1YIVA

Structure of myelin p2 protein from equine spinal cord
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
131
structure length
131
Chain Sequence
b'SNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDVITIRTESGFKNTEISFKLGQEFDETTADNRKAKSTVTLAAGALNQVQKWNGNETTIKRKLVDGKMVVECKMASVVCTRIYEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myelin P2 protein
publication title Structure of myelin P2 protein from equine spinal cord.
pubmed doi rcsb
molecule tags Lipid transport
total genus 27
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1yivA00
5D8JA 2W2BA 1OEEA 4ZHCA 1IIUA 1FDQA 2DM5A 3C77X 3FW4A 4RUNA 1SXXA 3ELZA 2W2AA 4IBAA 3EMMA 3FA8A 4YGGA 3KFFA 4QGVA 1QG5A 1KZWA 1PBOA 1GX9A 3AKMA 2WQ9A 4N7CA 1S2PA 3B2IA 3NQ9A 1DV9A 4BVMA 3JSQA 4ARHA 1X8NA 3AKNA 4TKJA 2WR6A 3QKGA 5HBSA 5HZ9A 1ERBA 4UU2A 1GT1A 3WVMA 1YUPA 1I4UA 1JZUA 1QFVA 4R0BA 3STNA 1VPRA 1LKEA 5JR8A 2QOSC 3U0DA 1EIOA 5HA1A 2JU3A 2GJ5A 4YCHA 3STMX 3FA6A 4Y0RA 2JU8A 5HTDA 1VYFA 1KQWA 5IO7A 2GTFX 3STKA 2HNXA 2NNEA 2G7BA 1HQPA 1CBIA 1JYDA 2ALLX 1LICA 1S44A 1E02A 3VG7A 3WJEA 4LKPA 3BDRA 3BS2A 3BY0A 3EBWA 1NP1A 1TOWA 4IMOA 1LNMA 5DG4A 5EEDA 1YIVA 3D97A 1X8OA 2L67A 1BRQA 2CZUA 1AELA 3NX2A 1A18A 1EXSA 5F1EA 3TF6A 3TGAA 3O22A 2LKKA 4OS8A 2OFMX 1QY1A 2FLJA 2NNQA 1I06A 3NPOA 4GETA 3DTQA 1GT4A 3BSZE 4ZH9A 2QO6A 3D95A 4Y0QA 2FS7A 3APWA 3HK1A 3UEVA 2G78A 4YKMA 3BX8A 4AZRA 2HMBA 1EQDA 1B4MA 3CMPA 5HWZA 1IKEA 1OEJA 3DSZA 2Q4NA 2ACPX 1HMTA 3KFHA 3KZAA 2G79A 4TLJA 1BBPA 2FS6A 1S7DA 5IO5A 3G7XA 3GAQA 4QGWA 3APVA 1EUOA 3PP6A 1HBPA 3UEXA 1QY0A 2CBSA 2MO5A 5F58A 4ZGUA 3VG2A 4ZHFA 1UREA 3P6DA 4K19A 5H8TA 4ORUA 5H9LA 4YGHA 5K06A 3FA7A 1HN2A 2RD7C 2A13A 5FAZA 1T0VA 3WJCA 1TVQA 1G85A 1KT3A 4YMYA 2OVDA 1YP6A 2AMMX 4XMHA 2GC9A 1IFBA 1CRBA 2AT8X 2YG2A 2HZQA 3WJBA 3EBKA 5KHPA 2OZQA 3S26A 1KT5A 3RZYA 1ZRYA 4I3CA 4AZPA 3HWEA 4Y0SA 5DPQA 2R73A 1LIDA 1B8EA 1LIEA 3B2HA 4ZR2A 3TGBA 3TZSA 1DZKA 1ADLA 4XMFA 1DC9A 2NNDA 3FEPA 1AB0A 4QAEA 1HMSA 1A2DA 1Z24A 4XMGA 4O9SA 2LB6A 4OS3A 4YKOA 4YCEA 1OBUA 3FMZA 1HMRA 2HYSA 2Q2PA 2MJIA 3BX7A 4NNTA 3O19A 2WWPA 1EPAA 1ZNKA 1G7NA 1ALBA 1ZNLA 1LIFA 4I9RA 3K3LA 2AT5X 3FA9A 2LBAA 4HFOA 4ORRA 5HZ6A 5BVQA 1X8PA 4YH0A 2POAA 4RUUA 3F8AA 5LJGA 1JV4A 4NNSA 4AZQA 4NP1A 5HCCC 1UZ2X 2KTDA 3WBGA 2PY1A 1G74A 2JOZA 1OBPA 3ZUIA 1KT7A 4OS0A 1MDCA 4IAWA 4A8ZA 4EFGA 3U03A 5H9NA 2EU7X 1T8VA 5LKFA 1QQSA 5LKEA 3FR2A 2FWVA 3PH6A 1N0SA 2X46A 4HPBA 5H9AA 4BQUA 1YWBA 1YWCA 1FTPA 4AW8A 4I3BA 1YP7A 4OMXA 1LFOA 4Y0PA 1SY2A 2N93A 5HAEA 4CK4A 5LJKA 3PEDA 2WEWA 1E00A 1SA8A 4ORWA 4HPAA 4ORSA 1QFTA 2FR3A 1SY3A 2LFOA 4D6BA 5FENA 2WQAE 1KZXA 4BOEA 4ZHDA 4ALOA 1GKAB 5LJCA 1KGLA 1XKIA 2HZRA 3VG6A 4ZHHA 3PH5A 5CE4A 4AYHA 2K23A 4WFVA 3FEKA 3B2LA 2A2UA 1PEEA 3BU1A 2KT4B 5B27A 3HWFA 1VYGA 3RSWA 1CJ5A 3VG4A 4HPCA 1GT5A 3CBCA 4IB7A 4TJZA 3B2KA 3ZUOA 1JJJA 2WEXA 5B29A 1B56A 4HPDA 1ZNGA 4YFRA 4AZNA 1JBHA 1X8UA 2AL0X 4YBPA 3P6FA 3BLGA 2R74A 1OPAA 5BVTA 2ANSA 1EALA 4ZJ0A 3CQRA 1A57A 1DZMA 4M7MA 1R0UA 4MVLA 5KIDA 4KIIA 1QWDA 1GX8A 4EDEA 1JYJA 3Q6LA 1KOIA 5D45A 1X8QA 2RCQA 4WFUA 1E06A 1SY1A 4TKHA 1IFCA 5C0NA 4YDBA 1SXUA 2FT9A 1CBQA 4YFPA 1TXLA 1D3SA 4EEJA 2F73A 4WBKA 1MX8A 4A60A 1DZJA 3I0AA 1BJ7A 2L9CA 5BVSA 4PSQA 2FTBA 1FEMA 4YBUA 5EDBA 1ZNHA 3FR4A 4XMCA 3CBSA 4YFQA 1TOUA 2QO5A 5F6BA 1LPJA 4UU3A 1IW2A 2K62A 1BM5A 3B2JA 2W2FA 3EM0A 4QGXA 4TKBA 1U0XA 4YGZA 2CBRA 4NYQA 4GE1A 3OJYC 3ZQ3A 1GKAA 4EXZA 3FW5A 1SXYA 4A1HA 3APXA 4GH7A 3L4RA 4MVKA 3APUA 5HCDC 5D48A 2RA6A 4ZFXA 1I04A 1X71A 4ES7A 3PPTA 2RCTA 4XMDA 2QO4A 1BSOA 1GGLA 5L8OA 1DF3A 3NR3A 1KQXA 2RQ0A 3FR5A 4ORXA 1U17A 5IO6A 1EIIA 3C76X 2R56A 5KICA 1B0OA 1G5WA 5LJBA 5L8NA 4ODDA 1ICMA 4I9SA 3BU9A 5F6ZA 1DFVA 4YDAA 5D4AA 1A3YA 2CZTA 2Q9SA 3TGCA 2OVAA 3HWDA 3U9PC 4IAXA 2FRSA 1O1VA 1ZNDA 3F9DA 1JJXA 3VG3A 2FR2A 4LZUA 3FENA 1FENA 3IA8A 1E5PA 4NLIA 2AT6X 2X45A 4MVIA 3UEWA 3C78X 3ELXA 1FE3A 2MM3A 5EEEA 1GM6A 1MVGA 4IMNA 1MX7A 5F7GA 5HZ5A 1O8VA 2AT0X 3FELA 1HBQA 5HTEA 2BLGA 3P6HA 3NADA 1CBSA 1ACDA 4D6AA 4GKCA 1EPBA 2E4JA 5HZQA 1QABE 2CM9A 2JN3A 3P6CA 3WJGA 2AH7X 2A3FX 1ICNA 4IB6A 4NLJA 1FELA 3MVFA 4XMEA 4DQ4A 5HZ8A 3FLLA 1OBQA 1H91A 3WJFA 3FIQA 4LZVA 4OMWA 3UEUA 2XSTA 1ERXA 4GNYA 1AVGI 1O1UA 1ML7A 2AKQA 3SAOA 1QY2A 3VG5A 4GNWA 3I17A 2WSJA 4M6SA 1GXAA 1LF7A 3MBTA 1NP4A 5FFHA 2L5PA 1BRPA 3JS1A 3NX1A 2OFRX 3P6EA 2A2GA 5L8IA 4QYPA 5LJDA 1KT4A 4ZHGA 1X89A 4IB9A 1BLRA 2CM4A 4DQ3A 2IFBA 1PMPA 4N7DA 3NQ3A 3NP1A 1KXOA 1TW4A 2Q2MA 2Q39A 4AZOA 4IB8A 5HCEC 4TQ2A 5LJHA 2NP1A 4GRJA 1GT3A 2JU7A 4QZUA 2O62A 2ASNX 4AZMA 1BEBA 3PECA 1ZNEA 4TNNA 1CBRA 5HA0A 1AQBA 4ZCBA 1RLBE 3WXQA 1BSYA 3KFGA 5EZ2A 2HLVA 3EYCA 3IFBA 4ALBA 3CR6A 2P8GA 1KT6A 2AT3X 4QYNA 2L68A 1T68X 4QZTA 1I05A 1SY0A 3D96A 4LKTA 2XKLA 4ZH6A 1U18A 3CQNA 1D2UA 3O2YA 1L6MA 1P6PA 5EDCA 3CWKA 1OPBA 1XCAA 1RBPA 3P6GA 5AQ6A 5EPQA 1EW3A 1DZPA 3HWGA 4I3DA 1YWAA 5D47A 1MUPA 4A1YA 1BWYA 1BSQA 1SXWA 3KFIA 4ORYA 1LIBA 1PM1X 3KQ0A 3WJDA 5LJEA 2WUTA 4NYRA 3BRNA 1NGLA 2OVEA 2A0AA 2ACOA 2LBVA 1IKJA 2QM9A 5H9KA 1YWDA 3T1DA 1OEKA
chains in the Genus database with same CATH superfamily
