OBPA 1HMRA 1ML7A 1SY1A 1VYFA 2QOMA 5F6BA 2M4LA 4BX5B 3S60A 1SWKA 3VU1A 3D96A 4Y0RA 1X8QA 4TQ2A 2RCTA 3WYQA 5IRWA 2WWPA 1CBIA 1YP7A 3PK2A 4U8UM 4TKBA 5B11O 1LCZA 2RTEB 3S5XA 2RCQA 1VWRB 3RY1A 5AQ6A 2OVAA 4GNWA 1ACDA 3SZHA 5HBSA 1SWLA 2NP1A 5D47A 4O4UA 1LIBA 1RXKA 1PBYA 2FR2A 1JQPA 2N93A 2AT8X 1QABE 2A13A 4K19A 3VG4A 3LHNA 1LPJA 1YWBA 5JR8A 3PQUA 1AQBA 5L3YA 3VG2A 5HZ9A 5AJBA 4IB8A 1KL4A 3CQRA 4ZGUA 3O19A 2WQAE 4QGVA 1EUOA 2E4JA 3T6FA 3WZPA 2JMBA 4CDDA 3EYCA 1N4JA 1MK5A 4HPDA 3RDUA 1UYOX 1OPAA 3VG3A 3IA8A 2RTKA 3WXQA 3PECA 1VWLB 3PP6A 5LJHA 2MJIA 3JQOA 2VFCA 2Y32A 3RKGA 2RTRB 4NLJA 3O22A 5D45A 5LJGA 4LKPA 3T6LA 1IJ8A 5IRAA 3UEVA 3HTYA 5BVTA 3C77X 2L67A 3FA7A 1P6PA 4WHIA 2RTOB 3U0DA 2OY7A 2RN4A 2VDFA 1KT4A 3HWDA 1IKEA 1KOIA 2OL7A 1STRB 4U8UO 1N7YA 3EBKA 1IIUA 3U03A 3WJCA 4BX6B 3F8AA 4JHQA 4EQAC 2ALLX 2GTFX 3D97A 4ALBA 2OY5O 4YGHA 4CDFA 3NX2A 3Q6LA 1VWHB 2AH7X 4DQ3A 4YCHA 3FW4A 3ZW1A 4OEMA 4O3ZA 4UU3A 1DZKA 2IZIA 2OVSA 1TOWA 1SWCA 1VWCB 5FQ7E 1VWOB 2HZQA 5FQ8E 4IB6A 3RZYA 3SOTA 5K06A 3X00A 4BQUA 1ALBA 4Z6JA 2F01A 5B27A 1A2DA 3F9DA 4NP1A 4O4OA 3CBSA 2ZSCA 2RD7C 5B10O 3VHMA 1GGLA 1N0SA 1FENA 1SWPA 1OPBA 3KFIA 2QOSC 1VWFB 2IZJA 1LFOA
chains in the Genus database with same CATH topology
4Y5DA 2RTJA 1MEPA 2G5LA 1SWBA 1LCVA 4CPIA 3EW1A 1SWDA 1SRHA 1I9HA 1SWNA 4GD9A 2IZDB 1VWNB 2GH7A 4U46A 4I60A 3VHHA 4CPHB 4BX6A 4Z2VA 2RTLA 1STSB 1SLDB 2IZJA 1SRIA 1VWMB 2IZLB 5JD2A 4Z27A 1LDOA 3SZJA 1WBIA 2IZEB 2IZKA 5CHKA 4EKVA 1HY2A 1SLFB 4GGZA 1SWEA 5K67A 4GJVA 1SWSA 4Z2PA 2RTDB 4YVBA 1SRFA 4Z28A 4BX7B 3RDXA 1MM9A 1VWDB 3MM0A 1SWJA 2C4IA 2IZGB 1SRJA 2FHLA 2OFBA 1KL3A 1AVEA 2RTQB 3WZNA 3WYPA 1SWFA 1VWKB 4GGTA 2UYWA 1RAVA 2A5CA 1SLGB 2IZBA 1N9MA 2RTCB 3WZQA 2FHNX 2RTMA 2Y3FA 1Y53X 4BBOA 4BX5B 2RTGB 4Y59A 5B5FA 4CPFA 1SWKA 1RXJA 1NQNA 4BCSA 5B5GA 2RTNB 3WYQA 5IRWA 3PK2A 1LCZA 2RTHB 2RTEB 1LUQA 3RE5A 3VHIA 1VWJB 4JO6A 1AVDA 1VWBB 1VWRB 2QCBA 3RY1A 1VWPB 3RDSA 1PTSA 1SREA 1VWIB 4OKAA 3SZHA 1HXZA 1SWLA 4DNEA 1RXKA 2MF6A 1SWUA 4GGRA 4JNJA 4BX7A 4GJSA 2C1SA 4IRWA 2Y3EA 2UZ2A 3RDMA 4CPEA 5L3YA 2JGSA 3FDCA 3T2XA 2IZAA 1KL4A 1NQMA 5F2BA 2A8GA 2AVIA 3T6FA 1VWGB 3WZPA 2RTFB 1NDJA 1N4JA 1MK5A 1SWGA 3RDUA 5CSEA 1N9YA 3RE6A 5K68A 2RTKA 1VWLB 1SWRA 1VWAB 1HXLA 1MOYA 2Y32A 1VWEB 2RTRB 4CPHA 3T6LA 1RSTB 1SWQA 