4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
1ZCMA 1PPOA 2PADA 4G54A 1AU2A 3PDFA 4AXLA 3P5WA 1F2CA 2B1NA 2G8EA 3I3TA 2FTDA 2DZZA 1QDQA 4YYVA 2DCBA 4MZOA 1BP4A 3N3KA 2GFOA 3V6EA 1NPZA 1YK8A 1EF7A 4I07A 4P6EA 1CSBB 3U8EA 3B79A 2P0RA 3OF9A 5JH3A 5PADA 1BY8A 2DCCA 3IV2A 3AI8A 3GCBA 2FUDA 3IUTA 3P5XA 2NQGA 1AIMA 4RY2A 1K3BB 2YJCA 1BQIA 1CVZA 2ATOA 1XKGA 2G7YA 3RVWA 3S3QA 5K16A 4BSQA 1F2BA 3KWZA 3OVZA 1NQCA 3IHPA 1F2AA 2R6NA 2HHNA 2AUXA 2F7DA 3O0UA 1Y4HA 2Y6EA 1MS6A 3H8BA 4MSXA 1VJVA 1SP4B 5CVOB 4QBBA 4ZUXU 1GLOA 4QRXA 4PP2E 3P5VA 2ARYA 1DF0A 1PPPA 2FYEA 1ATKA 3H89A 1YT7A 3OVXA 2OULA 5CHVA 2P7UA 2GHUA 1KFUL 1Y08A 3HWNA 3OISA 1HUCB 4K7CA 3MORA 2B1MA 2DJGB 4W4UA 3KW9A 4X6IA 3BC3A 1EWPA 1K3BA 2DCDA 2VHSA 3PNRA 2E00A 2H7JA 2FO5A 1U9QX 5CHTA 2E01A 3BPMA 2R9OA 3H8CA 4DMXA 2DJFB 3E1ZB 1CB5A 1NB3A 3N3GA 3WXFA 2E02A 1PADA 1AECA 3IOQA 4YYWA 2R9CA 2HXZA 1BGOA 2PNSA 4CZWA 2XU5A 2AYOA 2R9MA 1PPNA 2O6XA 1A6RA 1CTEA 4YYSA 1F29A 4N79A 4QRGA 3LXSA 4FJCA 4CDDA 1TL9A 1U9WA 2XU1A 1U9VA 4QRVA 3QJ3A 3M99A 1AU0A 1PPDA 4XUIA 1CPJA 2FQ9A 2XU4A 4I04A 3C9EA 3IEJA 2AS8A 4Q8HA 1U9XA 3V6CA 2FT2A 2AVWA 4CDEA 3MTNA 1EWOA 4BS5A 3KSEA 2AIMA 1VSNA 3TNXA 2CIOA 4BPVA 2Y5BA 5F02A 2AYNA 5FPWA 3CH2X 3CH3X 1JQPA 4CDDB 2BDZA 2DC7A 1ZIVA 2AU1A 2PREA 2NQDB 5CVNB 4CDFA 3BCNA 1AU3A 1YVBA 2DZYA 1IWDA 2VHFA 4HWYA 3QSDA 9PAPA 3S3RA 5A24A 3I06A 4W5CA 4N4ZA 1ME3A 1AU4A 3D6SA 2FRQA 2ACTA 2E03A 4N8WA 3HHIA 1PE6A 1MIRA 3KKUA 3ZUAA 1QXPA 3CBKA 2YJ2A 4PADA 3WXEA 2DJFA 3NHEA 2DC9A 3BOWA 2G8JA 3MHSA 3PBHA 1KHQA 4WA6A 4FIPA 6PADA 2YJ8A 2OP3A 1MDWA 2YJBA 1MEGA 1KXRA 4AXMA 1X9YA 1MHWA 2AUZA 2R9NA 1GCBA 3IMAA 1PXVA 1ME4A 4QH6A 1NLJA 2HH5A 2YJ9A 4MZSA 1DEUA 4OELA 2NQAA 1AYUA 1QOLA 1KHPA 1QMYA 3CBJA 2DC8A 1THEA 2P86A 3KWBX 4P6GA 1PIPA 4CDEB 1STFE 1KFXL 1MEMA 1O0EA 3RVXA 1POPA 5J94A 4YVAA 2WBFX 4W5BA 4X6JA 4BS6A 2NQIA 4YV8A 4Q8GA 1NB5A 2PBHA 3DF0A 3K24A 3USVA 2CB5A 4X6HA 1GECE 2HD5A 3HD3A 1GMYA 2JQFR 2F1GA 4YYQA 1NL6A 4CDCA 1CJLA 1TLOA 3LFYA 3OF8A 2DC6A 1EWLA 5EGWA 2BDLA 4BQVA 7PCKA 3O1GA 1YALA 1EWMA 3ERVA 2OZ2A 2DCAA 3K9MA 3K8UA 3HHAA 5CVMA 4YYUA 4KLBA 4YYRA 1PBHA 1ICFA 3MHHA 3KX1A 4OEMA 3H6SA 1S4VA 1YK7A 4PI3A 4PP1A 2R9FA 3KFQA 8PCHA 4FK5A 1U5IA 3WXGA 1TU6A 3N4CA 1SNKA 3P5UA 1AYVA 3PW3A 3F75A 3QT4A 4DMYA 2JQGR 4CDCB 1M6DA 3F5VA 1CS8A 1PCIA 1CQDA 1AYWA 4CDFB 3H7DA 5JA7A 1ITOA 1FH0A 2DJGA 5EF4A 4I05A 3BPFA 1Q6KA 1CV8A 2XU3A 2C0YA 2IBIA 3BWKA 4XR7A 2G6DA 2IPPB 2FRAA 3RVVA
chains in the Genus database with same CATH superfamily
1PPOA 4G54A 1AU2A 1SWEA 1TXLA 5LKFA 1HXZA 2FR3A 2G8EA 4EDEA 1BP4A 1ALBA 3B2IA 1MOYA 4P6EA 3U8EA 2X34A 4AZPA 3WJGA 1QABE 2FUDA 5HCEC 2NQGA 1SA8A 2KTDA 5E6JA 3LV4A 1HN2A 1JMZA 4FGIB 1VYGA 1PTSA 2ATOA 1XKGA 1X8QA 4U8UN 3NQ3A 3RVWA 3S3QA 1ZNKA 3NX2A 4Y0SA 4O4OA 4YH0A 3OVZA 4IUMA 2FR2A 2AF5A 1KL5A 2AUXA 4A1YA 3TRKA 1Y4HA 3H8BA 1ICMA 1IIUA 3BY4A 1VWLB 1SP4B 2QO4A 5CVOB 2P8GA 4ZUXU 3Q6LA 4TKJA 4PP2E 4RKXA 1O1UA 3SOTA 1ATKA 3H89A 3TZSA 3PP6A 5HAEA 3BSZE 