5D8JA 1K24A 4FBRA 3LV4A 1SWOA 2W2BA 1OEEA 4ZHCA 1IIUA 1FDQA 3S60A 2DM5A 2RTPB 3C77X 3FW4A 4BJ8A 2BS6A 4RUNA 2OFBA 1N9YA 1HXZA 1VWBB 1SXXA 4FBVA 3ELZA 3FIDA 4L3RA 4GD9A 2W2AA 2FKGA 4IBAA 3EMMA 3FA8A 4YGGA 3KFFA 4QGVA 3MX7A 1QG5A 4Z2VA 1SWFA 1FJ1E 3VHMA 3LHNA 1PBOA 1KZWA 1GX9A 3AKMA 1SWCA 4WHIA 2WQ9A 4N7CA 1S2PA 1OSPO 3B2IA 3NQ9A 1DV9A 3RY1A 1SLGB 3RDOA 1Y9TA 4NV7A 3VU1A 4BVMA 3JSQA 4CPIA 4ARHA 1X8NA 3AKNA 2OF9A 3T6FA 4TKJA 5B11O 2JGSA 2C1QA 2WR6A 3QKGA 2OY7A 5HBSA 5HZ9A 1LCWA 1VWCB 4BBOA 1AVDA 4GU8A 4JGLA 2PI3O 3EW2A 1ERBA 1SRGA 1GT1A 4MEEA 2OF8A 4UU2A 3WVMA 3WYQA 1YUPA 1I4UA 2C1SA 1QFVA 1JZUA 4R0BA 3STNA 1VPRA 1LKEA 5JD2A 5JR8A 2QOSC 3U0DA 1EIOA 4GUZA 5IRUA 5HA1A 2JU3A 2GJ5A 4YCHA 2OY5O 2M4LA 3FA6A 4Y0RA 2JU8A 3STMX 1I78A 1VYFA 5HTDA 2ZSCA 4L1NA 3RY2A 1KQWA 3FYFA 5IO7A 2GTFX 3STKA 2HNXA 2NNEA 1MK5A 1HQPA 2G7BA 1CBIA 3NQKA 2Z4HA 1JYDA 2ALLX 5CYBA 1LICA 3HTYA 1HXLA 1E02A 1S44A 3SZIA 3VG7A 3WJEA 3RE6A 1VWDB 4LKPA 4KT5A 3BDRA 3BS2A 1SWJA 3BY0A 1NP1A 3EBWA 1TOWA 1EI5A 4IMOA 1LNMA 4YVBA 4I6SA 1MOYA 5DG4A 5EEDA 3OBLA 1YIVA 3D97A 4U9CA 1X8OA 2L67A 1BRQA 1GX3A 2CZUA 1AELA 1SWGA 3NX2A 1A18A 4Z28A 1EXSA 5F1EA 3TF6A 3TGAA 1SRFA 4EKVA 3O22A 2LKKA 2OY8A 4OS8A 1SWBA 2OFMX 1QY1A 2FLJA 2RTQB 1RSUB 2NNQA 1N4JA 1I06A 2IZBA 3NPOA 3PQSA 3F6ZB 2BC3A 4GETA 4Z6JA 3DTQA 1GT4A 3BSZE 4ZH9A 2QO6A 2IZGB 2X32A 3D95A 2FS7A 3EC5A 4Y0QA 3APWA 3HK1A 1NQNA 2IZFB 2X8SA 3T6LA 3UEVA 1VWOB 2G78A 4YKMA 3BX8A 4AZRA 4CV7A 2HMBA 1EQDA 1B4MA 3CMPA 5B5FA 5HWZA 1IKEA 1OEJA 2IZCB 3DSZA 2IZIA 2Q4NA 2ACPX 1HMTA 3KFHA 3KZAA 2G79A 4TLJA 4ALBA 4O3YA 3ZW0B 1BBPA 2FS6A 4CDEA 2X8TA 1S7DA 3Q34A 5IO5A 3JQOA 3G7XA 3GAQA 4QGWA 3APVA 3D9WA 1EUOA 4HWMA 3PP6A 1HBPA 1NBXA 1QY0A 2CBSA 2MO5A 5F58A 3UEXA 2X56A 3RKGA 1UREA 3P6DA 4K19A 5IRAA 3VG2A 3ZW1B 5H8TA 1SRIA 4ORUA 5H9LA 2IZJA 4YGHA 5K06A 3FA7A 1HN2A 2RD7C 4U46A 2A13A 1W4TA 1STPA 1VWRB 4GGRA 5FAZA 1T0VA 3HPEA 2OY1O 1TVQA 3WJCA 1G85A 1KT3A 2QOMA 4YMYA 1VWIB 2OVDA 2RTEB 4ID2A 1Y53X 1YP6A 2AMMX 2GC9A 4XMHA 2FKJA 2G5LA 1IFBA 1CRBA 2AT8X 2RTGB 2YG2A 2HZQA 3PK2A 4QNIA 3WJBA 3EBKA 5KHPA 2OZQA 3S26A 1KT5A 3RZYA 1ZRYA 4I3CA 4AZPA 1VWHB 3HWEA 4Y0SA 5DPQA 2R73A 4B55A 1LIDA 1B8EA 1LIEA 3B2HA 4ZR2A 3TGBA 3TZSA 1DZKA 1VWEB 1ADLA 4XMFA 1JMZA 1DC9A 2NNDA 3FEPA 5K67A 2C4IA 1AB0A 4QAEA 1HMSA 2OFAA 5K68A 1A2DA 1SLDB 2QCBA 1K3BA 1Y0GA 1Z24A 2VFCA 4O9SA 4XMGA 2RTRB 3RDMA 2LB6A 4OS3A 4YKOA 3WZOA 4YCEA 3SLJA 1OBUA 3FMZA 1HMRA 2HYSA 2Q2PA 4OKAA 2MJIA 2ZAGA 3BX7A 3RBYA 4NNTA 1SWDA 1Y9LA 2OL6O 3O19A 1KL4A 2WWPA 1EPAA 1ZNKA 1G7NA 1KFFA 1ALBA 3OE3A 1ZNLA 3CKFA 1LIFA 4I9RA 3K3LA 2AT5X 3FA9A 5B2AO 5IRWA 2LBAA 4HFOA 4ORRA 5HZ6A 5BVQA 1X8PA 3VHIA 4YH0A 2POAA 4RUUA 1LDQA 3QQ2A 1VWJB 3F8AA 5LJGA 1JV4A 4NNSA 4AZQA 1W5RA 4NP1A 2MHDA 5HCCC 1UZ2X 2KTDA 3WBGA 2PY1A 1G74A 2JOZA 3RDXA 4CDFA 1OBPA 2RTAA 4O49A 3ZUIA 1KT7A 2RTFB 2Y3FA 3S5XA 4KC8A 4OS0A 4KH8A 1MDCA 2UYWA 4IAWA 4A8ZA 3ZW0A 4EFGA 3U03A 5H9NA 4U8UM 2EU7X 1T8VA 1VWLB 1SLEB 5LKFA 1RAVA 1QQSA 4GGZA 5LKEA 3FR2A 2FWVA 3PH6A 1N0SA 3ZW1A 2A8GA 2X46A 4HPBA 5H9AA 4BQUA 2GTLM 1YWBA 1YWCA 1FTPA 3RDUA 4AW8A 3P02A 4I3BA 1YP7A 4OMXA 1LFOA 2AF5A 4Y0PA 4BGFA 2X4MA 3T2XA 1SY2A 2N93A 5HAEA 4QQ1A 2IZEB 4CK4A 5LJKA 3SLOA 3PEDA 3KVNA 2WEWA 1E00A 1SA8A 1WBIA 4ORWA 4HPAA 4ORSA 1QFTA 2FR3A 1SY3A 2LFOA 4D6BA 5FENA 1LUQA 2WQAE 1KZXA 4BOEA 4ZHDA 3VPJE 1WUBA 4ALOA 1E2TA 2BS5A 3T2WA 1GKAB 5LJCA 1KGLA 1XKIA 2HZRA 3VG6A 4O4XA 1LCZA 3MM0A 4ZHHA 3PH5A 5CE4A 4AYHA 2K23A 1KL5A 4WFVA 1VWMB 3FEKA 4CDCA 3B2LA 2A2UA 1PEEA 1MM9A 3BU1A 2KT4B 4BX6B 5B27A 1SWPA 3HWFA 4OELA 1VYGA 2DJFA 3RSWA 1CJ5A 1PBYA 3VG4A 1SWLA 1SWTA 4HPCA 1VWFB 1GT5A 3CBCA 4IB7A 1SRHA 3B2KA 4TJZA 3VE2A 3ZUOA 1JJJA 1W6FA 2WEXA 4U3QA 5F2BA 5B29A 1B56A 4HPDA 1ZNGA 4YFRA 2MWHA 4AZNA 3CKGA 1X8UA 1RXHA 4FGIB 1JBHA 2AL0X 2RN4A 4YBPA 3P6FA 3BLGA 2R74A 2Y3EA 3WOVA 4Z2OA 1OPAA 5BVTA 2VFBA 4JHQA 3VHHA 3E3CA 2ANSA 2G8CO 1EALA 2DJGA 4ZJ0A 3CQRA 1A57A 1DZMA 4M7MA 4CPHB 1R0UA 2QMIA 4MVLA 5KIDA 2BHVA 2FHNX 2BT9A 1RXKA 4KIIA 5HZ5A 1QWDA 1GX8A 4EDEA 1JYJA 1RXJA 3Q6LA 4O3ZA 1KOIA 4U8UO 3MG5A 5D45A 1X8QA 2RCQA 2F01A 4WFUA 1E06A 1SY1A 5CSEA 4TKHA 1IFCA 2RTCB 3X00A 2GTLO 3AUMO 1STRB 3V8UA 5C0NA 4YDBA 1PTSA 1SXUA 2FT9A 3S5VA 5AJCA 1CBQA 4YFPA 1TXLA 2RTBB 1D3SA 4EEJA 2F73A 4WBKA 1MX8A 1JIWI 4A60A 1DZJA 1N9MA 2GH7A 3I0AA 1BJ7A 2L9CA 5BVSA 4PSQA 1VWNB 3RDQA 2FTBA 1SWUA 1FEMA 2Z4IA 4YBUA 5EDBA 5FQ8E 3WYPA 1ZNHA 3FR4A 4XMCA 1NDJA 3CBSA 4YFQA 5FQ6E 1TOUA 2QO5A 1SWSA 1MEPA 4IABA 5F6BA 1LPJA 4UU3A 5B5GA 1IW2A 2K62A 3SLTA 1BM5A 2X8FA 3B2JA 2W2FA 2I5VO 3EM0A 4QGXA 4TKBA 1U0XA 4YGZA 2CBRA 4I95A 1VWGB 4NYQA 4GE1A 1SRJA 3OJYC 4MIRA 1GKAA 3ZQ3A 1HQQA 3HOLA 4O4OA 4EXZA 4Z27A 3FW5A 3RDSA 2IZKA 1SXYA 4A1HA 4COTA 3APXA 4GH7A 3L4RA 4GZVA 4MVKA 3APUA 5HCDC 5D48A 4CPEA 4BX6A 3ZI8A 2RA6A 4ZFXA 1I04A 2AVIA 3RE5A 2KTSA 5B3MO 4DCBA 1JJUA 1X71A 4ES7A 4ZGUA 2VDFA 2IZHB 3WZQA 3PPTA 4FQBB 2RTHB 1SWQA 2RCTA 4KC7A 4XMDA 2A5BA 2QO4A 1BSOA 1GGLA 5L8OA 1DF3A 1STSB 1KQXA 2JMBA 2KW1A 2OL8O 2RQ0A 3FR5A 3NR3A 1U17A 4ORXA 4BCSA 5IO6A 1DF8A 3C76X 1EIIA 2R56A 5KICA 3H3IA 2Y32A 1B0OA 1G5WA 5LJBA 4GK9A 5L8NA 3NBXX 1JQPA 1N43A 4CPHA 4ODDA 1ICMA 4I9SA 3BU9A 1HY2A 4O3XB 4O4UA 1DFVA 4YDAA 5F6ZA 5D4AA 3RWXA 3ZZVA 1A3YA 2CZTA 2Q9SA 3TGCA 2OVAA 3HWDA 1SWHA 3P24A 3U9PC 4IAXA 4ON1A 2RTDB 2X55A 2OL7A 3VE1A 1LELA 4BX7B 1LCVA 4BX5B 4U8UN 2FRSA 1IJ8A 1UYNX 1O1VA 1ZNDA 2KD2A 5B10O 3F9DA 1JJXA 3VG3A 2FR2A 2GTLN 1SWKA 2FGSA 2UZ2A 3FENA 1FENA 3IA8A 1E5PA 2MF6A 2RTIB 2AT6X 4NLIA 3OD9A 2X45A 3ZWEA 4MVIA 3UEWA 1VWAB 2YMSA 3C78X 3ELXA 1FE3A 1VWQB 2MM3A 5EEEA 4CSBA 1GM6A 1MVGA 4IMNA 1MX7A 1JMXA 3PQUA 1SWAA 4MISA 5F7GA 2JW1A 1O8VA 4EQAC 2AT0X 1SWNA 2RTJA 3FELA 1HBQA 2RTLA 2X34A 5HTEA 4JO6A 2CAMA 2BLGA 3SOTA 4I60A 3P6HA 4Y59A 3NADA 1CBSA 1ACDA 4D6AA 4GKCA 2FHLA 3GE2A 1VWPB 1EPBA 2E4JA 4GGTA 1NC9A 1QABE 2CM9A 2JN3A 