3VGWA 1IJ8A 5IRAA 2RTBB 1SRGA 2OFAA 2RTOB 1DF8A 1SWAA 1Y55X 2IZCB 3RDOA 4Z2OA 1NC9A 1RXHA 3RY2A 1NBXA 1STPA 1STRB 1N7YA 1LELA 4BX6B 4JHQA 1N43A 1KFFA 2RTPB 1VWHB 3EW2A 1SWOA 2WPUA 2RTIB 5IRUA 3SZIA 4BJ8A 1RSUB 2IZIA 1VWCB 1SWCA 2OF8A 2BC3A 2A5BA 1SWHA 1VWOB 3T2WA 4GDAA 2IZHB 1HQQA 1LDQA 1VYOA 1Y52X 3X00A 3WZOA 2OF9A 4Z6JA 1VWQB 2F01A 1SWTA 2ZSCA 1LCWA 2CAMA 3VHMA 4BX5A 3MG5A 2IZFB 1SWPA 2RTAA 1KL5A 1SLEB 3RDQA 1VWFB 2C1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5D A;  2RTJ A;  1MEP A;  2G5L A;  1SWB A;  1LCV A;  4CPI A;  3EW1 A;  1SWD A;  1SRH A;  1I9H A;  1SWN A;  4GD9 A;  2IZD B;  1VWN B;  2GH7 A;  4U46 A;  4I60 A;  3VHH A;  4CPH B;  4BX6 A;  4Z2V A;  2RTL A;  1STS B;  1SLD B;  2IZJ A;  1SRI A;  1VWM B;  2IZL B;  5JD2 A;  4Z27 A;  1LDO A;  3SZJ A;  1WBI A;  2IZE B;  2IZK A;  5CHK A;  4EKV A;  1HY2 A;  1SLF B;  4GGZ A;  1SWE A;  5K67 A;  4GJV A;  1SWS A;  4Z2P A;  2RTD B;  4YVB A;  1SRF A;  4Z28 A;  4BX7 B;  3RDX A;  1MM9 A;  1VWD B;  3MM0 A;  1SWJ A;  2C4I A;  2IZG B;  1SRJ A;  2FHL A;  2OFB A;  1KL3 A;  1AVE A;  2RTQ B;  3WZN A;  3WYP A;  1SWF A;  1VWK B;  4GGT A;  2UYW A;  1RAV A;  2A5C A;  1SLG B;  2IZB A;  1N9M A;  2RTC B;  3WZQ A;  2FHN X;  2RTM A;  2Y3F A;  1Y53 X;  4BBO A;  4BX5 B;  2RTG B;  4Y59 A;  5B5F A;  4CPF A;  1SWK A;  1RXJ A;  1NQN A;  4BCS A;  5B5G A;  2RTN B;  3WYQ A;  5IRW A;  3PK2 A;  1LCZ A;  2RTH B;  2RTE B;  1LUQ A;  3RE5 A;  3VHI A;  1VWJ B;  4JO6 A;  1AVD A;  1VWB B;  1VWR B;  2QCB A;  3RY1 A;  1VWP B;  3RDS A;  1PTS A;  1SRE A;  1VWI B;  4OKA A;  3SZH A;  1HXZ A;  1SWL A;  4DNE A;  1RXK A;  2MF6 A;  1SWU A;  4GGR A;  4JNJ A;  4BX7 A;  4GJS A;  2C1S A;  4IRW A;  2Y3E A;  2UZ2 A;  3RDM A;  4CPE A;  5L3Y A;  2JGS A;  3FDC A;  3T2X A;  2IZA A;  1KL4 A;  1NQM A;  5F2B A;  2A8G A;  2AVI A;  3T6F A;  1VWG B;  3WZP A;  2RTF B;  1NDJ A;  1N4J A;  1MK5 A;  1SWG A;  3RDU A;  5CSE A;  1N9Y A;  3RE6 A;  5K68 A;  2RTK A;  1VWL B;  1SWR A;  1VWA B;  1HXL A;  1MOY A;  2Y32 A;  1VWE B;  2RTR B;  4CPH A;  3T6L A;  1RST B;  1SWQ A;  3VGW A;  1IJ8 A;  5IRA A;  2RTB B;  1SRG A;  2OFA A;  2RTO B;  1DF8 A;  1SWA A;  1Y55 X;  2IZC B;  3RDO A;  4Z2O A;  1NC9 A;  1RXH A;  3RY2 A;  1NBX A;  1STP A;  1STR B;  1N7Y A;  1LEL A;  4BX6 B;  4JHQ A;  1N43 A;  1KFF A;  