4I3BA 2WPUA 2WEWA 2VDFA 4I95A 1KFUL 3NPOA 1Y0GA 5HTEA 4K7CA 3MORA 2A8GA 1LFOA 4W4UA 3KW9A 2HZRA 4BCSA 3BLGA 2Z84A 4QRLA 3PNRA 1E06A 2E00A 1SWFA 1Z24A 2FO5A 4WFUA 1H91A 2QCBA 3BPMA 2W2AA 1VWOB 2VFCA 3SLOA 4MISA 4O49A 3WXFA 2O62A 3BY0A 1B0OA 4BX5A 1YWCA 5B11O 3IOQA 3K3LA 4LZVA 1NQNA 2HXZA 4GDZA 2FHLA 1FDQA 2AYOA 2X46A 1E02A 1MK5A 4N79A 3STMX 4CDDA 4GGZA 4QRVA 5EDCA 1PPDA 1R0UA 5LJDA 5EPQA 1LIFA 4ODDA 4OVZA 4I9RA 1VWKB 4IB7A 2WWPA 5F6BA 2XSTA 2FGSA 4NLIA 2FT2A 1EWOA 1D2UA 1O1VA 2VFBA 3TNXA 1E5PA 4BPVA 2N93A 2RTGB 3CH2X 3CH3X 1JQPA 2DC7A 2A5CA 2QOMA 2AU1A 1MX8A 4QZTA 3GE2A 1SXWA 2GTLM 1OEEA 5HZ8A 1G5WA 2CM9A 1YVBA 3EMMA 4Y59A 1N43A 5K67A 1SRJA 4JO6A 2KW1A 1Y52X 2WSJA 9PAPA 3UEWA 4GZVA 2HWKA 1A2DA 2BLGA 4N4ZA 5AQ6A 1ME3A 2JU3A 2AT8X 3S5XA 2OFAA 2ACTA 4QZUA 1RLBE 2K62A 2QOSC 1AVGI 3C76X 1NGLA 2OZQA 3ZW2A 5HCCC 3EBKA 4FBRA 3CBKA 2BTWA 2A2UA 4GD9A 3BOWA 2X4MA 1KHQA 2RQ0A 3JQOA 2F73A 4WA6A 3FELA 3HTYA 4FIPA 1GKAA 2OP3A 1D3SA 5IRWA 3VG4A 2YJBA 5F7GA 1PMPA 1MEGA 3TGCA 5LJBA 2IZIA 1EI5A 1MHWA 1Y53X 3BRNA 5JZEA 1GCBA 1S44A 4CPFA 1PXVA 4U46A 2YG2A 3P6GA 1NLJA 4YCHA 4EQAC 1DEUA 1LDQA 1SWTA 4ZGFA 3WJCA 1QOLA 1KHPA 4O3WA 4YBUA 2DC8A 3B2KA 1THEA 4U8UM 4P6GA 1KFXL 1MEMA 1VWPB 3MBTA 1A18A 1AVDA 1IKEA 4W5BA 4YGGA 4X6JA 4XMHA 2NQIA 4YV8A 4ES7A 2A5BA 5C0NA 1FELA 4JGLA 3WJFA 1KQWA 2CZUA 2CB5A 4O3ZA 1GECE 5B29A 4DQ4A 1GMYA 3PK2A 4HFOA 2F1GA 1DC9A 4YYQA 2G5LA 1CJLA 1TLOA 2BU3A 5LJCA 3NQ9A 2ANSA 4BVMA 1UREA 4CV7A 4AZNA 2AT3X 2AL0X 2FT9A 2LFOA 4YDAA 1YALA 3K9MA 3HHAA 5CVMA 4A5UA 3HWDA 2CM4A 4ID2A 4D6BA 3OQCA 4O4UA 4GNWA 3FR4A 2K23A 3WJEA 1B4MA 2BS5A 2AT5X 2OY8A 3WVMA 3WXGA 3N4CA 1OSPO 1SNKA 3PW3A 1AYVA 2CAMA 3B2HA 4KCAA 2GTLN 2AVIA 3F75A 3QT4A 3C78X 4GGRA 2JQGR 1B8EA 1M6DA 4MVLA 1PCIA 1CQDA 4CDFB 4ZHHA 5JA7A 4LZUA 3ELXA 4AZMA 1FH0A 1Q6KA 1CV8A 2X8SA 2IBIA 4AZRA 4U3QA 4XR7A 2G6DA 2IPPB 4ZH6A 4M0WA 2BS6A 3HK1A 5CSEA 5B2AO 3KZAA 2OY7A 5LJGA 2L5PA 1F2CA 3PH5A 3VE2A 3RE5A 2JMBA 5LJHA 2FTDA 2DZZA 4YYVA 2DCBA 1EIIA 1OEJA 1LCWA 4QGVA 4IRWA 2OVEA 2OYBO 3F8AA 3V6EA 1JV4A 1EF7A 2GH7A 1KGLA 1X8UA 1NC9A 3C77X 4CSBA 1VWGB 5FFHA 3CQRA 3KVNA 4BOUA 2FKGA 1KT5A 1BY8A 4Y0RA 3HPEA 1CRBA 3AI8A 1WUBA 3D4RA 3IUTA 2Q39A 1SWRA 3P5XA 5HTDA 3IFUA 2RTPB 1VYOA 3NP1A 3VPJE 5HZ5A 1BJ7A 1K3BB 2Y3FA 1BQIA 4WHIA 4GUZA 3AEHA 5K68A 3N91A 4BSQA 3T6FA 4ZHGA 1NQCA 3P24A 2RTBB 2R6NA 2RTLA 1EPAA 2R74A 1YP6A 3KFIA 2HHNA 2X32A 4GH7A 1I05A 5D47A 4BX6B 1MS6A 4MEEA 1PM1X 5HZQA 4NNTA 2F01A 5JR8A 3V8UA 1JMXA 1GLOA 1B56A 1JYDA 2X56A 3CBCA 2MO5A 2ARYA 1EALA 5F58A 1PPPA 3C0RA 2FYEA 1YT7A 2ZAGA 4RNAA 3OJYC 3WZQA 4ZHCA 2LBVA 1HXLA 3KFFA 5L8NA 4OVZB 1BEBA 1SWKA 3BB7A 2LBAA 2IZAA 1HUCB 1CBIA 2YMSA 4X6IA 5BYPA 3BC3A 1VYFA 2RTOB 4BX7B 1K3BA 2RCTA 1SMPI 2DCDA 4N7CA 4HPBA 4JNJA 1G74A 3KQ0A 3RDMA 4P16A 3T2WA 3ZUOA 2E01A 3H8CA 1L6MA 2IZHB 3E1ZB 4EKVA 4NLJA 1GX9A 4BOQA 5B10O 4HXDB 3HOEA 2MM3A 3ZQ3A 1PADA 1AECA 4YYWA 4RF0A 2J7QC 1NP1A 4KT5A 1ZNEA 2PNSA 1X8OA 5HCDC 1SWBA 2WQ9A 2OVSA 1HMSA 1I4UA 