5HZQA 3P6CA 4LZUA 3WJGA 4OEMA 2A3FX 1ICNA 4IB6A 3HOEA 1FELA 3MVFA 4NLJA 5AJBA 2AH7X 4XMEA 4DQ4A 5HZ8A 3FLLA 2RTOB 1OBQA 4NV8A 1H91A 4KCAA 4Y5DA 3FIQA 4LZVA 4OMWA 3UEUA 2XSTA 1ERXA 3WJFA 4CDDA 5L3YA 4GNYA 1AVGI 1O1UA 2IZLB 1ML7A 2AKQA 3EW1A 3SAOA 1QY2A 3VG5A 4GNWA 4ZHFA 3I17A 2WSJA 2WPUA 4M6SA 1GXAA 1LF7A 4O4SA 3MBTA 1NP4A 5FFHA 2L5PA 5IXGA 1BRPA 3JS1A 3NX1A 2OFRX 3P6EA 2A2GA 4Z2PA 5L8IA 3AEHA 1SWRA 4DNEA 2I5ZO 2ZAIA 1VWKB 3LTWA 4GJSA 4QYPA 1N7YA 4FBOA 5LJDA 1KT4A 3D4RA 4GDAA 4ZHGA 1X89A 4IB9A 1BLRA 2CM4A 4DQ3A 2IFBA 5AEOA 2RTKA 4MVEA 1PMPA 4N7DA 2IZDB 3NQ3A 4INNA 1SWEA 3ZW2A 3SZHA 3NP1A 1KXOA 1Y55X 3WZNA 1TW4A 2Q2MA 3UAQA 1I9HA 2BSZA 4LQZA 2A5CA 2Q39A 4AZOA 4IB8A 5HCEC 4TQ2A 4JNJA 2NP1A 1AVEA 1GT3A 4GRJA 2JU7A 4QZUA 5LJHA 4BX7A 2O62A 4ZGFA 2ASNX 3FDCA 4AZMA 4BX5A 1BEBA 3PECA 1ZNEA 3WZPA 4TNNA 1CBRA 2LA7A 5FQ7E 5HA0A 1AQBA 2F09A 5BYPA 4ZCBA 4PJ2A 1SLFB 1RLBE 3WXQA 1BSYA 3KFGA 5EZ2A 3PDFA 2HLVA 1SMPI 1KL3A 1RSTB 3EYCA 3CR6A 3IFBA 1KT6A 2AT3X 2P8GA 2RTMA 2L68A 1T68X 4GJVA 1I05A 4QYNA 4QZTA 5CHKA 4NW4A 4QRLA 3VGWA 2IZAA 3SZJA 4O3WA 1SY0A 3D96A 4LKTA 2XKLA 4ZH6A 1U18A 3CQNA 1D2UA 3O2YA 1L6MA 1P6PA 5EDCA 3CWKA 4ML7B 1OPBA 1VYOA 1XCAA 1RBPA 4C5PA 3P6GA 5AQ6A 1UYOX 5EPQA 2HKDA 2OYBO 1EW3A 1DZPA 3HWGA 3N91A 1SREA 4CPFA 4I3DA 1YWAA 5D47A 1MUPA 4A1YA 1BWYA 1BSQA 1SXWA 3KFIA 4IRWA 4ORYA 2OVSA 1LIBA 1PM1X 2RTNB 4GDZA 3KQ0A 1NQMA 3WJDA 1Y52X 5LJEA 2WUTA 4NYRA 3BRNA 1NGLA 2OVEA 2A0AA 2ACOA 1LDOA 1IKJA 2LBVA 2QM9A 5H9KA 1YWDA 3T1DA 1OEKA
chains in the Genus database with same CATH topology
5D8JA 4FBRA 3LV4A 2W2BA 1OEEA 4ZHCA 1IIUA 1FDQA 3S60A 2DM5A 3C77X 3FW4A 2BS6A 4RUNA 1SXXA 4FBVA 3ELZA 4L3RA 2W2AA 4IBAA 3EMMA 3FA8A 4YGGA 3KFFA 4QGVA 3MX7A 1QG5A 3LHNA 1PBOA 1KZWA 1GX9A 3AKMA 4WHIA 2WQ9A 4N7CA 1S2PA 3B2IA 3NQ9A 1DV9A 1Y9TA 4BVMA 3VU1A 3JSQA 4ARHA 1X8NA 3AKNA 4TKJA 2WR6A 3QKGA 5HBSA 5HZ9A 4JGLA 4GU8A 1ERBA 4UU2A 1GT1A 3WVMA 1YUPA 1I4UA 1JZUA 1QFVA 4R0BA 3STNA 1VPRA 1LKEA 5JR8A 2QOSC 3U0DA 1EIOA 5HA1A 2JU3A 2GJ5A 4YCHA 2M4LA 3FA6A 4Y0RA 2JU8A 3STMX 5HTDA 1VYFA 4L1NA 1KQWA 3FYFA 5IO7A 2GTFX 3STKA 2HNXA 2NNEA 2G7BA 1HQPA 1CBIA 3NQKA 2Z4HA 1JYDA 2ALLX 5CYBA 1LICA 3HTYA 1S44A 1E02A 3VG7A 3WJEA 4LKPA 4KT5A 3BDRA 3BS2A 3BY0A 3EBWA 1NP1A 1TOWA 1EI5A 4IMOA 1LNMA 4I6SA 5DG4A 5EEDA 3OBLA 1YIVA 3D97A 4U9CA 1X8OA 2L67A 1BRQA 2CZUA 1AELA 3NX2A 1A18A 1EXSA 5F1EA 3TF6A 3TGAA 3O22A 2LKKA 4OS8A 2OFMX 1QY1A 2FLJA 2NNQA 3PQSA 1I06A 3NPOA 3F6ZB 4GETA 3DTQA 1GT4A 3BSZE 4ZH9A 2QO6A 3D95A 4Y0QA 2FS7A 3APWA 3HK1A 2X8SA 3UEVA 2G78A 4YKMA 3BX8A 4AZRA 4CV7A 2HMBA 1EQDA 1B4MA 3CMPA 5HWZA 1IKEA 1OEJA 3DSZA 2Q4NA 2ACPX 1HMTA 3KFHA 3KZAA 2G79A 4TLJA 4O3YA 3ZW0B 1BBPA 2FS6A 2X8TA 1S7DA 5IO5A 3JQOA 3G7XA 3GAQA 4QGWA 3APVA 4HWMA 1EUOA 3PP6A 1HBPA 3UEXA 1QY0A 2CBSA 2MO5A 5F58A 3ZW1B 3VG2A 3RKGA 1UREA 3P6DA 4K19A 4ZHFA 5H8TA 4ORUA 5H9LA 4YGHA 5K06A 3FA7A 1HN2A 2RD7C 2A13A 5FAZA 1T0VA 3WJCA 1TVQA 1G85A 1KT3A 4YMYA 2OVDA 4ID2A 1YP6A 2AMMX 4XMHA 2GC9A 1IFBA 1CRBA 2AT8X 2YG2A 4QNIA 2HZQA 3WJBA 3EBKA 5KHPA 2OZQA 3S26A 1KT5A 3RZYA 1ZRYA 4I3CA 4AZPA 3HWEA 4Y0SA 5DPQA 2R73A 1LIDA 1B8EA 1LIEA 3B2HA 4ZR2A 3TGBA 3TZSA 1DZKA 1ADLA 4XMFA 1DC9A 2NNDA 3FEPA 1AB0A 4QAEA 1HMSA 1A2DA 1Z24A 4XMGA 4O9SA 2LB6A 4OS3A 4YKOA 4YCEA 1OBUA 3FMZA 1HMRA 2HYSA 2Q2PA 2MJIA 2ZAGA 3BX7A 3RBYA 4NNTA 1Y9LA 3O19A 2WWPA 1EPAA 1ZNKA 1G7NA 1ALBA 3OE3A 1ZNLA 1LIFA 4I9RA 3K3LA 2AT5X 3FA9A 2LBAA 4HFOA 4ORRA 5HZ6A 5BVQA 1X8PA 4YH0A 2POAA 4RUUA 3F8AA 5LJGA 1JV4A 4NNSA 4AZQA 4NP1A 2MHDA 5HCCC 1UZ2X 2KTDA 3WBGA 2PY1A 1G74A 2JOZA 1OBPA 4O49A 3ZUIA 1KT7A 3S5XA 4KC8A 4OS0A 4KH8A 1MDCA 4IAWA 4A8ZA 3ZW0A 4EFGA 3U03A 5H9NA 4U8UM 2EU7X 1T8VA 5LKFA 1QQSA 5LKEA 3FR2A 2FWVA 3PH6A 1N0SA 3ZW1A 2X46A 4HPBA 5H9AA 4BQUA 2GTLM 1YWBA 1YWCA 1FTPA 4AW8A 3P02A 4I3BA 1YP7A 4OMXA 1LFOA 4Y0PA 1SY2A 2N93A 5HAEA 4QQ1A 4CK4A 5LJKA 3PEDA 2WEWA 1E00A 1SA8A 4ORWA 4HPAA 4ORSA 1QFTA 2FR3A 1SY3A 2LFOA 4D6BA 5FENA 2WQAE 1KZXA 4BOEA 4ZHDA 3VPJE 4ALOA 2BS5A 1GKAB 5LJCA 1KGLA 1XKIA 2HZRA 3VG6A 4O4XA 4ZHHA 3PH5A 5CE4A 4AYHA 2K23A 4WFVA 3FEKA 3B2LA 2A2UA 1PEEA 3BU1A 2KT4B 5B27A 3HWFA 1VYGA 3RSWA 1CJ5A 3VG4A 4HPCA 1GT5A 3CBCA 4IB7A 4TJZA 3B2KA 3VE2A 3ZUOA 1JJJA 2WEXA 4U3QA 5B29A 1B56A 4HPDA 1ZNGA 4YFRA 2MWHA 4AZNA 4FGIB 1X8UA 1JBHA 2AL0X 2RN4A 4YBPA 3P6FA 3BLGA 2R74A 3WOVA 1OPAA 5BVTA 3E3CA 2ANSA 1EALA 4ZJ0A 3CQRA 1A57A 1DZMA 4M7MA 1R0UA 2QMIA 4MVLA 5KIDA 2BHVA 2BT9A 4KIIA 1QWDA 1GX8A 4EDEA 1JYJA 3Q6LA 4O3ZA 1KOIA 4U8UO 5D45A 1X8QA 2RCQA 4WFUA 1E06A 1SY1A 4TKHA 1IFCA 2GTLO 3V8UA 5C0NA 4YDBA 1SXUA 2FT9A 3S5VA 5AJCA 1CBQA 4YFPA 1TXLA 1D3SA 4EEJA 2F73A 4WBKA 1MX8A 1JIWI 4A60A 1DZJA 3I0AA 1BJ7A 2L9CA 5BVSA 4PSQA 2FTBA 1FEMA 2Z4IA 4YBUA 5EDBA 5FQ8E 1ZNHA 3FR4A 4XMCA 3CBSA 4YFQA 5FQ6E 1TOUA 2QO5A 4IABA 5F6BA 1LPJA 4UU3A 1IW2A 2K62A 1BM5A 2X8FA 3B2JA 2W2FA 3EM0A 4QGXA 4TKBA 1U0XA 4YGZA 2CBRA 4I95A 4NYQA 4GE1A 3OJYC 4MIRA 3ZQ3A 1GKAA 3HOLA 4O4OA 4EXZA 3FW5A 1SXYA 4A1HA 4COTA 3APXA 4GH7A 3L4RA 4GZVA 4MVKA 3APUA 5HCDC 5D48A 3ZI8A 2RA6A 4ZFXA 1I04A 2KTSA 1X71A 4ES7A 4ZGUA 3PPTA 4FQBB 2RCTA 4KC7A 4XMDA 2QO4A 1BSOA 1GGLA 5L8OA 1DF3A 2JMBA 1KQXA 3NR3A 2KW1A 2RQ0A 3FR5A 4ORXA 1U17A 5IO6A 1EIIA 3C76X 2R56A 5KICA 3H3IA 1B0OA 1G5WA 5LJBA 4GK9A 5L8NA 3NBXX 4ODDA 1ICMA 4I9SA 3BU9A 4O3XB 4O4UA 1DFVA 4YDAA 5F6ZA 5D4AA 3RWXA 3ZZVA 1A3YA 2CZTA 2Q9SA 3TGCA 2OVAA 3HWDA 3P24A 3U9PC 4IAXA 4ON1A 3VE1A 4U8UN 2FRSA 1O1VA 1ZNDA 2KD2A 3F9DA 1JJXA 3VG3A 2FR2A 2GTLN 4LZUA 3FENA 1FENA 3IA8A 