2RTP B;  1VWH B;  3EW2 A;  1SWO A;  2WPU A;  2RTI B;  5IRU A;  3SZI A;  4BJ8 A;  1RSU B;  2IZI A;  1VWC B;  1SWC A;  2OF8 A;  2BC3 A;  2A5B A;  1SWH A;  1VWO B;  3T2W A;  4GDA A;  2IZH B;  1HQQ A;  1LDQ A;  1VYO A;  1Y52 X;  3X00 A;  3WZO A;  2OF9 A;  4Z6J A;  1VWQ B;  2F01 A;  1SWT A;  2ZSC A;  1LCW A;  2CAM A;  3VHM A;  4BX5 A;  3MG5 A;  2IZF B;  1SWP A;  2RTA A;  1KL5 A;  1SLE B;  3RDQ A;  1VWF B;  2C1Q A; 
#chains in the Genus database with same CATH topology
 2OY8 A;  4Y5D A;  3RWX A;  4U8U N;  1BRQ A;  4I95 A;  1LCV A;  2R73 A;  5LKE A;  1LIF A;  1SRH A;  4GH7 A;  4NNS A;  5HWZ A;  1DV9 A;  1GX8 A;  1L6M A;  3AUM O;  1O1V A;  1VWN B;  2QO5 A;  2W2B A;  4U46 A;  1G7N A;  3S26 A;  3S5V A;  5C0N A;  1IFC A;  4XMH A;  4LZV A;  4Z2V A;  2XKL A;  1A18 A;  1SLD B;  2PY1 A;  4FQB B;  5IO5 A;  2FS7 A;  1JJJ A;  2K62 A;  5IXG A;  2OFM X;  4YKO A;  2MM3 A;  2IZE B;  4EKV A;  5CHK A;  1HY2 A;  4ID2 A;  1LNM A;  1EXS A;  1GM6 A;  1SWE A;  1QQS A;  4ZJ0 A;  1E02 A;  4TNN A;  1DZJ A;  4YVB A;  1G85 A;  1PM1 X;  3RDX A;  5F1E A;  1O1U A;  1DZP A;  1B8E A;  3BS2 A;  3P6C A;  1XKI A;  4WFU A;  1DFV A;  2FHL A;  4I3D A;  4O49 A;  4QGX A;  4YGZ A;  5HZ6 A;  2JU7 A;  4RUU A;  1EAL A;  2O62 A;  4CSB A;  4MVL A;  1KT7 A;  2OYB O;  2UYW A;  4NYQ A;  4QGW A;  1YIV A;  4MVE A;  3WZQ A;  2WUT A;  4YFQ A;  3DSZ A;  2RTM A;  1SY3 A;  3JS1 A;  4PSQ A;  2Y3F A;  3CMP A;  3ZZV A;  4QAE A;  4BBO A;  3MBT A;  5B5F A;  4CPF A;  1RXJ A;  4CV7 A;  4BCS A;  4A1H A;  3KFF A;  2RTN B;  4N7D A;  4YDA A;  4ML7 B;  4RUN A;  2RA6 A;  2RTH B;  3RE5 A;  1JIW I;  2JOZ A;  3CWK A;  2FWV A;  1VWP B;  3RDS A;  1PTS A;  3I17 A;  5L8O A;  1PMP A;  1KGL A;  1I05 A;  4Y0Q A;  3VE2 A;  1SXU A;  3I0A A;  4HPC A;  1GX9 A;  1OBQ A;  1SWU A;  3JSQ A;  4JNJ A;  1DC9 A;  1KQX A;  2FT9 A;  4GJS A;  1TVQ A;  2MWH A;  3HOE A;  4D6A A;  2X32 A;  2R56 A;  2QO6 A;  1PEE A;  3L4R A;  2P8G A;  3PQS A;  1OEK A;  4B55 A;  1HBP A;  2JW1 A;  1NQM A;  1PBO A;  1R0U A;  2A8G A;  3KZA A;  3STM X;  3STK A;  2W2F A;  1K3B A;  1LF7 A;  4NNT A;  1VWG B;  1HQP A;  3N91 A;  1NDJ A;  5CSE A;  1A3Y A;  1N9Y A;  1X8U A;  2HMB A;  4GU8 A;  4HPB A;  4KT5 A;  1SWR A;  4AZN A;  1VWA B;  1HXL A;  2Q2M A;  1H91 A;  2ZAI A;  3SLT A;  4C5P A;  3TF6 A;  