1PPNA 4AZQA 3OE3A 3RDOA 1VWDB 1CTEA 4YYSA 1F29A 3D95A 1BBPA 1LIDA 2Q2MA 4QRGA 1BM5A 3LXSA 4FJCA 3EBWA 4YGZA 1SY0A 3QJ3A 4A60A 1AU0A 4ORUA 3M99A 2C1SA 1CPJA 2XU4A 2OVAA 3EC5A 4I04A 1ADLA 4O3XB 3C9EA 1Y9LA 4HPDA 4Q8HA 4ORXA 3FA7A 1EW3A 3SLTA 2OL6O 3E9SA 2AIMA 3HWEA 3PHWA 1DF3A 2Y5BA 1O8VA 3E3CA 1N4JA 3UAQA 4LKTA 4DQ3A 4OMWA 3VHIA 3RWXA 4AZOA 1IJ8A 5CVNB 2POAA 3UEXA 1AU3A 1LPJA 3KFGA 2DZYA 1IWDA 2IZFB 2VHFA 3WZPA 4YCEA 2NP1A 1AELA 4HWYA 3HWFA 5B5GA 3ZW0A 2JN3A 1W4TA 4A1HA 1SWQA 2OVDA 2RTQB 3I06A 4W5CA 3ZUIA 5KHPA 1ZNLA 2G79A 2QM9A 1BRPA 2FRSA 1SXYA 3FLLA 3OD9A 2LB6A 4ZGUA 2FRQA 2G8CO 2E03A 4NP1A 1VWJB 4D8BA 4YBPA 1DZMA 2AT6X 4ORSA 1UKFA 3ZUAA 3WYQA 1QXPA 4U9CA 1TW4A 1DFVA 5BVSA 4AYHA 2YJ2A 3OBLA 4D8IA 3NHEA 2DC9A 1Y55X 1E2TA 4LQZA 3MHSA 3IFBA 4TKHA 1STSB 2YJ8A 6PADA 1STPA 1W6FA 1U18A 1SWJA 5HZ6A 4BQUA 4BOPA 3AUMO 2R9NA 4RF1A 1KT3A 2BHVA 3TMPA 4QGWA 1ME4A 1QG5A 1BSYA 1JJUA 1I04A 1SXXA 4CPIA 2JOZA 3FEKA 1AB0A 4MZSA 4ON1A 4R0BA 2HLVA 1EQDA 2NQAA 3P6DA 1RXKA 3O19A 2UZJA 4TLJA 3PT2A 2ACOA 2R73A 1SY3A 4U8UO 4ZTBA 3Q34A 2FS7A 3MG5A 1JIWI 3APUA 1SWNA 3PHXA 1GT4A 5EZQA 3RY2A 3S5VA 4NV7A 4BS6A 4REZA 2X8TA 5D45A 1T8VA 1SXUA 5H9KA 2X45A 4EXZA 2NNDA 1NB5A 2PBHA 1HBQA 4X6HA 4Z2PA 1GKAB 2HD5A 4YMYA 3FMZA 2JQFR 1A3YA 3STNA 4CDCA 3WBGA 1VWCB 3OF8A 3GAQA 1IW2A 1DV9A 5H9NA 2XKLA 4YFPA 5KIDA 1UYOX 2F09A 4GNYA 4GJSA 1NDJA 1PVJA 3ERVA 3P6FA 1P6PA 2OZ2A 1FENA 2HMBA 2MHDA 2HKDA 4YYUA 4KLBA 1ZNGA 3APXA 1ICFA 3MHHA 1XKIA 4INNA 3KX1A 4OEMA 5IRAA 3FR2A 3SZJA 4PJ2A 2ACPX 1S4VA 3H6SA 1U17A 5D8JA 4PP1A 2R9FA 2WEXA 4IP3A 2C4IA 3ELZA 3JS1A 2MWHA 1U5IA 3RZYA 2RD7C 1TVQA 2IZLB 3U9PC 1TU6A 2WR6A 1CBQA 2RTNB 1N9YA 3F5VA 4CDCB 4LKPA 1CS8A 1KL4A 3U0DA 4GETA 4I6SA 1LF7A 4NYRA 1FEMA 1ITOA 1HQPA 2DJGA 5D4AA 5EF4A 2Y3EA 4O3YA 5CE4A 4I9SA 3I17A 1SLGB 2A2GA 4R3DA 2FRAA 3P6EA 4MVEA 2I5VO 2PADA 3NR3A 3PDFA 1X89A 4YDBA 2KTSA 3P5WA 3HWGA 1LIBA 1N0SA 1HQQA 2LA7A 1IKJA 1RXJA 2AT0X 4M6SA 1MX7A 1KL3A 4I3DA 4MZOA 2AKQA 4O9SA 2NNQA 4ZCBA 1LDOA 3N3KA 1NPZA 4QNIA 3TF6A 1CBSA 3OF9A 5PADA 1PBOA 2RTEB 2Z4IA 2KT4B 1SWSA 1LELA 3KFHA 2BC3A 3FIQA 1SWOA 1AIMA 4RY2A 3RDXA 4A8ZA 5K16A 3L4RA 4BBOA 1F2BA 2WQAE 4WURA 4MI7A 4GE1A 3APVA 1ZNDA 3TGAA 4CPHB 1DZJA 4BGFA 5HA0A 2F7DA 3O0UA 4C5PA 3SZIA 3D9WA 1VJVA 2KD2A 4ZHDA 3VG7A 2PY1A 2Q9SA 4QBBA 1NP4A 1PBYA 3FYFA 3CKFA 2JTCA 4YGHA 4ORYA 2OULA 4RUUA 5CHVA 2GHUA 3NADA 1STRB 3HWNA 3OISA 3FENA 1OBQA 2B1MA 3DSZA 4OMXA 1EWPA 1EXSA 1QQSA 4GGTA 2VHSA 1JJJA 4TJZA 1SLEB 2H7JA 5CHTA 2R9OA 3PEDA 5EEEA 2DJFB 1BSOA 2L68A 4BOZA 3HOLA 3FW5A 2Q4NA 3MJ5A 3N3GA 2E02A 3B2JA 2R9CA 3LTWA 2XU5A 1VWQB 3CKGA 2R9MA 1LCVA 1ICNA 5EEDA 2RTCB 4OS8A 3VG3A 1A6RA 1SWDA 3P6HA 3RBYA 1IFBA 3ZZVA 5CHKA 4UU2A 2OY5O 3T1DA 1TL9A 1U9WA 1YZBA 3O2YA 1FE3A 3QQ2A 4XUIA 2A0AA 4O4SA 3FA8A 1X8PA 2RTMA 3IEJA 3FIDA 4TQ2A 1DZPA 5AEOA 1SREA 4B55A 1HMRA 1EPBA 2AVWA 1GT3A 4CDEA 1YWAA 4L3RA 2IZGB 3MTNA 2RTJA 4BX7A 4GU8A 5B5FA 2WUTA 3EW1A 1OBUA 4Z28A 1OEKA 1ZIVA 2AH7X 5FENA 2UZ2A 3VG2A 