1E5PA 3ZWEA 4NLIA 2AT6X 3OD9A 2X45A 4MVIA 3UEWA 2YMSA 3C78X 3ELXA 1FE3A 2MM3A 5EEEA 4CSBA 1GM6A 1MVGA 4IMNA 1MX7A 5F7GA 3PQUA 4MISA 4EQAC 5HZ5A 2JW1A 1O8VA 2AT0X 3FELA 1HBQA 5HTEA 2BLGA 3SOTA 3P6HA 3NADA 1CBSA 1ACDA 4D6AA 4GKCA 3GE2A 1EPBA 2E4JA 5HZQA 1QABE 2CM9A 2JN3A 3P6CA 3WJGA 2AH7X 2A3FX 1ICNA 4IB6A 3HOEA 1FELA 3MVFA 4NLJA 5AJBA 4XMEA 4DQ4A 5HZ8A 3FLLA 1OBQA 1H91A 4KCAA 3WJFA 3FIQA 4LZVA 4OMWA 3UEUA 2XSTA 1ERXA 4GNYA 1AVGI 1O1UA 1ML7A 2AKQA 3SAOA 1QY2A 3VG5A 4GNWA 3I17A 2WSJA 4M6SA 1GXAA 1LF7A 4O4SA 3MBTA 1NP4A 5FFHA 2L5PA 1BRPA 3JS1A 3NX1A 2OFRX 3P6EA 2A2GA 5L8IA 2ZAIA 4QYPA 4FBOA 5LJDA 1KT4A 3D4RA 4ZHGA 1X89A 4IB9A 1BLRA 2CM4A 4DQ3A 2IFBA 5AEOA 4MVEA 1PMPA 4N7DA 3NQ3A 4INNA 3ZW2A 3NP1A 1KXOA 1TW4A 2Q2MA 3UAQA 4LQZA 2Q39A 4AZOA 4IB8A 5HCEC 4TQ2A 5LJHA 2NP1A 4GRJA 1GT3A 2JU7A 4QZUA 2O62A 4ZGFA 2ASNX 4AZMA 1BEBA 3PECA 1ZNEA 4TNNA 1CBRA 2LA7A 5FQ7E 5HA0A 1AQBA 2F09A 5BYPA 4ZCBA 4PJ2A 1RLBE 3WXQA 1BSYA 3KFGA 5EZ2A 2HLVA 1SMPI 3EYCA 3IFBA 4ALBA 3CR6A 1KT6A 2AT3X 2P8GA 4QYNA 2L68A 1T68X 4QZTA 1I05A 4NW4A 4QRLA 4O3WA 1SY0A 3D96A 4LKTA 2XKLA 4ZH6A 1U18A 3CQNA 1D2UA 3O2YA 1L6MA 1P6PA 5EDCA 3CWKA 4ML7B 1OPBA 1XCAA 1RBPA 3P6GA 5AQ6A 5EPQA 1EW3A 1DZPA 3HWGA 3N91A 4I3DA 1YWAA 5D47A 1MUPA 4A1YA 1BWYA 1BSQA 1SXWA 3KFIA 4ORYA 2OVSA 1LIBA 1PM1X 4GDZA 3KQ0A 3WJDA 5LJEA 2WUTA 4NYRA 3BRNA 1NGLA 2OVEA 2A0AA 2ACOA 2LBVA 1IKJA 2QM9A 5H9KA 1YWDA 3T1DA 1OEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8J A;  2W2B A;  1OEE A;  4ZHC A;  1IIU A;  1FDQ A;  2DM5 A;  3C77 X;  3FW4 A;  4RUN A;  1SXX A;  3ELZ A;  2W2A A;  4IBA A;  3EMM A;  3FA8 A;  4YGG A;  3KFF A;  4QGV A;  1QG5 A;  1KZW A;  1PBO A;  1GX9 A;  3AKM A;  2WQ9 A;  4N7C A;  1S2P A;  3B2I A;  3NQ9 A;  1DV9 A;  4BVM A;  3JSQ A;  4ARH A;  1X8N A;  3AKN A;  4TKJ A;  2WR6 A;  3QKG A;  5HBS A;  5HZ9 A;  1ERB A;  4UU2 A;  1GT1 A;  3WVM A;  1YUP A;  1I4U A;  1JZU A;  1QFV A;  4R0B A;  3STN A;  1VPR A;  1LKE A;  5JR8 A;  2QOS C;  3U0D A;  1EIO A;  5HA1 A;  2JU3 A;  2GJ5 A;  4YCH A;  3STM X;  3FA6 A;  4Y0R A;  2JU8 A;  5HTD A;  1VYF A;  1KQW A;  5IO7 A;  2GTF X;  3STK A;  2HNX A;  2NNE A;  2G7B A;  1HQP A;  1CBI A;  1JYD A;  2ALL X;  1LIC A;  1S44 A;  1E02 A;  3VG7 A;  3WJE A;  4LKP A;  3BDR A;  3BS2 A;  3BY0 A;  3EBW A;  1NP1 A;  1TOW A;  4IMO A;  1LNM A;  5DG4 A;  5EED A;  1YIV A;  3D97 A;  1X8O A;  2L67 A;  1BRQ A;  2CZU A;  1AEL A;  3NX2 A;  1A18 A;  1EXS A;  5F1E A;  3TF6 A;  3TGA A;  3O22 A;  2LKK A;  4OS8 A;  2OFM X;  1QY1 A;  2FLJ A;  2NNQ A;  1I06 A;  3NPO A;  4GET A;  3DTQ A;  1GT4 A;  3BSZ E;  4ZH9 A;  2QO6 A;  3D95 A;  4Y0Q A;  2FS7 A;  3APW A;  3HK1 A;  3UEV A;  2G78 A;  4YKM A;  3BX8 A;  4AZR A;  2HMB A;  1EQD A;  1B4M A;  3CMP A;  5HWZ A;  1IKE A;  1OEJ A;  3DSZ A;  2Q4N A;  2ACP X;  1HMT A;  3KFH A;  3KZA A;  2G79 A;  4TLJ A;  1BBP A;  2FS6 A;  1S7D A;  5IO5 A;  3G7X A;  3GAQ A;  4QGW A;  3APV A;  1EUO A;  3PP6 A;  1HBP A;  3UEX A;  1QY0 A;  2CBS A;  2MO5 A;  5F58 A;  4ZGU A;  3VG2 A;  4ZHF A;  1URE A;  3P6D A;  4K19 A;  5H8T A;  4ORU A;  5H9L A;  4YGH A;  5K06 A;  3FA7 A;  1HN2 A;  2RD7 C;  2A13 A;  5FAZ A;  1T0V A;  3WJC A;  1TVQ A;  1G85 A;  1KT3 A;  4YMY A;  2OVD A;  1YP6 A;  2AMM X;  4XMH A;  2GC9 A;  1IFB A;  1CRB A;  2AT8 X;  2YG2 A;  2HZQ A;  3WJB A;  3EBK A;  5KHP A;  2OZQ A;  3S26 A;  1KT5 A;  3RZY A;  1ZRY A;  4I3C A;  4AZP A;  3HWE A;  4Y0S A;  5DPQ A;  2R73 A;  1LID A;  1B8E A;  1LIE A;  3B2H A;  4ZR2 A;  3TGB A;  3TZS A;  1DZK A;  1ADL A;  4XMF A;  1DC9 A;  2NND A;  3FEP A;  1AB0 A;  4QAE A;  1HMS A;  1A2D A;  1Z24 A;  4XMG A;  4O9S A;  2LB6 A;  4OS3 A;  4YKO A;  4YCE A;  1OBU A;  3FMZ A;  1HMR A;  2HYS A;  2Q2P A;  2MJI A;  3BX7 A;  4NNT A;  3O19 A;  2WWP A;  1EPA A;  1ZNK A;  1G7N A;  1ALB A;  1ZNL A;  1LIF A;  4I9R A;  3K3L A;  2AT5 X;  3FA9 A;  2LBA A;  4HFO A;  4ORR A;  5HZ6 A;  5BVQ A;  1X8P A;  4YH0 A;  2POA A;  4RUU A;  3F8A A;  5LJG A;  1JV4 A;  4NNS A;  4AZQ A;  4NP1 A;  5HCC C;  1UZ2 X;  2KTD A;  3WBG A;  2PY1 A;  1G74 A;  2JOZ A;  1OBP A;  3ZUI A;  1KT7 A;  4OS0 A;  1MDC A;  4IAW A;  4A8Z A;  4EFG A;  3U03 A;  5H9N A;  2EU7 X;  1T8V A;  5LKF A;  1QQS A;  5LKE A;  3FR2 A;  2FWV A;  3PH6 A;  1N0S A;  2X46 A;  4HPB A;  5H9A A;  4BQU A;  1YWB A;  1YWC A;  1FTP A;  4AW8 A;  4I3B A;  1YP7 A;  4OMX A;  1LFO A;  4Y0P A;  1SY2 A;  2N93 A;  5HAE A;  4CK4 A;  5LJK A;  3PED A;  2WEW A;  1E00 A;  1SA8 A;  4ORW A;  4HPA A;  4ORS A;  1QFT A;  2FR3 A;  1SY3 A;  2LFO A;  4D6B A;  5FEN A;  2WQA E;  1KZX A;  4BOE A;  4ZHD A;  4ALO A;  1GKA B;  5LJC A;  1KGL A;  1XKI A;  2HZR A;  3VG6 A;  4ZHH A;  3PH5 A;  5CE4 A;  4AYH A;  2K23 A;  4WFV A;  3FEK A;  3B2L A;  2A2U A;  1PEE A;  3BU1 A;  2KT4 B;  5B27 A;  3HWF A;  1VYG A;  3RSW A;  1CJ5 A;  3VG4 A;  4HPC A;  1GT5 A;  3CBC A;  4IB7 A;  4TJZ A;  3B2K A;  3ZUO A;  1JJJ A;  2WEX A;  5B29 A;  1B56 A;  4HPD A;  1ZNG A;  4YFR A;  4AZN A;  1JBH A;  1X8U A;  2AL0 X;  4YBP A;  3P6F A;  3BLG A;  2R74 A;  1OPA A;  5BVT A;  2ANS A;  1EAL A;  4ZJ0 A;  3CQR A;  1A57 A;  1DZM A;  4M7M A;  1R0U A;  4MVL A;  5KID A;  4KII A;  1QWD A;  1GX8 A;  4EDE A;  1JYJ A;  3Q6L A;  1KOI A;  5D45 A;  1X8Q A;  2RCQ A;  4WFU A;  1E06 A;  1SY1 A;  4TKH A;  1IFC A;  5C0N A;  4YDB A;  1SXU A;  2FT9 A;  1CBQ A;  4YFP A;  1TXL A;  1D3S A;  4EEJ A;  2F73 A;  4WBK A;  1MX8 A;  4A60 A;  1DZJ A;  3I0A A;  1BJ7 A;  2L9C A;  5BVS A;  4PSQ A;  2FTB A;  1FEM