1GKA A;  3UAQ A;  1Y9T A;  2NND A;  2Q39 A;  2VFB A;  5H8T A;  3HWE A;  3VG6 A;  3OJY C;  5L8N A;  3TGC A;  4EFG A;  2OFA A;  1ICM A;  1DF8 A;  1SWA A;  2PI3 O;  2X4M A;  3B2K A;  2AL0 X;  3OBL A;  4QZU A;  5BVQ A;  1NBX A;  2MO5 A;  1VPR A;  1ZNK A;  1LEL A;  1CJ5 A;  2QMI A;  1FEL A;  1ADL A;  2I5Z O;  1ERB A;  4ALO A;  1GT4 A;  4KC7 A;  5HA1 A;  4GKC A;  4HPA A;  1SWO A;  3FEP A;  4CK4 A;  1GT3 A;  4YBU A;  2OVD A;  2CBS A;  2WPU A;  4YBP A;  4BJ8 A;  3NPO A;  1OSP O;  4AZO A;  1JMZ A;  1SXY A;  2A5B A;  4IBA A;  4TLJ A;  5KIC A;  2GTL M;  4GDA A;  3ZW2 A;  4I3C A;  4IAW A;  3OE3 A;  1HN2 A;  1SY2 A;  2GC9 A;  3QQ2 A;  1VYO A;  1Y52 X;  2AT0 X;  3BRN A;  3D95 A;  1AVG I;  2X8S A;  3DTQ A;  4QNI A;  2G7B A;  5DG4 A;  1LCW A;  2G78 A;  5LJD A;  2ACO A;  4OMW A;  1FTP A;  1KZW A;  3D4R A;  3ZWE A;  4BGF A;  4WFV A;  2AT3 X;  3BX8 A;  1EW3 A;  1MEP A;  1SWB A;  3FEN A;  4IMO A;  2F09 A;  1JYJ A;  3RSW A;  1GT1 A;  1I9H A;  1SWN A;  4U3Q A;  2LBV A;  4N7C A;  5H9A A;  1OEJ A;  4BOE A;  4GD9 A;  2IZD B;  1NP1 A;  4GUZ A;  1FE3 A;  4FGI B;  4L1N A;  3WJG A;  3VHH A;  4Y0S A;  3HWG A;  5HZQ A;  2OY1 O;  1I04 A;  2G79 A;  2IZL B;  2WEW A;  4MEE A;  5JD2 A;  2OL6 O;  3SZJ A;  3VG5 A;  3ZI8 A;  1D3S A;  1W6F A;  1A57 A;  3FLL A;  5DPQ A;  3F6Z B;  4DCB A;  1I4U A;  4NW4 A;  5K67 A;  4GJV A;  1JYD A;  2FS6 A;  3GE2 A;  5F7G A;  1SWS A;  5HCE C;  3FIQ A;  3LV4 A;  4Z28 A;  1JZU A;  2POA A;  1SWJ A;  2FLJ A;  5LJK A;  4AZR A;  5HCD C;  2JU8 A;  3Q34 A;  1AVE A;  3ZUI A;  1HBQ A;  4O3Y A;  1TOU A;  2BSZ A;  3WYP A;  1EPA A;  1B0O A;  1X8N A;  4O4X A;  1SWF A;  1EPB A;  1VWK B;  5F58 A;  3H3I A;  4CDC A;  3V8U A;  3P6H A;  2FR3 A;  3VPJ E;  1ZNE A;  2OZQ A;  1KXO A;  4QZT A;  4YMY A;  1X8P A;  1ZND A;  4TKH A;  1W5R A;  1X71 A;  3FID A;  1KZX A;  1W4T A;  5FEN A;  4A60 A;  2ZAG A;  4D6B A;  4Y59 A;  4ZR2 A;  1B4M A;  3E3C A;  2CBR A;  2NNQ A;  3APV A;  4XMF A;  5B5G A;  1JJU A;  1VWJ B;  4JO6 A;  1AVD A;  2QCB A;  1CBR A;  4OS3 A;  4ZHG A;  1EII A;  2BS6 A;  5EDC A;  4EDE A;  1VWI B;  3WJD A;  4OKA A;  4FBO A;  1LID A;  4IAX A;  3ZW1 B;  2AT6 X;  2MF6 A;  2CM4 A;  1QG5 A;  3K3L A;  4BX7 A;  3T1D A;  3BSZ E;  4JGL A;  5BYP A;  5KID A;  4IRW A;  4ZHC A;  2GJ5 A;  2UZ2 A;  4YFP A;  3RDM