5DG4A 3UEUA 5KO3A 4Z2OA 1SRIA 3PH6A 3FA6A 3B21A 4CDFA 3BCNA 4BJ8A 4KIIA 1SLFB 2W2FA 4QGXA 3P6CA 4BX6A 1N7YA 1KT4A 4HPAA 1HBPA 3NX1A 3SAOA 3UEVA 5A24A 3ZWEA 3T6LA 2OFMX 3O22A 3WOVA 4Z27A 3D6SA 3B2LA 1G85A 4Z6JA 1DF8A 1KT6A 4TKBA 3STKA 4N8WA 3FDCA 3T2XA 1ZRYA 1N9MA 1SWAA 1PE6A 2RCQA 1MIRA 2NNEA 2ZAIA 4ALBA 4YFQA 2QMIA 5HZ9A 2DJFA 2JGSA 2FWVA 1VWHB 1QY0A 4ML7B 1MDCA 2IZJA 1KQXA 3VHHA 1MDWA 5EDBA 2JU8A 4AW8A 2L67A 1KXRA 4MVIA 4ZJ0A 1RSUB 4YKOA 4AXMA 3BU1A 3ZW0B 1X9YA 1SY1A 1I9HA 4I60A 4QH6A 1JYJA 4GDAA 4XMGA 4GJVA 2HH5A 1SY2A 2CBRA 2YJ9A 2RTIB 4OELA 1AYUA 1VWEB 2M4LA 1VWAB 2X8FA 4GRJA 2L9CA 3RDQA 1KT7A 3VU1A 2P86A 3KWBX 1OBPA 1AQBA 1I06A 1PIPA 3ZNHA 3PRMA 4XZXA 4GKCA 1BWYA 1POPA 3RVXA 5AJBA 5J94A 4YVAA 4YVBA 5CYBA 5BVQA 2WBFX 1DKIA 3I0AA 4KC7A 2OL7A 4YKMA 2OFRX 4Q8GA 3MTVA 4I3CA 1ERBA 1JJXA 3DF0A 3K24A 3USVA 2RTAA 2OY1O 2BT9A 3HD3A 3CQNA 4NNSA 4Y5DA 3F9DA 2FLJA 4DCBA 2DC6A 4BOSA 4XMFA 4BQVA 2X55A 1VWNB 2FTBA 2RTHB 1EWMA 4L1NA 1WBIA 3H3IA 2FE8A 3RNVA 1KFFA 2EU7X 3S26A 5LJEA 3K8UA 5LJKA 4CPHA 2QO6A 4YYRA 1PBHA 4ORRA 4N7DA 4IB9A 4HWMA 1HMTA 3PHUA 1GX8A 1YK7A 3WXQA 1RSTB 3KFQA 8PCHA 4FK5A 1VWIB 1SWCA 4FQBB 2Y32A 3P5UA 1ML7A 1SWLA 3G7XA 3O65A 4RUNA 4DMYA 5AJCA 3QKGA 1VWMB 3PQUA 1VWRB 3PRPA 5IO5A 3MX7A 3RE6A 4I05A 3NQKA 1LUQA 1I78A 4COTA 5JD2A 3BWKA 4GUAA 3VGWA 3RY1A 1ZCMA 1BSQA 1MUPA 1NBXA 4ZH9A 2C1QA 1GM6A 4AXLA 2JRIA 2JU7A 1PEEA 3MP2A 1LCZA 2B1NA 3I3TA 1QDQA 1SWPA 1IFCA 1NQMA 1VWBB 4IABA 2IZKA 5F2BA 1KXOA 5HWZA 4CPEA 2GFOA 1YK8A 4I07A 1Y9TA 1CSBB 4EEJA 5FAZA 3B79A 2P0RA 2OF9A 5JH3A 1SWHA 1MVGA 3RSWA 5F1EA 4XMEA 2DCCA 3IV2A 1UYNX 1CBRA 1MM9A 4Z2VA 3GCBA 1RBPA 1LIEA 5DPQA 4JHQA 1SLDB 2YJCA 3P02A 1CVZA 1G7NA 2RTDB 4D8EA 2G7YA 4OW0A 3W31A 4QAEA 4XMDA 3KWZA 1QFTA 3IHPA 4BX5B 4IB8A 1FTPA 1F2AA 5H9LA 3IA8A 3VG6A 1DZKA 1S2PA 1TOUA 2OFBA 2Y6EA 4MSXA 4KH8A 3VG5A 3F6ZB 1TOWA 3D97A 5L3YA 4IB6A 3EW2A 2GC9A 3X00A 4QRXA 1EIOA 3VHMA 3P5VA 1DF0A 3OVXA 4HPCA 1GXAA 2ASNX 2ALLX 2G7BA 4IAXA 2P7UA 4ORWA 1ACDA 4OS3A 1YWDA 1Y08A 4GK9A 3BX8A 3ZW1A 1K24A 2Q2PA 2DJGB 4XMCA 1VPRA 4M7MA 1FJ1E 1U9QX 2IZEB 4DMXA 2IFBA 1JZUA 2PI3O 2A13A 5IO6A 1CB5A 1AVEA 1KZWA 1NB3A 3BS2A 5HBSA 1MEPA 4DNEA 5L8OA 3MM0A 1BGOA 4CZWA 1LICA 5KICA 2O6XA 3EYCA 2Z4HA 4QYPA 3NBXX 2XU1A 3AKNA 1U9VA 2RN4A 2FQ9A 2MF6A 2AS8A 1LNMA 1U9XA 3V6CA 4QYNA 2OF8A 1QY2A 4CK4A 3WJBA 1QY1A 2OL8O 4BS5A 3KSEA 2RTRB 2GJ5A 4D6AA 1VSNA 3D96A 2CIOA 5F02A 2AYNA 4IMOA 5FPWA 1T0VA 4CDDB 2BDZA 2W2BA 3BU9A 4O4XA 4QQ1A 3WJDA 4UU3A 1GX3A 2PREA 2HYSA 2NQDB 5FQ7E 5HA1A 2GTLO 2J7QA 5EZ2A 1LKEA 3QSDA 3TGBA 1A57A 1GT5A 1ZNHA 1E00A 5D48A 1SRGA 2E4JA 2HNXA 4WFVA 4Y0PA 3S3RA 3PECA 3SLJA 3PPTA 3FA9A 5FQ8E 5B27A 4PSQA 4YFRA 5H9AA 4ZHFA 2IZCB 1AU4A 1BLRA 1RAVA 3SZHA 4IBAA 3JSQA 2MJIA 4IMNA 3CWKA 2DOSA 1KZXA 3HHIA 1GGLA 2GTFX 3KKUA 1XCAA 1SWGA 1KOIA 5LKEA 1T68X 5BVTA 3S60A 1UZ2X 4ARHA 1SWUA 3PSEA 4PADA 3WXEA 2G8JA 4NYQA 3PBHA 3DTQA 2DM5A 1BRQA 3BDRA 2JW1A 3U03A 1U0XA 3MVFA 1CJ5A 2AUZA 3IMAA 2BTWB 2QO5A 1QFVA 3FW4A 