A;  4YBU A;  5EDB A;  1ZNH A;  3FR4 A;  4XMC A;  3CBS A;  4YFQ A;  1TOU A;  2QO5 A;  5F6B A;  1LPJ A;  4UU3 A;  1IW2 A;  2K62 A;  1BM5 A;  3B2J A;  2W2F A;  3EM0 A;  4QGX A;  4TKB A;  1U0X A;  4YGZ A;  2CBR A;  4NYQ A;  4GE1 A;  3OJY C;  3ZQ3 A;  1GKA A;  4EXZ A;  3FW5 A;  1SXY A;  4A1H A;  3APX A;  4GH7 A;  3L4R A;  4MVK A;  3APU A;  5HCD C;  5D48 A;  2RA6 A;  4ZFX A;  1I04 A;  1X71 A;  4ES7 A;  3PPT A;  2RCT A;  4XMD A;  2QO4 A;  1BSO A;  1GGL A;  5L8O A;  1DF3 A;  3NR3 A;  1KQX A;  2RQ0 A;  3FR5 A;  4ORX A;  1U17 A;  5IO6 A;  1EII A;  3C76 X;  2R56 A;  5KIC A;  1B0O A;  1G5W A;  5LJB A;  5L8N A;  4ODD A;  1ICM A;  4I9S A;  3BU9 A;  5F6Z A;  1DFV A;  4YDA A;  5D4A A;  1A3Y A;  2CZT A;  2Q9S A;  3TGC A;  2OVA A;  3HWD A;  3U9P C;  4IAX A;  2FRS A;  1O1V A;  1ZND A;  3F9D A;  1JJX A;  3VG3 A;  2FR2 A;  4LZU A;  3FEN A;  1FEN A;  3IA8 A;  1E5P A;  4NLI A;  2AT6 X;  2X45 A;  4MVI A;  3UEW A;  3C78 X;  3ELX A;  1FE3 A;  2MM3 A;  5EEE A;  1GM6 A;  1MVG A;  4IMN A;  1MX7 A;  5F7G A;  5HZ5 A;  1O8V A;  2AT0 X;  3FEL A;  1HBQ A;  5HTE A;  2BLG A;  3P6H A;  3NAD A;  1CBS A;  1ACD A;  4D6A A;  4GKC A;  1EPB A;  2E4J A;  5HZQ A;  1QAB E;  2CM9 A;  2JN3 A;  3P6C A;  3WJG A;  2AH7 X;  2A3F X;  1ICN A;  4IB6 A;  4NLJ A;  1FEL A;  3MVF A;  4XME A;  4DQ4 A;  5HZ8 A;  3FLL A;  1OBQ A;  1H91 A;  3WJF A;  3FIQ A;  4LZV A;  4OMW A;  3UEU A;  2XST A;  1ERX A;  4GNY A;  1AVG I;  1O1U A;  1ML7 A;  2AKQ A;  3SAO A;  1QY2 A;  3VG5 A;  4GNW A;  3I17 A;  2WSJ A;  4M6S A;  1GXA A;  1LF7 A;  3MBT A;  1NP4 A;  5FFH A;  2L5P A;  1BRP A;  3JS1 A;  3NX1 A;  2OFR X;  3P6E A;  2A2G A;  5L8I A;  4QYP A;  5LJD A;  1KT4 A;  4ZHG A;  1X89 A;  4IB9 A;  1BLR A;  2CM4 A;  4DQ3 A;  2IFB A;  1PMP A;  4N7D A;  3NQ3 A;  3NP1 A;  1KXO A;  1TW4 A;  2Q2M A;  2Q39 A;  4AZO A;  4IB8 A;  5HCE C;  4TQ2 A;  5LJH A;  2NP1 A;  4GRJ A;  1GT3 A;  2JU7 A;  4QZU A;  2O62 A;  2ASN X;  4AZM A;  1BEB A;  3PEC A;  1ZNE A;  4TNN A;  1CBR A;  5HA0 A;  1AQB A;  4ZCB A;  1RLB E;  3WXQ A;  1BSY A;  3KFG A;  5EZ2 A;  2HLV A;  3EYC A;  3IFB A;  4ALB A;  3CR6 A;  2P8G A;  1KT6 A;  2AT3 X;  4QYN A;  2L68 A;  1T68 X;  4QZT A;  1I05 A;  1SY0 A;  3D96 A;  4LKT A;  2XKL A;  4ZH6 A;  1U18 A;  3CQN A;  1D2U A;  3O2Y A;  1L6M A;  1P6P A;  5EDC A;  3CWK A;  1OPB A;  1XCA A;  1RBP A;  3P6G A;  5AQ6 A;  5EPQ A;  1EW3 A;  1DZP A;  3HWG A;  4I3D A;  1YWA A;  5D47 A;  1MUP A;  4A1Y A;  1BWY A;  1BSQ A;  1SXW A;  3KFI A;  4ORY A;  1LIB A;  1PM1 X;  3KQ0 A;  3WJD A;  5LJE A;  2WUT A;  4NYR A;  3BRN A;  1NGL A;  2OVE A;  2A0A A;  2ACO A;  2LBV A;  1IKJ A;  2QM9 A;  5H9K A;  1YWD A;  3T1D A;  1OEK A; 
#chains in the Genus database with same CATH topology
 5D8J A;  1K24 A;  4FBR A;  3LV4 A;  1SWO A;  2W2B A;  1OEE A;  4ZHC A;  1IIU A;  1FDQ A;  3S60 A;  2DM5 A;  2RTP B;  3C77 X;  3FW4 A;  4BJ8 A;  2BS6 A;  4RUN A;  2OFB A;  1N9Y A;  1HXZ A;  1VWB B;  1SXX A;  4FBV A;  3ELZ A;  3FID A;  4L3R A;  4GD9 A;  2W2A A;  2FKG A;  4IBA A;  3EMM A;  3FA8 A;  4YGG A;  3KFF A;  4QGV A;  3MX7 A;  1QG5 A;  4Z2V A;  1SWF A;  1FJ1 E;  3VHM A;  3LHN A;  1PBO A;  1KZW A;  1GX9 A;  3AKM A;  1SWC A;  4WHI A;  2WQ9 A;  4N7C A;  1S2P A;  1OSP O;  3B2I A;  3NQ9 A;  1DV9 A;  3RY1 A;  1SLG B;  3RDO A;  1Y9T A;  4NV7 A;  3VU1 A;  4BVM A;  3JSQ A;  4CPI A;  4ARH A;  1X8N A;  3AKN A;  2OF9 A;  3T6F A;  4TKJ A;  5B11 O;  2JGS A;  2C1Q A;  2WR6 A;  3QKG A;  2OY7 A;  5HBS A;  5HZ9 A;  1LCW A;  1VWC B;  4BBO A;  1AVD A;  4GU8 A;  4JGL A;  2PI3 O;  3EW2 A;  1ERB A;  1SRG A;  1GT1 A;  4MEE A;  2OF8 A;  4UU2 A;  3WVM A;  3WYQ A;  1YUP A;  1I4U A;  2C1S A;  1QFV A;  1JZU A;  4R0B A;  3STN A;  1VPR A;  1LKE A;  5JD2 A;  5JR8 A;  2QOS C;  3U0D A;  1EIO A;  4GUZ A;  5IRU A;  5HA1 A;  2JU3 A;  2GJ5 A;  4YCH A;  2OY5 O;  2M4L A;  3FA6 A;  4Y0R A;  2JU8 A;  3STM X;  1I78 A;  1VYF A;  5HTD A;  2ZSC A;  4L1N A;  3RY2 A;  1KQW A;  3FYF A;  5IO7 A;  2GTF X;  3STK A;  2HNX A;  2NNE A;  1MK5 A;  1HQP A;  2G7B A;  1CBI A;  3NQK A;  2Z4H A;  1JYD A;  2ALL X;  5CYB A;  1LIC A;  3HTY A;  1HXL A;  1E02 A;  1S44 A;  3SZI A;  3VG7 A;  3WJE A;  3RE6 A;  1VWD B;  4LKP A;  4KT5 A;  3BDR A;  3BS2 A;  1SWJ A;  3BY0 A;  1NP1 A;  3EBW A;  1TOW A;  1EI5 A;  4IMO A;  1LNM A;  4YVB A;  4I6S A;  1MOY A;  5DG4 A;  5EED A;  3OBL A;  1YIV A;  3D97 A;  4U9C A;  1X8O A;  2L67 A;  1BRQ A;  1GX3 A;  2CZU A;  1AEL A;  1SWG A;  3NX2 A;  1A18 A;  4Z28 A;  1EXS A;  5F1E A;  3TF6 A;  3TGA A;  1SRF A;  4EKV A;  3O22 A;  2LKK A;  2OY8 A;  4OS8 A;  1SWB A;  2OFM X;  1QY1 A;  2FLJ A;  2RTQ B;  1RSU B;  2NNQ A;  1N4J A;  1I06 A;  2IZB A;  3NPO A;  3PQS A;  3F6Z B;  2BC3 A;  4GET A;  4Z6J A;  3DTQ A;  1GT4 A;  3BSZ E;  4ZH9 A;  2QO6 A;  2IZG B;  2X32 A;  3D95 A;  2FS7 A;  3EC5 A;  4Y0Q A;  3APW A;  3HK1 A;  1NQN A;  2IZF B;  2X8S A;  3T6L A;  3UEV A;  1VWO B;  2G78 A;  4YKM A;  3BX8 A;  4AZR A;  4CV7 A;  2HMB A;  1EQD A;  1B4M A;  3CMP A;  5B5F A;  5HWZ A;  1IKE A;  1OEJ A;  2IZC B;  3DSZ A;  2IZI A;  2Q4N A;  2ACP X;  1HMT A;  3KFH A;  3KZA A;  2G79 A;  4TLJ A;  4ALB A;  4O3Y A;  3ZW0 B;  1BBP A;  2FS6 A;  4CDE A;  2X8T A;  1S7D A;  3Q34 A;  5IO5 A;  3JQO A;  3G7X A;  3GAQ A;  4QGW A;  3APV A;  3D9W A;  1EUO A;  4HWM A;  3PP6 A;  1HBP A;  1NBX A;  1QY0 A;  2CBS A;  2MO5 A;  5F58 A;  3UEX A;  2X56 A;  3RKG A;  1URE A;  3P6D A;  4K19 A;  5IRA A;  3VG2 A;  3ZW1 B;  5H8T A;  1SRI A;  4ORU A;  