A;  1YUP A;  5LJC A;  3FDC A;  3STN A;  2CZT A;  3T2X A;  1K24 A;  5F2B A;  3PED A;  1S44 A;  5HCC C;  3P02 A;  4LZU A;  4KH8 A;  3FA8 A;  5CE4 A;  4O9S A;  1SWG A;  2L68 A;  2X55 A;  2A2G A;  3RE6 A;  4XMG A;  4ES7 A;  2YMS A;  1MOY A;  3FR2 A;  1E00 A;  2LB6 A;  3FW5 A;  3HK1 A;  4CPH A;  1QY2 A;  1U0X A;  1JBH A;  1SWQ A;  3APX A;  1T8V A;  1CBS A;  3FR5 A;  3P6E A;  4YFR A;  1BSQ A;  2AT5 X;  2Q9S A;  1SRG A;  4MVI A;  1OBU A;  1Y55 X;  2ACP X;  3VG7 A;  4ORY A;  4WBK A;  1RXH A;  2BS5 A;  2AMM X;  1O8V A;  1RLB E;  2BHV A;  3PDF A;  3RY2 A;  3P6G A;  2Z4I A;  4ZHD A;  1Y0G A;  4L3R A;  3BDR A;  1YWC A;  1ICN A;  2X45 A;  3EC5 A;  1RBP A;  1KFF A;  2LBA A;  2OVE A;  3P6D A;  5EED A;  2FGS A;  5FQ6 E;  3EW2 A;  3NQ9 A;  1U17 A;  4YH0 A;  5AJC A;  2EU7 X;  5LJE A;  2RTI B;  3FYF A;  4O3X B;  1RSU B;  2F73 A;  2OF8 A;  1DZM A;  2BC3 A;  4IMN A;  1SWH A;  3FA9 A;  3C78 X;  2A0A A;  3T2W A;  2IZH B;  4AZP A;  1G5W A;  1I78 A;  4LQZ A;  4OMX A;  1T0V A;  3NP1 A;  1QFV A;  2W2A A;  1FDQ A;  1LKE A;  4OEL A;  2R74 A;  1VWQ B;  2KTS A;  2HNX A;  3O2Y A;  1SWT A;  3APU A;  1HMS A;  4M7M A;  3B2H A;  2LFO A;  1YP6 A;  4QRL A;  2CAM A;  3VE1 A;  3CKG A;  1YWA A;  1SA8 A;  2OL8 O;  2HLV A;  2IZF B;  3BLG A;  4A8Z A;  2RTA A;  4KC8 A;  3UEU A;  3IFB A;  2WSJ A;  4ORU A;  3RDQ A;  4A1Y A;  1U18 A;  1E2T A;  1FEM A;  3P6F A;  4GRJ A;  4MIR A;  1LIC A;  1JV4 A;  3QKG A;  2G5L A;  3BU1 A;  1BSY A;  3NBX X;  1UYN X;  4COT A;  1GX3 A;  1QY1 A;  1MDC A;  1NGL A;  4YGG A;  5FAZ A;  2X8F A;  5D48 A;  4I9R A;  1GT5 A;  4CPH B;  4MVK A;  1BLR A;  4BX6 A;  2RTL A;  1STS B;  1G74 A;  5IO6 A;  3P24 A;  4Y0P A;  5EZ2 A;  1LDO A;  2Q2P A;  1KQW A;  3OD9 A;  3AKM A;  5F6Z A;  2DJF A;  3UEW A;  4GGZ A;  3SLJ A;  1B56 A;  2DJG A;  4XME A;  2YG2 A;  1Y9L A;  1SRF A;  4Z2P A;  1MM9 A;  3BU9 A;  4U9C A;  2JN3 A;  3MM0 A;  4LKT A;  3FA6 A;  2C4I A;  2IZG B;  1IFB A;  1KT3 A;  2OFB A;  2RQ0 A;  4XMC A;  2NNE A;  4GE1 A;  1EI5 A;  3EBW A;  5H9L A;  4EEJ A;  3FEK A;  5HTE A;  3WZN A;  3NX1 A;  3NR3 A;  1CBQ A;  4AZQ A;  4DQ4 A;  2A3F X;  1MX7 A;  1RAV A;  3CBC A;  1TXL A;  2A5C A;  3ELX A;  2IZB A;  4ODD A;  1N9M A;  2CZU A;  3NAD A;  4YKM A;  2FHN X;  4XMD A;  4QQ1 A;  1T68 X;  3ZW0 A;  1Y53 X;  1FJ1 