3WYPA 5F6ZA 2IZBA 3EM0A 4BOEA 2FKJA 3WZOA 2RTFB 1ERXA 5L8IA 1GT1A 2R56A 1QMYA 3CBJA 4MVKA 5K06A 5IRUA 4IAWA 1QWDA 1STFE 4CDEB 1SRHA 1O0EA 1YP7A 4WBKA 2G78A 5H8TA 1RXHA 3CR6A 4K19A 4NW4A 4MIRA 4FBOA 1SRFA 4Y0QA 2ZSCA 2I5ZO 4NV8A 4ZFXA 4TNNA 1YUPA 1YIVA 1NL6A 3CBSA 3LHNA 3LFYA 1EWLA 5EGWA 2BDLA 5FQ6E 3RKGA 7PCKA 2UYWA 2FS6A 3O1GA 1W5RA 4ZR2A 3RDUA 3APWA 2DCAA 3ZI8A 1X71A 2IZDB 3FR5A 2AGAA 3CMPA 4OKAA 4ALOA 4KC8A 3AKMA 4PI3A 5IXGA 4MM3B 3BX7A 1EUOA 3FEPA 2FHNX 2CZTA 3WZNA 3W30A 2RA6A 2A3FX 4PT5A 1OPAA 4FBVA 2CBSA 2RTKA 5IO7A 5EZSA 3ZW1B 4EFGA 1S7DA 1AYWA 1OPBA 5B3MO 2AMMX 3BBAA 3H7DA 1HY2A 3PQSA 3VE1A 2HZQA 4OS0A 3BPFA 1VWFB 2BSZA 3RDSA 2XU3A 2C0YA 1JBHA 1X8NA 2LKKA 1YWBA 3RVVA
chains in the Genus database with same CATH topology
1ZCMA 1PPOA 2PADA 4G54A 1AU2A 3PDFA 4AXLA 3P5WA 1F2CA 2B1NA 2G8EA 3I3TA 2FTDA 2DZZA 1QDQA 4YYVA 2DCBA 4MZOA 1BP4A 3N3KA 2GFOA 3V6EA 1NPZA 1YK8A 1EF7A 4I07A 4P6EA 1CSBB 3U8EA 3B79A 2P0RA 3OF9A 5JH3A 5PADA 1BY8A 2DCCA 3IV2A 3AI8A 3GCBA 2FUDA 3IUTA 3P5XA 2NQGA 1AIMA 4RY2A 1K3BB 2YJCA 1BQIA 1CVZA 4GUZA 2ATOA 1XKGA 2G7YA 3RVWA 3S3QA 5K16A 4BSQA 1F2BA 3KWZA 3OVZA 1NQCA 3IHPA 1F2AA 2R6NA 4BGFA 2HHNA 2AUXA 2F7DA 3O0UA 4C5PA 3D9WA 1Y4HA 2Y6EA 1MS6A 3H8BA 4MSXA 1VJVA 1SP4B 5CVOB 4QBBA 4ZUXU 1GLOA 4QRXA 4PP2E 3P5VA 2ARYA 1DF0A 1PPPA 2FYEA 1ATKA 3H89A 1YT7A 3OVXA 2OULA 5CHVA 2P7UA 2GHUA 1KFUL 1Y08A 3HWNA 3OISA 1HUCB 4K7CA 3MORA 2B1MA 2DJGB 4W4UA 3KW9A 4X6IA 3BC3A 1EWPA 1K3BA 2DCDA 2VHSA 3PNRA 2E00A 2H7JA 2FO5A 1U9QX 5CHTA 2E01A 3BPMA 2R9OA 3H8CA 4DMXA 2DJFB 3E1ZB 2VFCA 1CB5A 1NB3A 3N3GA 3WXFA 2E02A 1PADA 1AECA 3IOQA 4YYWA 2R9CA 2HXZA 1BGOA 2PNSA 4CZWA 3LTWA 2XU5A 2AYOA 2R9MA 1PPNA 2O6XA 1A6RA 1CTEA 4YYSA 1F29A 4N79A 4QRGA 3LXSA 4FJCA 4CDDA 1TL9A 1U9WA 2XU1A 1U9VA 4QRVA 3QJ3A 3M99A 1AU0A 1PPDA 4XUIA 1CPJA 2FQ9A 2XU4A 4I04A 3C9EA 3IEJA 2AS8A 4Q8HA 1U9XA 3V6CA 4B55A 2FT2A 2AVWA 4CDEA 3MTNA 1EWOA 4BS5A 3KSEA 2VFBA 2AIMA 1VSNA 3TNXA 2CIOA 4BPVA 2Y5BA 5F02A 2AYNA 5FPWA 3CH2X 3CH3X 1JQPA 4CDDB 2BDZA 2DC7A 1ZIVA 2AU1A 2PREA 1GX3A 2NQDB 5CVNB 4CDFA 3BCNA 1AU3A 1YVBA 2DZYA 1IWDA 2VHFA 4HWYA 3QSDA 1W4TA 9PAPA 3S3RA 5A24A 3I06A 4W5CA 4N4ZA 1ME3A 1AU4A 3D6SA 2FRQA 2ACTA 2E03A 4N8WA 3HHIA 1PE6A 1MIRA 3KKUA 3ZUAA 1QXPA 3CBKA 2YJ2A 4PADA 3WXEA 2DJFA 3NHEA 2DC9A 3BOWA 2G8JA 1E2TA 3MHSA 3PBHA 1KHQA 4WA6A 4FIPA 6PADA 2YJ8A 2OP3A 1MDWA 1W6FA 2YJBA 1MEGA 1KXRA 4AXMA 1X9YA 1MHWA 2AUZA 2R9NA 1GCBA 3IMAA 1PXVA 1ME4A 4QH6A 1NLJA 2HH5A 2YJ9A 4MZSA 1DEUA 4OELA 2NQAA 1AYUA 1QOLA 1KHPA 1QMYA 3CBJA 2DC8A 1THEA 2P86A 3KWBX 4P6GA 1PIPA 4CDEB 1STFE 1KFXL 1MEMA 1O0EA 3RVXA 1POPA 5J94A 4YVAA 2WBFX 4W5BA 4X6JA 4NV7A 4BS6A 2NQIA 4YV8A 4Q8GA 1NB5A 2PBHA 3DF0A 3K24A 3USVA 2CB5A 4NV8A 4X6HA 1GECE 2HD5A 3HD3A 1GMYA 2JQFR 2F1GA 4YYQA 1NL6A 4CDCA 1CJLA 1TLOA 3LFYA 3OF8A 2DC6A 1EWLA 5EGWA 2BDLA 4BQVA 7PCKA 3O1GA 1W5RA 1YALA 1EWMA 3ERVA 2OZ2A 2DCAA 3K9MA 3K8UA 3HHAA 5CVMA 4YYUA 4KLBA 4YYRA 1PBHA 1ICFA 3MHHA 3KX1A 4OEMA 3H6SA 1S4VA 1YK7A 