5H9L A;  2IZJ A;  4YGH A;  5K06 A;  3FA7 A;  1HN2 A;  2RD7 C;  4U46 A;  2A13 A;  1W4T A;  1STP A;  1VWR B;  4GGR A;  5FAZ A;  1T0V A;  3HPE A;  2OY1 O;  1TVQ A;  3WJC A;  1G85 A;  1KT3 A;  2QOM A;  4YMY A;  1VWI B;  2OVD A;  2RTE B;  4ID2 A;  1Y53 X;  1YP6 A;  2AMM X;  2GC9 A;  4XMH A;  2FKJ A;  2G5L A;  1IFB A;  1CRB A;  2AT8 X;  2RTG B;  2YG2 A;  2HZQ A;  3PK2 A;  4QNI A;  3WJB A;  3EBK A;  5KHP A;  2OZQ A;  3S26 A;  1KT5 A;  3RZY A;  1ZRY A;  4I3C A;  4AZP A;  1VWH B;  3HWE A;  4Y0S A;  5DPQ A;  2R73 A;  4B55 A;  1LID A;  1B8E A;  1LIE A;  3B2H A;  4ZR2 A;  3TGB A;  3TZS A;  1DZK A;  1VWE B;  1ADL A;  4XMF A;  1JMZ A;  1DC9 A;  2NND A;  3FEP A;  5K67 A;  2C4I A;  1AB0 A;  4QAE A;  1HMS A;  2OFA A;  5K68 A;  1A2D A;  1SLD B;  2QCB A;  1K3B A;  1Y0G A;  1Z24 A;  2VFC A;  4O9S A;  4XMG A;  2RTR B;  3RDM A;  2LB6 A;  4OS3 A;  4YKO A;  3WZO A;  4YCE A;  3SLJ A;  1OBU A;  3FMZ A;  1HMR A;  2HYS A;  2Q2P A;  4OKA A;  2MJI A;  2ZAG A;  3BX7 A;  3RBY A;  4NNT A;  1SWD A;  1Y9L A;  2OL6 O;  3O19 A;  1KL4 A;  2WWP A;  1EPA A;  1ZNK A;  1G7N A;  1KFF A;  1ALB A;  3OE3 A;  1ZNL A;  3CKF A;  1LIF A;  4I9R A;  3K3L A;  2AT5 X;  3FA9 A;  5B2A O;  5IRW A;  2LBA A;  4HFO A;  4ORR A;  5HZ6 A;  5BVQ A;  1X8P A;  3VHI A;  4YH0 A;  2POA A;  4RUU A;  1LDQ A;  3QQ2 A;  1VWJ B;  3F8A A;  5LJG A;  1JV4 A;  4NNS A;  4AZQ A;  1W5R A;  4NP1 A;  2MHD A;  5HCC C;  1UZ2 X;  2KTD A;  3WBG A;  2PY1 A;  1G74 A;  2JOZ A;  3RDX A;  4CDF A;  1OBP A;  2RTA A;  4O49 A;  3ZUI A;  1KT7 A;  2RTF B;  2Y3F A;  3S5X A;  4KC8 A;  4OS0 A;  4KH8 A;  1MDC A;  2UYW A;  4IAW A;  4A8Z A;  3ZW0 A;  4EFG A;  3U03 A;  5H9N A;  4U8U M;  2EU7 X;  1T8V A;  1VWL B;  1SLE B;  5LKF A;  1RAV A;  1QQS A;  4GGZ A;  5LKE A;  3FR2 A;  2FWV A;  3PH6 A;  1N0S A;  3ZW1 A;  2A8G A;  2X46 A;  4HPB A;  5H9A A;  4BQU A;  2GTL M;  1YWB A;  1YWC A;  1FTP A;  3RDU A;  4AW8 A;  3P02 A;  4I3B A;  1YP7 A;  4OMX A;  1LFO A;  2AF5 A;  4Y0P A;  4BGF A;  2X4M A;  3T2X A;  1SY2 A;  2N93 A;  5HAE A;  4QQ1 A;  2IZE B;  4CK4 A;  5LJK A;  3SLO A;  3PED A;  3KVN A;  2WEW A;  1E00 A;  1SA8 A;  1WBI A;  4ORW A;  4HPA A;  4ORS A;  1QFT A;  2FR3 A;  1SY3 A;  2LFO A;  4D6B A;  5FEN A;  1LUQ A;  2WQA E;  1KZX A;  4BOE A;  4ZHD A;  3VPJ E;  1WUB A;  4ALO A;  1E2T A;  2BS5 A;  3T2W A;  1GKA B;  5LJC A;  1KGL A;  1XKI A;  2HZR A;  3VG6 A;  4O4X A;  1LCZ A;  3MM0 A;  4ZHH A;  3PH5 A;  5CE4 A;  4AYH A;  2K23 A;  1KL5 A;  4WFV A;  1VWM B;  3FEK A;  4CDC A;  3B2L A;  2A2U A;  1PEE A;  1MM9 A;  3BU1 A;  2KT4 B;  4BX6 B;  5B27 A;  1SWP A;  3HWF A;  4OEL A;  1VYG A;  2DJF A;  3RSW A;  1CJ5 A;  1PBY A;  3VG4 A;  1SWL A;  1SWT A;  4HPC A;  1VWF B;  1GT5 A;  3CBC A;  4IB7 A;  1SRH A;  3B2K A;  4TJZ A;  3VE2 A;  3ZUO A;  1JJJ A;  1W6F A;  2WEX A;  4U3Q A;  5F2B A;  5B29 A;  1B56 A;  4HPD A;  1ZNG A;  4YFR A;  2MWH A;  4AZN A;  3CKG A;  1X8U A;  1RXH A;  4FGI B;  1JBH A;  2AL0 X;  2RN4 A;  4YBP A;  3P6F A;  3BLG A;  2R74 A;  2Y3E A;  3WOV A;  4Z2O A;  1OPA A;  5BVT A;  2VFB A;  4JHQ A;  3VHH A;  3E3C A;  2ANS A;  2G8C O;  1EAL A;  2DJG A;  4ZJ0 A;  3CQR A;  1A57 A;  1DZM A;  4M7M A;  4CPH B;  1R0U A;  2QMI A;  4MVL A;  5KID A;  2BHV A;  2FHN X;  2BT9 A;  1RXK A;  4KII A;  5HZ5 A;  1QWD A;  1GX8 A;  4EDE A;  1JYJ A;  1RXJ A;  3Q6L A;  4O3Z A;  1KOI A;  4U8U O;  3MG5 A;  5D45 A;  1X8Q A;  2RCQ A;  2F01 A;  4WFU A;  1E06 A;  1SY1 A;  5CSE A;  4TKH A;  1IFC A;  2RTC B;  3X00 A;  2GTL O;  3AUM O;  1STR B;  3V8U A;  5C0N A;  4YDB A;  1PTS A;  1SXU A;  2FT9 A;  3S5V A;  5AJC A;  1CBQ A;  4YFP A;  1TXL A;  2RTB B;  1D3S A;  4EEJ A;  2F73 A;  4WBK A;  1MX8 A;  1JIW I;  4A60 A;  1DZJ A;  1N9M A;  2GH7 A;  3I0A A;  1BJ7 A;  2L9C A;  5BVS A;  4PSQ A;  1VWN B;  3RDQ A;  2FTB A;  1SWU A;  1FEM A;  2Z4I A;  4YBU A;  5EDB A;  5FQ8 E;  3WYP A;  1ZNH A;  3FR4 A;  4XMC A;  1NDJ A;  3CBS A;  4YFQ A;  5FQ6 E;  1TOU A;  2QO5 A;  1SWS A;  1MEP A;  4IAB A;  5F6B A;  1LPJ A;  4UU3 A;  5B5G A;  1IW2 A;  2K62 A;  3SLT A;  1BM5 A;  2X8F A;  3B2J A;  2W2F A;  2I5V O;  3EM0 A;  4QGX A;  4TKB A;  1U0X A;  4YGZ A;  2CBR A;  4I95 A;  1VWG B;  4NYQ A;  4GE1 A;  1SRJ A;  3OJY C;  4MIR A;  1GKA A;  3ZQ3 A;  1HQQ A;  3HOL A;  4O4O A;  4EXZ A;  4Z27 A;  3FW5 A;  3RDS A;  2IZK A;  1SXY A;  4A1H A;  4COT A;  3APX A;  4GH7 A;  3L4R A;  4GZV A;  4MVK A;  3APU A;  5HCD C;  5D48 A;  4CPE A;  4BX6 A;  3ZI8 A;  2RA6 A;  4ZFX A;  1I04 A;  2AVI A;  3RE5 A;  2KTS A;  5B3M O;  4DCB A;  1JJU A;  1X71 A;  4ES7 A;  4ZGU A;  2VDF A;  2IZH B;  3WZQ A;  3PPT A;  4FQB B;  2RTH B;  1SWQ A;  2RCT A;  4KC7 A;  4XMD A;  2A5B A;  2QO4 A;  1BSO A;  1GGL A;  5L8O A;  1DF3 A;  1STS B;  1KQX A;  2JMB A;  2KW1 A;  2OL8 O;  2RQ0 A;  3FR5 A;  3NR3 A;  1U17 A;  4ORX A;  4BCS A;  5IO6 A;  1DF8 A;  3C76 X;  1EII A;  2R56 A;  5KIC A;  3H3I A;  2Y32 A;  1B0O A;  1G5W A;  5LJB A;  4GK9 A;  5L8N A;  3NBX X;  1JQP A;  1N43 A;  4CPH A;  4ODD A;  1ICM A;  4I9S A;  3BU9 A;  1HY2 A;  4O3X B;  4O4U A;  1DFV A;  4YDA A;  5F6Z A;  5D4A A;  3RWX A;  3ZZV A;  1A3Y A;  2CZT A;  2Q9S A;  3TGC A;  2OVA A;  3HWD A;  1SWH A;  3P24 A;  3U9P C;  4IAX A;  4ON1 A;  2RTD B;  2X55 A;  2OL7 A;  3VE1 A;  1LEL A;  4BX7 B;  1LCV A;  4BX5 B;  4U8U N;  2FRS A;  1IJ8 A;  1UYN X;  1O1V A;  1ZND A;  2KD2 A;  5B10 O;  3F9D A;  1JJX A;  3VG3 A;  2FR2 A;  2GTL N;  1SWK A;  2FGS A;  2UZ2 A;  3FEN A;  1FEN A;  3IA8 A;  1E5P A;  2MF6 