E;  2K23 A;  3KFG A;  1GKA B;  3HWF A;  2RTG B;  1KT5 A;  1WUB A;  4ORS A;  5HTD A;  1NQN A;  1E06 A;  1I06 A;  4I9S A;  5KHP A;  2X34 A;  4QYP A;  4ZHH A;  3CR6 A;  3B2L A;  4QYN A;  4GK9 A;  5IO7 A;  1VYG A;  2WR6 A;  1ZNH A;  1LUQ A;  3VHI A;  1E5P A;  1VWB B;  1X89 A;  1YWD A;  4GZV A;  4O3W A;  1MUP A;  4HWM A;  1SRE A;  2GTL O;  4DNE A;  1HXZ A;  1TW4 A;  1Z24 A;  2Z4H A;  4GGR A;  3PH5 A;  4I6S A;  1QWD A;  2C1S A;  5B2A O;  4HFO A;  2LKK A;  3MX7 A;  4IB9 A;  2Y3E A;  3TGA A;  3WBG A;  2DM5 A;  1BRP A;  5HA0 A;  3FEL A;  4CPE A;  1AEL A;  2JGS A;  3PH6 A;  4ZCB A;  2IZA A;  2X46 A;  1HMT A;  4PJ2 A;  1DF3 A;  3APW A;  2AVI A;  1SXX A;  4NV7 A;  2RTF B;  2HYS A;  4OS0 A;  1CRB A;  1JJX A;  5H9K A;  5K68 A;  3D9W A;  5HZ8 A;  4IAB A;  5CYB A;  2HKD A;  3WVM A;  1MX8 A;  5HZ5 A;  1KT6 A;  1VWE B;  5EDB A;  4ZGF A;  1BEB A;  3ZQ3 A;  4YDB A;  2CM9 A;  1RST B;  2WEX A;  2XST A;  3VGW A;  1BM5 A;  5D4A A;  4NV8 A;  1EIO A;  2RTB B;  5HAE A;  3CQN A;  2IZC B;  3RDO A;  3U9P C;  4Z2O A;  1NC9 A;  4ZH6 A;  2GTL N;  5B3M O;  5FFH A;  1STP A;  4O4S A;  1BBP A;  2ANS A;  4TKJ A;  4EXZ A;  3ZW0 B;  4ORR A;  3BX7 A;  3MVF A;  3AEH A;  3HOL A;  1N43 A;  2RTP B;  1IW2 A;  2ASN X;  2Q4N A;  3B2J A;  2BLG A;  2IFB A;  2WQ9 A;  2KD2 A;  3WOV A;  2A2U A;  3EM0 A;  2G8C O;  5B29 A;  5LJB A;  2QO4 A;  4AW8 A;  5IRU A;  3KVN A;  1NP4 A;  3SZI A;  4AYH A;  2LA7 A;  5D8J A;  4R0B A;  5L8I A;  1X8O A;  4Z27 A;  1ZNG A;  5LKF A;  1XCA A;  5EPQ A;  2KTD A;  3NQK A;  2L5P A;  3SAO A;  1HQQ A;  1LDQ A;  3UEX A;  3WZO A;  1MVG A;  2L9C A;  2OF9 A;  3PPT A;  3LTW A;  1LIE A;  2OFR X;  4I3B A;  4BX5 A;  3MG5 A;  2HZR A;  4OS8 A;  4ARH A;  2AF5 A;  1KL5 A;  1D2U A;  1S7D A;  1SLE B;  3CKF A;  1ZRY A;  2MHD A;  2C1Q A;  3ZUO A;  4CDE A;  5H9N A;  3KFH A;  2RTJ A;  1BSO A;  4CPI A;  2JU3 A;  4GNY A;  3RBY A;  4MIS A;  3EW1 A;  1SWD A;  3HPE A;  3WJF A;  4ORW A;  1GXA A;  1JMX A;  3BY0 A;  3FMZ A;  3WJB A;  2GH7 A;  1URE A;  2FTB A;  2QM9 A;  4I60 A;  4INN A;  2FKG A;  3SLO A;  4FBV A;  4FBR A;  1SRI A;  1VWM B;  4ON1 A;  2KT4 B;  1WBI A;  3G7X A;  1ERX A;  2IZK A;  1SLF B;  1AB0 A;  4M6S A;  4KCA A;  2X56 A;  4ZFX A;  3WJE A;  3EMM A;  1SY0 A;  4BVM A;  2RTD B;  4ORX A;  4BX7 B;  1BJ7 A;  1VWD B;  