4PI3A 4PP1A 2R9FA 3KFQA 8PCHA 4FK5A 1U5IA 3WXGA 1TU6A 3N4CA 1SNKA 3P5UA 1AYVA 3PW3A 3F75A 3QT4A 4DMYA 2JQGR 4CDCB 1M6DA 3F5VA 1CS8A 1PCIA 1CQDA 1AYWA 4CDFB 3H7DA 5JA7A 1ITOA 1FH0A 2DJGA 5EF4A 4I05A 3BPFA 2BSZA 1Q6KA 1CV8A 2XU3A 2C0YA 2IBIA 3BWKA 4XR7A 2G6DA 2IPPB 2FRAA 3RVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCM A;  1PPO A;  2PAD A;  4G54 A;  1AU2 A;  3PDF A;  4AXL A;  3P5W A;  1F2C A;  2B1N A;  2G8E A;  3I3T A;  2FTD A;  2DZZ A;  1QDQ A;  4YYV A;  2DCB A;  4MZO A;  1BP4 A;  3N3K A;  2GFO A;  3V6E A;  1NPZ A;  1YK8 A;  1EF7 A;  4I07 A;  4P6E A;  1CSB B;  3U8E A;  3B79 A;  2P0R A;  3OF9 A;  5JH3 A;  5PAD A;  1BY8 A;  2DCC A;  3IV2 A;  3AI8 A;  3GCB A;  2FUD A;  3IUT A;  3P5X A;  2NQG A;  1AIM A;  4RY2 A;  1K3B B;  2YJC A;  1BQI A;  1CVZ A;  2ATO A;  1XKG A;  2G7Y A;  3RVW A;  3S3Q A;  5K16 A;  4BSQ A;  1F2B A;  3KWZ A;  3OVZ A;  1NQC A;  3IHP A;  1F2A A;  2R6N A;  2HHN A;  2AUX A;  2F7D A;  3O0U A;  1Y4H A;  2Y6E A;  1MS6 A;  3H8B A;  4MSX A;  1VJV A;  1SP4 B;  5CVO B;  4QBB A;  4ZUX U;  1GLO A;  4QRX A;  4PP2 E;  3P5V A;  2ARY A;  1DF0 A;  1PPP A;  2FYE A;  1ATK A;  3H89 A;  1YT7 A;  3OVX A;  2OUL A;  5CHV A;  2P7U A;  2GHU A;  1KFU L;  1Y08 A;  3HWN A;  3OIS A;  1HUC B;  4K7C A;  3MOR A;  2B1M A;  2DJG B;  4W4U A;  3KW9 A;  4X6I A;  3BC3 A;  1EWP A;  1K3B A;  2DCD A;  2VHS A;  3PNR A;  2E00 A;  2H7J A;  2FO5 A;  1U9Q X;  5CHT A;  2E01 A;  3BPM A;  2R9O A;  3H8C A;  4DMX A;  2DJF B;  3E1Z B;  1CB5 A;  1NB3 A;  3N3G A;  3WXF A;  2E02 A;  1PAD A;  1AEC A;  3IOQ A;  4YYW A;  2R9C A;  2HXZ A;  1BGO A;  2PNS A;  4CZW A;  2XU5 A;  2AYO A;  2R9M A;  1PPN A;  2O6X A;  1A6R A;  1CTE A;  4YYS A;  1F29 A;  4N79 A;  4QRG A;  3LXS A;  4FJC A;  4CDD A;  1TL9 A;  1U9W A;  2XU1 A;  1U9V A;  4QRV A;  3QJ3 A;  3M99 A;  1AU0 A;  1PPD A;  4XUI A;  1CPJ A;  2FQ9 A;  2XU4 A;  4I04 A;  3C9E A;  3IEJ A;  2AS8 A;  4Q8H A;  1U9X A;  3V6C A;  2FT2 A;  2AVW A;  4CDE A;  3MTN A;  1EWO A;  4BS5 A;  3KSE A;  2AIM A;  1VSN A;  3TNX A;  2CIO A;  4BPV A;  2Y5B A;  5F02 A;  2AYN A;  5FPW A;  3CH2 X;  3CH3 X;  1JQP A;  4CDD B;  2BDZ A;  2DC7 A;  1ZIV A;  2AU1 A;  2PRE A;  2NQD B;  5CVN B;  4CDF A;  3BCN A;  1AU3 A;  1YVB A;  2DZY A;  1IWD A;  2VHF A;  4HWY A;  3QSD A;  9PAP A;  3S3R A;  5A24 A;  3I06 A;  4W5C A;  4N4Z A;  1ME3 A;  1AU4 A;  3D6S A;  2FRQ A;  2ACT A;  2E03 A;  4N8W A;  3HHI A;  1PE6 A;  1MIR A;  3KKU A;  3ZUA A;  1QXP A;  3CBK A;  2YJ2 A;  4PAD A;  3WXE A;  2DJF A;  3NHE A;  2DC9 A;  3BOW A;  2G8J A;  3MHS A;  3PBH A;  1KHQ A;  4WA6 A;  4FIP A;  6PAD A;  2YJ8 A;  2OP3 A;  1MDW A;  2YJB A;  1MEG A;  1KXR A;  4AXM A;  1X9Y A;  1MHW A;  2AUZ A;  2R9N A;  1GCB A;  3IMA A;  1PXV A;  1ME4 A;  4QH6 A;  1NLJ A;  2HH5 A;  2YJ9 A;  4MZS A;  1DEU A;  4OEL A;  2NQA A;  1AYU A;  1QOL A;  1KHP A;  1QMY A;  3CBJ A;  2DC8 A;  1THE A;  2P86 A;  3KWB X;  4P6G A;  1PIP A;  4CDE B;  1STF E;  1KFX L;  1MEM A;  1O0E A;  3RVX A;  1POP