A;  2RTI B;  2AT6 X;  4NLI A;  3OD9 A;  2X45 A;  3ZWE A;  4MVI A;  3UEW A;  1VWA B;  2YMS A;  3C78 X;  3ELX A;  1FE3 A;  1VWQ B;  2MM3 A;  5EEE A;  4CSB A;  1GM6 A;  1MVG A;  4IMN A;  1MX7 A;  1JMX A;  3PQU A;  1SWA A;  4MIS A;  5F7G A;  2JW1 A;  1O8V A;  4EQA C;  2AT0 X;  1SWN A;  2RTJ A;  3FEL A;  1HBQ A;  2RTL A;  2X34 A;  5HTE A;  4JO6 A;  2CAM A;  2BLG A;  3SOT A;  4I60 A;  3P6H A;  4Y59 A;  3NAD A;  1CBS A;  1ACD A;  4D6A A;  4GKC A;  2FHL A;  3GE2 A;  1VWP B;  1EPB A;  2E4J A;  4GGT A;  1NC9 A;  1QAB E;  2CM9 A;  2JN3 A;  5HZQ A;  3P6C A;  4LZU A;  3WJG A;  4OEM A;  2A3F X;  1ICN A;  4IB6 A;  3HOE A;  1FEL A;  3MVF A;  4NLJ A;  5AJB A;  2AH7 X;  4XME A;  4DQ4 A;  5HZ8 A;  3FLL A;  2RTO B;  1OBQ A;  4NV8 A;  1H91 A;  4KCA A;  4Y5D A;  3FIQ A;  4LZV A;  4OMW A;  3UEU A;  2XST A;  1ERX A;  3WJF A;  4CDD A;  5L3Y A;  4GNY A;  1AVG I;  1O1U A;  2IZL B;  1ML7 A;  2AKQ A;  3EW1 A;  3SAO A;  1QY2 A;  3VG5 A;  4GNW A;  4ZHF A;  3I17 A;  2WSJ A;  2WPU A;  4M6S A;  1GXA A;  1LF7 A;  4O4S A;  3MBT A;  1NP4 A;  5FFH A;  2L5P A;  5IXG A;  1BRP A;  3JS1 A;  3NX1 A;  2OFR X;  3P6E A;  2A2G A;  4Z2P A;  5L8I A;  3AEH A;  1SWR A;  4DNE A;  2I5Z O;  2ZAI A;  1VWK B;  3LTW A;  4GJS A;  4QYP A;  1N7Y A;  4FBO A;  5LJD A;  1KT4 A;  3D4R A;  4GDA A;  4ZHG A;  1X89 A;  4IB9 A;  1BLR A;  2CM4 A;  4DQ3 A;  2IFB A;  5AEO A;  2RTK A;  4MVE A;  1PMP A;  4N7D A;  2IZD B;  3NQ3 A;  4INN A;  1SWE A;  3ZW2 A;  3SZH A;  3NP1 A;  1KXO A;  1Y55 X;  3WZN A;  1TW4 A;  2Q2M A;  3UAQ A;  1I9H A;  2BSZ A;  4LQZ A;  2A5C A;  2Q39 A;  4AZO A;  4IB8 A;  5HCE C;  4TQ2 A;  4JNJ A;  2NP1 A;  1AVE A;  1GT3 A;  4GRJ A;  2JU7 A;  4QZU A;  5LJH A;  4BX7 A;  2O62 A;  4ZGF A;  2ASN X;  3FDC A;  4AZM A;  4BX5 A;  1BEB A;  3PEC A;  1ZNE A;  3WZP A;  4TNN A;  1CBR A;  2LA7 A;  5FQ7 E;  5HA0 A;  1AQB A;  2F09 A;  5BYP A;  4ZCB A;  4PJ2 A;  1SLF B;  1RLB E;  3WXQ A;  1BSY A;  3KFG A;  5EZ2 A;  3PDF A;  2HLV A;  1SMP I;  1KL3 A;  1RST B;  3EYC A;  3CR6 A;  3IFB A;  1KT6 A;  2AT3 X;  2P8G A;  2RTM A;  2L68 A;  1T68 X;  4GJV A;  1I05 A;  4QYN A;  4QZT A;  5CHK A;  4NW4 A;  4QRL A;  3VGW A;  2IZA A;  3SZJ A;  4O3W A;  1SY0 A;  3D96 A;  4LKT A;  2XKL A;  4ZH6 A;  1U18 A;  3CQN A;  1D2U A;  3O2Y A;  1L6M A;  1P6P A;  5EDC A;  3CWK A;  4ML7 B;  1OPB A;  1VYO A;  1XCA A;  1RBP A;  4C5P A;  3P6G A;  5AQ6 A;  1UYO X;  5EPQ A;  2HKD A;  2OYB O;  1EW3 A;  1DZP A;  3HWG A;  3N91 A;  1SRE A;  4CPF A;  4I3D A;  1YWA A;  5D47 A;  1MUP A;  4A1Y A;  1BWY A;  1BSQ A;  1SXW A;  3KFI A;  4IRW A;  4ORY A;  2OVS A;  1LIB A;  1PM1 X;  2RTN B;  4GDZ A;  3KQ0 A;  1NQM A;  3WJD A;  1Y52 X;  5LJE A;  2WUT A;  4NYR A;  3BRN A;  1NGL A;  2OVE A;  2A0A A;  2ACO A;  1LDO A;  1IKJ A;  2LBV A;  2QM9 A;  5H9K A;  1YWD A;  3T1D A;  1OEK A; 
#chains in the Genus database with same CATH homology
 5D8J A;  4FBR A;  3LV4 A;  2W2B A;  1OEE A;  4ZHC A;  1IIU A;  1FDQ A;  3S60 A;  2DM5 A;  3C77 X;  3FW4 A;  2BS6 A;  4RUN A;  1SXX A;  4FBV A;  3ELZ A;  4L3R A;  2W2A A;  4IBA A;  3EMM A;  3FA8 A;  4YGG A;  3KFF A;  4QGV A;  3MX7 A;  1QG5 A;  3LHN A;  1PBO A;  1KZW A;  1GX9 A;  3AKM A;  4WHI A;  2WQ9 A;  4N7C A;  1S2P A;  3B2I A;  3NQ9 A;  1DV9 A;  1Y9T A;  4BVM A;  3VU1 A;  3JSQ A;  4ARH A;  1X8N A;  3AKN A;  4TKJ A;  2WR6 A;  3QKG A;  5HBS A;  5HZ9 A;  4JGL A;  4GU8 A;  1ERB A;  4UU2 A;  1GT1 A;  3WVM A;  1YUP A;  1I4U A;  1JZU A;  1QFV A;  4R0B A;  3STN A;  1VPR A;  1LKE A;  5JR8 A;  2QOS C;  3U0D A;  1EIO A;  5HA1 A;  2JU3 A;  2GJ5 A;  4YCH A;  2M4L A;  3FA6 A;  4Y0R A;  2JU8 A;  3STM X;  5HTD A;  1VYF A;  4L1N A;  1KQW A;  3FYF A;  5IO7 A;  2GTF X;  3STK A;  2HNX A;  2NNE A;  2G7B A;  1HQP A;  1CBI A;  3NQK A;  2Z4H A;  1JYD A;  2ALL X;  5CYB A;  1LIC A;  3HTY A;  1S44 A;  1E02 A;  3VG7 A;  3WJE A;  4LKP A;  4KT5 A;  3BDR A;  3BS2 A;  3BY0 A;  3EBW A;  1NP1 A;  1TOW A;  1EI5 A;  4IMO A;  1LNM A;  4I6S A;  5DG4 A;  5EED A;  3OBL A;  1YIV A;  3D97 A;  4U9C A;  1X8O A;  2L67 A;  1BRQ A;  2CZU A;  1AEL A;  3NX2 A;  1A18 A;  1EXS A;  5F1E A;  3TF6 A;  3TGA A;  3O22 A;  2LKK A;  4OS8 A;  2OFM X;  1QY1 A;  2FLJ A;  2NNQ A;  3PQS A;  1I06 A;  3NPO A;  3F6Z B;  4GET A;  3DTQ A;  1GT4 A;  3BSZ E;  4ZH9 A;  2QO6 A;  3D95 A;  4Y0Q A;  2FS7 A;  3APW A;  3HK1 A;  2X8S A;  3UEV A;  2G78 A;  4YKM A;  3BX8 A;  4AZR A;  4CV7 A;  2HMB A;  1EQD A;  1B4M A;  3CMP A;  5HWZ A;  1IKE A;  1OEJ A;  3DSZ A;  2Q4N A;  2ACP X;  1HMT A;  3KFH A;  3KZA A;  2G79 A;  4TLJ A;  4O3Y A;  3ZW0 B;  1BBP A;  2FS6 A;  2X8T A;  1S7D A;  5IO5 A;  3JQO A;  3G7X A;  3GAQ A;  4QGW A;  3APV A;  4HWM A;  1EUO A;  3PP6 A;  1HBP A;  3UEX A;  1QY0 A;  2CBS A;  2MO5 A;  5F58 A;  3ZW1 B;  3VG2 A;  3RKG A;  1URE A;  3P6D A;  4K19 A;  4ZHF A;  5H8T A;  4ORU A;  5H9L A;  4YGH A;  5K06 A;  3FA7 A;  1HN2 A;  2RD7 C;  2A13 A;  5FAZ A;  1T0V A;  3WJC A;  1TVQ A;  1G85 A;  1KT3 A;  4YMY A;  2OVD A;  4ID2 A;  1YP6 A;  2AMM X;  4XMH A;  2GC9 A;  1IFB A;  1CRB A;  2AT8 X;  2YG2 A;  4QNI A;  2HZQ A;  3WJB A;  3EBK A;  5KHP A;  2OZQ A;  3S26 A;  1KT5 A;  3RZY A;  1ZRY A;  4I3C A;  4AZP A;  3HWE A;  4Y0S A;  5DPQ A;  2R73 A;  1LID A;  1B8E A;  1LIE A;  3B2H A;  4ZR2 A;  3TGB A;  3TZS A;  1DZK A;  1ADL A;  4XMF A;  1DC9 A;  2NND A;  3FEP A;  1AB0 A;  4QAE A;  1HMS A;  1A2D A;  1Z24 A;  4XMG A;  4O9S A;  2LB6 A;  4OS3 A;  4YKO A;  4YCE A;  1OBU A;  3FMZ A;  1HMR A;  2HYS A;  