2KW1 A;  4NLI A;  3TGB A;  2BT9 A;  4KII A;  1UZ2 X;  2AKQ A;  2X8T A;  5EEE A;  1ZNL A;  5BVS A;  1IKJ A;  1SRJ A;  1EQD A;  3B2I A;  4GDZ A;  1KL3 A;  4AZM A;  2FKJ A;  1SMP I;  2RTQ B;  4IB7 A;  4ZH9 A;  1S2P A;  1OEE A;  3NQ3 A;  3ELZ A;  3C76 X;  1SXW A;  3FR4 A;  4GGT A;  4ZHF A;  1BWY A;  3KQ0 A;  1SLG B;  2FRS A;  2RTC B;  1QFT A;  3GAQ A;  4GET A;  4NYR A;  4UU2 A;  4YCE A;  3AKN A;  5AEO A;  1QY0 A;  4TJZ A;  2I5V O;  3TZS A;  1OBP A;  1HMR A;  1ML7 A;  1SY1 A;  1VYF A;  2QOM A;  5F6B A;  2M4L A;  4BX5 B;  3S60 A;  1SWK A;  3VU1 A;  3D96 A;  4Y0R A;  1X8Q A;  4TQ2 A;  2RCT A;  3WYQ A;  5IRW A;  2WWP A;  1CBI A;  1YP7 A;  3PK2 A;  4U8U M;  4TKB A;  5B11 O;  1LCZ A;  2RTE B;  3S5X A;  2RCQ A;  1VWR B;  3RY1 A;  5AQ6 A;  2OVA A;  4GNW A;  1ACD A;  3SZH A;  5HBS A;  1SWL A;  2NP1 A;  5D47 A;  4O4U A;  1LIB A;  1RXK A;  1PBY A;  2FR2 A;  1JQP A;  2N93 A;  2AT8 X;  1QAB E;  2A13 A;  4K19 A;  3VG4 A;  3LHN A;  1LPJ A;  1YWB A;  5JR8 A;  3PQU A;  1AQB A;  5L3Y A;  3VG2 A;  5HZ9 A;  5AJB A;  4IB8 A;  1KL4 A;  3CQR A;  4ZGU A;  3O19 A;  2WQA E;  4QGV A;  1EUO A;  2E4J A;  3T6F A;  3WZP A;  2JMB A;  4CDD A;  3EYC A;  1N4J A;  1MK5 A;  4HPD A;  3RDU A;  1UYO X;  1OPA A;  3VG3 A;  3IA8 A;  2RTK A;  3WXQ A;  3PEC A;  1VWL B;  3PP6 A;  5LJH A;  2MJI A;  3JQO A;  2VFC A;  2Y32 A;  3RKG A;  2RTR B;  4NLJ A;  3O22 A;  5D45 A;  5LJG A;  4LKP A;  3T6L A;  1IJ8 A;  5IRA A;  3UEV A;  3HTY A;  5BVT A;  3C77 X;  2L67 A;  3FA7 A;  1P6P A;  4WHI A;  2RTO B;  3U0D A;  2OY7 A;  2RN4 A;  2VDF A;  1KT4 A;  3HWD A;  1IKE A;  1KOI A;  2OL7 A;  1STR B;  4U8U O;  1N7Y A;  3EBK A;  1IIU A;  3U03 A;  3WJC A;  4BX6 B;  3F8A A;  4JHQ A;  4EQA C;  2ALL X;  2GTF X;  3D97 A;  4ALB A;  2OY5 O;  4YGH A;  4CDF A;  3NX2 A;  3Q6L A;  1VWH B;  2AH7 X;  4DQ3 A;  4YCH A;  3FW4 A;  3ZW1 A;  4OEM A;  4O3Z A;  4UU3 A;  1DZK A;  2IZI A;  2OVS A;  1TOW A;  1SWC A;  1VWC B;  5FQ7 E;  1VWO B;  2HZQ A;  5FQ8 E;  4IB6 A;  3RZY A;  3SOT A;  5K06 A;  3X00 A;  4BQU A;  1ALB A;  4Z6J A;  2F01 A;  5B27 A;  1A2D A;  3F9D A;  4NP1 A;  4O4O A;  3CBS A;  2ZSC A;  2RD7 C;  5B10 O;  3VHM A;  1GGL A;  1N0S A;  1FEN A;  1SWP A;  1OPB A;  3KFI A;  2QOS C;  1VWF B;  2IZJ A;  1LFO A; 
#chains in the Genus database with same CATH homology