A;  5J94 A;  4YVA A;  2WBF X;  4W5B A;  4X6J A;  4BS6 A;  2NQI A;  4YV8 A;  4Q8G A;  1NB5 A;  2PBH A;  3DF0 A;  3K24 A;  3USV A;  2CB5 A;  4X6H A;  1GEC E;  2HD5 A;  3HD3 A;  1GMY A;  2JQF R;  2F1G A;  4YYQ A;  1NL6 A;  4CDC A;  1CJL A;  1TLO A;  3LFY A;  3OF8 A;  2DC6 A;  1EWL A;  5EGW A;  2BDL A;  4BQV A;  7PCK A;  3O1G A;  1YAL A;  1EWM A;  3ERV A;  2OZ2 A;  2DCA A;  3K9M A;  3K8U A;  3HHA A;  5CVM A;  4YYU A;  4KLB A;  4YYR A;  1PBH A;  1ICF A;  3MHH A;  3KX1 A;  4OEM A;  3H6S A;  1S4V A;  1YK7 A;  4PI3 A;  4PP1 A;  2R9F A;  3KFQ A;  8PCH A;  4FK5 A;  1U5I A;  3WXG A;  1TU6 A;  3N4C A;  1SNK A;  3P5U A;  1AYV A;  3PW3 A;  3F75 A;  3QT4 A;  4DMY A;  2JQG R;  4CDC B;  1M6D A;  3F5V A;  1CS8 A;  1PCI A;  1CQD A;  1AYW A;  4CDF B;  3H7D A;  5JA7 A;  1ITO A;  1FH0 A;  2DJG A;  5EF4 A;  4I05 A;  3BPF A;  1Q6K A;  1CV8 A;  2XU3 A;  2C0Y A;  2IBI A;  3BWK A;  4XR7 A;  2G6D A;  2IPP B;  2FRA A;  3RVV A; 
#chains in the Genus database with same CATH topology
 1PPO A;  4G54 A;  1AU2 A;  1SWE A;  1TXL A;  5LKF A;  1HXZ A;  2FR3 A;  2G8E A;  4EDE A;  1BP4 A;  1ALB A;  3B2I A;  1MOY A;  4P6E A;  3U8E A;  2X34 A;  4AZP A;  3WJG A;  1QAB E;  2FUD A;  5HCE C;  2NQG A;  1SA8 A;  2KTD A;  5E6J A;  3LV4 A;  1HN2 A;  1JMZ A;  4FGI B;  1VYG A;  1PTS A;  2ATO A;  1XKG A;  1X8Q A;  4U8U N;  3NQ3 A;  3RVW A;  3S3Q A;  1ZNK A;  3NX2 A;  4Y0S A;  4O4O A;  4YH0 A;  3OVZ A;  4IUM A;  2FR2 A;  2AF5 A;  1KL5 A;  2AUX A;  4A1Y A;  3TRK A;  1Y4H A;  3H8B A;  1ICM A;  1IIU A;  3BY4 A;  1VWL B;  1SP4 B;  2QO4 A;  5CVO B;  2P8G A;  4ZUX U;  3Q6L A;  4TKJ A;  4PP2 E;  4RKX A;  1O1U A;  3SOT A;  1ATK A;  3H89 A;  3TZS A;  3PP6 A;  5HAE A;  3BSZ E;  4I3B A;  2WPU A;  2WEW A;  2VDF A;  4I95 A;  1KFU L;  3NPO A;  1Y0G A;  5HTE A;  4K7C A;  3MOR A;  2A8G A;  1LFO A;  4W4U A;  3KW9 A;  2HZR A;  4BCS A;  3BLG A;  2Z84 A;  4QRL A;  3PNR A;  1E06 A;  2E00 A;  1SWF A;  1Z24 A;  2FO5 A;  4WFU A;  1H91 A;  2QCB A;  3BPM A;  2W2A A;  1VWO B;  2VFC A;  3SLO A;  4MIS A;  4O49 A;  3WXF A;  2O62 A;  3BY0 A;  1B0O A;  4BX5 A;  1YWC A;  5B11 O;  3IOQ A;  3K3L A;  4LZV A;  1NQN A;  2HXZ A;  4GDZ A;  2FHL A;  1FDQ A;  2AYO A;  2X46 A;  1E02 A;  1MK5 A;  4N79 A;  3STM X;  4CDD A;  4GGZ A;  4QRV A;  5EDC A;  1PPD A;  1R0U A;  5LJD A;  5EPQ A;  1LIF A;  4ODD A;  4OVZ A;  4I9R A;  1VWK B;  4IB7 A;  2WWP A;  5F6B A;  2XST A;  2FGS A;  4NLI A;  2FT2 A;  1EWO A;  1D2U A;  1O1V A;  2VFB A;  3TNX A;  1E5P A;  4BPV A;  2N93 A;  2RTG B;  3CH2 X;  3CH3 X;  1JQP A;  2DC7 A;  2A5C A;  2QOM A;  2AU1 A;  1MX8 A;  4QZT A;  3GE2 A;  1SXW A;  2GTL M;  1OEE A;  5HZ8 A;  1G5W A;  2CM9 A;  1YVB A;  3EMM A;  4Y59 A;  1N43 A;  5K67 A;  1SRJ A;  4JO6 A;  2KW1 A;  1Y52 X;  2WSJ A;  9PAP A;  3UEW A;  4GZV A;  2HWK A;  1A2D A;  2BLG A;  4N4Z A;  5AQ6 A;  1ME3 A;  2JU3 A;  2AT8 X;  3S5X A;  2OFA A;  2ACT A;  4QZU A;  1RLB E;  2K62 A;  2QOS C;  1AVG I;  3C76 X;  1NGL A;  2OZQ A;  3ZW2 A;  