2Q2P A;  2MJI A;  2ZAG A;  3BX7 A;  3RBY A;  4NNT A;  1Y9L A;  3O19 A;  2WWP A;  1EPA A;  1ZNK A;  1G7N A;  1ALB A;  3OE3 A;  1ZNL A;  1LIF A;  4I9R A;  3K3L A;  2AT5 X;  3FA9 A;  2LBA A;  4HFO A;  4ORR A;  5HZ6 A;  5BVQ A;  1X8P A;  4YH0 A;  2POA A;  4RUU A;  3F8A A;  5LJG A;  1JV4 A;  4NNS A;  4AZQ A;  4NP1 A;  2MHD A;  5HCC C;  1UZ2 X;  2KTD A;  3WBG A;  2PY1 A;  1G74 A;  2JOZ A;  1OBP A;  4O49 A;  3ZUI A;  1KT7 A;  3S5X A;  4KC8 A;  4OS0 A;  4KH8 A;  1MDC A;  4IAW A;  4A8Z A;  3ZW0 A;  4EFG A;  3U03 A;  5H9N A;  4U8U M;  2EU7 X;  1T8V A;  5LKF A;  1QQS A;  5LKE A;  3FR2 A;  2FWV A;  3PH6 A;  1N0S A;  3ZW1 A;  2X46 A;  4HPB A;  5H9A A;  4BQU A;  2GTL M;  1YWB A;  1YWC A;  1FTP A;  4AW8 A;  3P02 A;  4I3B A;  1YP7 A;  4OMX A;  1LFO A;  4Y0P A;  1SY2 A;  2N93 A;  5HAE A;  4QQ1 A;  4CK4 A;  5LJK A;  3PED A;  2WEW A;  1E00 A;  1SA8 A;  4ORW A;  4HPA A;  4ORS A;  1QFT A;  2FR3 A;  1SY3 A;  2LFO A;  4D6B A;  5FEN A;  2WQA E;  1KZX A;  4BOE A;  4ZHD A;  3VPJ E;  4ALO A;  2BS5 A;  1GKA B;  5LJC A;  1KGL A;  1XKI A;  2HZR A;  3VG6 A;  4O4X A;  4ZHH A;  3PH5 A;  5CE4 A;  4AYH A;  2K23 A;  4WFV A;  3FEK A;  3B2L A;  2A2U A;  1PEE A;  3BU1 A;  2KT4 B;  5B27 A;  3HWF A;  1VYG A;  3RSW A;  1CJ5 A;  3VG4 A;  4HPC A;  1GT5 A;  3CBC A;  4IB7 A;  4TJZ A;  3B2K A;  3VE2 A;  3ZUO A;  1JJJ A;  2WEX A;  4U3Q A;  5B29 A;  1B56 A;  4HPD A;  1ZNG A;  4YFR A;  2MWH A;  4AZN A;  4FGI B;  1X8U A;  1JBH A;  2AL0 X;  2RN4 A;  4YBP A;  3P6F A;  3BLG A;  2R74 A;  3WOV A;  1OPA A;  5BVT A;  3E3C A;  2ANS A;  1EAL A;  4ZJ0 A;  3CQR A;  1A57 A;  1DZM A;  4M7M A;  1R0U A;  2QMI A;  4MVL A;  5KID A;  2BHV A;  2BT9 A;  4KII A;  1QWD A;  1GX8 A;  4EDE A;  1JYJ A;  3Q6L A;  4O3Z A;  1KOI A;  4U8U O;  5D45 A;  1X8Q A;  2RCQ A;  4WFU A;  1E06 A;  1SY1 A;  4TKH A;  1IFC A;  2GTL O;  3V8U A;  5C0N A;  4YDB A;  1SXU A;  2FT9 A;  3S5V A;  5AJC A;  1CBQ A;  4YFP A;  1TXL A;  1D3S A;  4EEJ A;  2F73 A;  4WBK A;  1MX8 A;  1JIW I;  4A60 A;  1DZJ A;  3I0A A;  1BJ7 A;  2L9C A;  5BVS A;  4PSQ A;  2FTB A;  1FEM A;  2Z4I A;  4YBU A;  5EDB A;  5FQ8 E;  1ZNH A;  3FR4 A;  4XMC A;  3CBS A;  4YFQ A;  5FQ6 E;  1TOU A;  2QO5 A;  4IAB A;  5F6B A;  1LPJ A;  4UU3 A;  1IW2 A;  2K62 A;  1BM5 A;  2X8F A;  3B2J A;  2W2F A;  3EM0 A;  4QGX A;  4TKB A;  1U0X A;  4YGZ A;  2CBR A;  4I95 A;  4NYQ A;  4GE1 A;  3OJY C;  4MIR A;  3ZQ3 A;  1GKA A;  3HOL A;  4O4O A;  4EXZ A;  3FW5 A;  1SXY A;  4A1H A;  4COT A;  3APX A;  4GH7 A;  3L4R A;  4GZV A;  4MVK A;  3APU A;  5HCD C;  5D48 A;  3ZI8 A;  2RA6 A;  4ZFX A;  1I04 A;  2KTS A;  1X71 A;  4ES7 A;  4ZGU A;  3PPT A;  4FQB B;  2RCT A;  4KC7 A;  4XMD A;  2QO4 A;  1BSO A;  1GGL A;  5L8O A;  1DF3 A;  2JMB A;  1KQX A;  3NR3 A;  2KW1 A;  2RQ0 A;  3FR5 A;  4ORX A;  1U17 A;  5IO6 A;  1EII A;  3C76 X;  2R56 A;  5KIC A;  3H3I A;  1B0O A;  1G5W A;  5LJB A;  4GK9 A;  5L8N A;  3NBX X;  4ODD A;  1ICM A;  4I9S A;  3BU9 A;  4O3X B;  4O4U A;  1DFV A;  4YDA A;  5F6Z A;  5D4A A;  3RWX A;  3ZZV A;  1A3Y A;  2CZT A;  2Q9S A;  3TGC A;  2OVA A;  3HWD A;  3P24 A;  3U9P C;  4IAX A;  4ON1 A;  3VE1 A;  4U8U N;  2FRS A;  1O1V A;  1ZND A;  2KD2 A;  3F9D A;  1JJX A;  3VG3 A;  2FR2 A;  2GTL N;  4LZU A;  3FEN A;  1FEN A;  3IA8 A;  1E5P A;  3ZWE A;  4NLI A;  2AT6 X;  3OD9 A;  2X45 A;  4MVI A;  3UEW A;  2YMS A;  3C78 X;  3ELX A;  1FE3 A;  2MM3 A;  5EEE A;  4CSB A;  1GM6 A;  1MVG A;  4IMN A;  1MX7 A;  5F7G A;  3PQU A;  4MIS A;  4EQA C;  5HZ5 A;  2JW1 A;  1O8V A;  2AT0 X;  3FEL A;  1HBQ A;  5HTE A;  2BLG A;  3SOT A;  3P6H A;  3NAD A;  1CBS A;  1ACD A;  4D6A A;  4GKC A;  3GE2 A;  1EPB A;  2E4J A;  5HZQ A;  1QAB E;  2CM9 A;  2JN3 A;  3P6C A;  3WJG A;  2AH7 X;  2A3F X;  1ICN A;  4IB6 A;  3HOE A;  1FEL A;  3MVF A;  4NLJ A;  5AJB A;  4XME A;  4DQ4 A;  5HZ8 A;  3FLL A;  1OBQ A;  1H91 A;  4KCA A;  3WJF A;  3FIQ A;  4LZV A;  4OMW A;  3UEU A;  2XST A;  1ERX A;  4GNY A;  1AVG I;  1O1U A;  1ML7 A;  2AKQ A;  3SAO A;  1QY2 A;  3VG5 A;  4GNW A;  3I17 A;  2WSJ A;  4M6S A;  1GXA A;  1LF7 A;  4O4S A;  3MBT A;  1NP4 A;  5FFH A;  2L5P A;  1BRP A;  3JS1 A;  3NX1 A;  2OFR X;  3P6E A;  2A2G A;  5L8I A;  2ZAI A;  4QYP A;  4FBO A;  5LJD A;  1KT4 A;  3D4R A;  4ZHG A;  1X89 A;  4IB9 A;  1BLR A;  2CM4 A;  4DQ3 A;  2IFB A;  5AEO A;  4MVE A;  1PMP A;  4N7D A;  3NQ3 A;  4INN A;  3ZW2 A;  3NP1 A;  1KXO A;  1TW4 A;  2Q2M A;  3UAQ A;  4LQZ A;  2Q39 A;  4AZO A;  4IB8 A;  5HCE C;  4TQ2 A;  5LJH A;  2NP1 A;  4GRJ A;  1GT3 A;  2JU7 A;  4QZU A;  2O62 A;  4ZGF A;  2ASN X;  4AZM A;  1BEB A;  3PEC A;  1ZNE A;  4TNN A;  1CBR A;  2LA7 A;  5FQ7 E;  5HA0 A;  1AQB A;  2F09 A;  5BYP A;  4ZCB A;  4PJ2 A;  1RLB E;  3WXQ A;  1BSY A;  3KFG A;  5EZ2 A;  2HLV A;  1SMP I;  3EYC A;  3IFB A;  4ALB A;  3CR6 A;  1KT6 A;  2AT3 X;  2P8G A;  4QYN A;  2L68 A;  1T68 X;  4QZT A;  1I05 A;  4NW4 A;  4QRL A;  4O3W A;  1SY0 A;  3D96 A;  4LKT A;  2XKL A;  4ZH6 A;  1U18 A;  3CQN A;  1D2U A;  3O2Y A;  1L6M A;  1P6P A;  5EDC A;  3CWK A;  4ML7 B;  1OPB A;  1XCA A;  1RBP A;  3P6G A;  5AQ6 A;  5EPQ A;  1EW3 A;  1DZP A;  3HWG A;  3N91 A;  4I3D A;  1YWA A;  5D47 A;  1MUP A;  4A1Y A;  1BWY A;  1BSQ A;  1SXW A;  3KFI A;  4ORY A;  2OVS A;  1LIB A;  1PM1 X;  4GDZ A;  3KQ0 A;  3WJD A;  5LJE A;  2WUT A;  4NYR A;  3BRN A;  1NGL A;  2OVE A;  2A0A A;  2ACO A;  2LBV A;  1IKJ A;  2QM9 A;  5H9K A;  1YWD A;  3T1D A;  1OEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...