 4Y5D A;  2RTJ A;  1MEP A;  2G5L A;  1SWB A;  1LCV A;  4CPI A;  3EW1 A;  1SWD A;  1SRH A;  1I9H A;  1SWN A;  4GD9 A;  2IZD B;  1VWN B;  2GH7 A;  4U46 A;  4I60 A;  3VHH A;  4CPH B;  4BX6 A;  4Z2V A;  2RTL A;  1STS B;  1SLD B;  2IZJ A;  1SRI A;  1VWM B;  2IZL B;  5JD2 A;  4Z27 A;  1LDO A;  3SZJ A;  1WBI A;  2IZE B;  2IZK A;  5CHK A;  4EKV A;  1HY2 A;  1SLF B;  4GGZ A;  1SWE A;  5K67 A;  4GJV A;  1SWS A;  4Z2P A;  2RTD B;  4YVB A;  1SRF A;  4Z28 A;  4BX7 B;  3RDX A;  1MM9 A;  1VWD B;  3MM0 A;  1SWJ A;  2C4I A;  2IZG B;  1SRJ A;  2FHL A;  2OFB A;  1KL3 A;  1AVE A;  2RTQ B;  3WZN A;  3WYP A;  1SWF A;  1VWK B;  4GGT A;  2UYW A;  1RAV A;  2A5C A;  1SLG B;  2IZB A;  1N9M A;  2RTC B;  3WZQ A;  2FHN X;  2RTM A;  2Y3F A;  1Y53 X;  4BBO A;  4BX5 B;  2RTG B;  4Y59 A;  5B5F A;  4CPF A;  1SWK A;  1RXJ A;  1NQN A;  4BCS A;  5B5G A;  2RTN B;  3WYQ A;  5IRW A;  3PK2 A;  1LCZ A;  2RTH B;  2RTE B;  1LUQ A;  3RE5 A;  3VHI A;  1VWJ B;  4JO6 A;  1AVD A;  1VWB B;  1VWR B;  2QCB A;  3RY1 A;  1VWP B;  3RDS A;  1PTS A;  1SRE A;  1VWI B;  4OKA A;  3SZH A;  1HXZ A;  1SWL A;  4DNE A;  1RXK A;  2MF6 A;  1SWU A;  4GGR A;  4JNJ A;  4BX7 A;  4GJS A;  2C1S A;  4IRW A;  2Y3E A;  2UZ2 A;  3RDM A;  4CPE A;  5L3Y A;  2JGS A;  3FDC A;  3T2X A;  2IZA A;  1KL4 A;  1NQM A;  5F2B A;  2A8G A;  2AVI A;  3T6F A;  1VWG B;  3WZP A;  2RTF B;  1NDJ A;  1N4J A;  1MK5 A;  1SWG A;  3RDU A;  5CSE A;  1N9Y A;  3RE6 A;  5K68 A;  2RTK A;  1VWL B;  1SWR A;  1VWA B;  1HXL A;  1MOY A;  2Y32 A;  1VWE B;  2RTR B;  4CPH A;  3T6L A;  1RST B;  1SWQ A;  3VGW A;  1IJ8 A;  5IRA A;  2RTB B;  1SRG A;  2OFA A;  2RTO B;  1DF8 A;  1SWA A;  1Y55 X;  2IZC B;  3RDO A;  4Z2O A;  1NC9 A;  1RXH A;  3RY2 A;  1NBX A;  1STP A;  1STR B;  1N7Y A;  1LEL A;  4BX6 B;  4JHQ A;  1N43 A;  1KFF A;  2RTP B;  1VWH B;  3EW2 A;  1SWO A;  2WPU A;  2RTI B;  5IRU A;  3SZI A;  4BJ8 A;  1RSU B;  2IZI A;  1VWC B;  1SWC A;  2OF8 A;  2BC3 A;  2A5B A;  1SWH A;  1VWO B;  3T2W A;  4GDA A;  2IZH B;  1HQQ A;  1LDQ A;  1VYO A;  1Y52 X;  3X00 A;  3WZO A;  2OF9 A;  4Z6J A;  1VWQ B;  2F01 A;  1SWT A;  2ZSC A;  1LCW A;  2CAM A;  3VHM A;  4BX5 A;  3MG5 A;  2IZF B;  1SWP A;  2RTA A;  1KL5 A;  1SLE B;  3RDQ A;  1VWF B;  2C1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...