5HCC C;  3EBK A;  4FBR A;  3CBK A;  2BTW A;  2A2U A;  4GD9 A;  3BOW A;  2X4M A;  1KHQ A;  2RQ0 A;  3JQO A;  2F73 A;  4WA6 A;  3FEL A;  3HTY A;  4FIP A;  1GKA A;  2OP3 A;  1D3S A;  5IRW A;  3VG4 A;  2YJB A;  5F7G A;  1PMP A;  1MEG A;  3TGC A;  5LJB A;  2IZI A;  1EI5 A;  1MHW A;  1Y53 X;  3BRN A;  5JZE A;  1GCB A;  1S44 A;  4CPF A;  1PXV A;  4U46 A;  2YG2 A;  3P6G A;  1NLJ A;  4YCH A;  4EQA C;  1DEU A;  1LDQ A;  1SWT A;  4ZGF A;  3WJC A;  1QOL A;  1KHP A;  4O3W A;  4YBU A;  2DC8 A;  3B2K A;  1THE A;  4U8U M;  4P6G A;  1KFX L;  1MEM A;  1VWP B;  3MBT A;  1A18 A;  1AVD A;  1IKE A;  4W5B A;  4YGG A;  4X6J A;  4XMH A;  2NQI A;  4YV8 A;  4ES7 A;  2A5B A;  5C0N A;  1FEL A;  4JGL A;  3WJF A;  1KQW A;  2CZU A;  2CB5 A;  4O3Z A;  1GEC E;  5B29 A;  4DQ4 A;  1GMY A;  3PK2 A;  4HFO A;  2F1G A;  1DC9 A;  4YYQ A;  2G5L A;  1CJL A;  1TLO A;  2BU3 A;  5LJC A;  3NQ9 A;  2ANS A;  4BVM A;  1URE A;  4CV7 A;  4AZN A;  2AT3 X;  2AL0 X;  2FT9 A;  2LFO A;  4YDA A;  1YAL A;  3K9M A;  3HHA A;  5CVM A;  4A5U A;  3HWD A;  2CM4 A;  4ID2 A;  4D6B A;  3OQC A;  4O4U A;  4GNW A;  3FR4 A;  2K23 A;  3WJE A;  1B4M A;  2BS5 A;  2AT5 X;  2OY8 A;  3WVM A;  3WXG A;  3N4C A;  1OSP O;  1SNK A;  3PW3 A;  1AYV A;  2CAM A;  3B2H A;  4KCA A;  2GTL N;  2AVI A;  3F75 A;  3QT4 A;  3C78 X;  4GGR A;  2JQG R;  1B8E A;  1M6D A;  4MVL A;  1PCI A;  1CQD A;  4CDF B;  4ZHH A;  5JA7 A;  4LZU A;  3ELX A;  4AZM A;  1FH0 A;  1Q6K A;  1CV8 A;  2X8S A;  2IBI A;  4AZR A;  4U3Q A;  4XR7 A;  2G6D A;  2IPP B;  4ZH6 A;  4M0W A;  2BS6 A;  3HK1 A;  5CSE A;  5B2A O;  3KZA A;  2OY7 A;  5LJG A;  2L5P A;  1F2C A;  3PH5 A;  3VE2 A;  3RE5 A;  2JMB A;  5LJH A;  2FTD A;  2DZZ A;  4YYV A;  2DCB A;  1EII A;  1OEJ A;  1LCW A;  4QGV A;  4IRW A;  2OVE A;  2OYB O;  3F8A A;  3V6E A;  1JV4 A;  1EF7 A;  2GH7 A;  1KGL A;  1X8U A;  1NC9 A;  3C77 X;  4CSB A;  1VWG B;  5FFH A;  3CQR A;  3KVN A;  4BOU A;  2FKG A;  1KT5 A;  1BY8 A;  4Y0R A;  3HPE A;  1CRB A;  3AI8 A;  1WUB A;  3D4R A;  3IUT A;  2Q39 A;  1SWR A;  3P5X A;  5HTD A;  3IFU A;  2RTP B;  1VYO A;  3NP1 A;  3VPJ E;  5HZ5 A;  1BJ7 A;  1K3B B;  2Y3F A;  1BQI A;  4WHI A;  4GUZ A;  3AEH A;  5K68 A;  3N91 A;  4BSQ A;  3T6F A;  4ZHG A;  1NQC A;  3P24 A;  2RTB B;  2R6N A;  2RTL A;  1EPA A;  2R74 A;  1YP6 A;  3KFI A;  2HHN A;  2X32 A;  4GH7 A;  1I05 A;  5D47 A;  4BX6 B;  1MS6 A;  4MEE A;  1PM1 X;  5HZQ A;  4NNT A;  2F01 A;  5JR8 A;  3V8U A;  1JMX A;  1GLO A;  1B56 A;  1JYD A;  2X56 A;  3CBC A;  2MO5 A;  2ARY A;  1EAL A;  5F58 A;  1PPP A;  3C0R A;  2FYE A;  1YT7 A;  2ZAG A;  4RNA A;  3OJY C;  3WZQ A;  4ZHC A;  2LBV A;  1HXL A;  3KFF A;  5L8N A;  4OVZ B;  1BEB A;  1SWK A;  3BB7 A;  2LBA A;  2IZA A;  1HUC B;  1CBI A;  2YMS A;  4X6I A;  5BYP A;  3BC3 A;  1VYF A;  2RTO B;  4BX7 B;  1K3B A;  2RCT A;  1SMP I;  2DCD A;  4N7C A;  4HPB A;  4JNJ A;  1G74 A;  3KQ0 A;  3RDM A;  4P16 A;  3T2W A;  3ZUO A;  2E01 A;  3H8C A;  1L6M A;  2IZH B;  3E1Z B;  4EKV A;  4NLJ A;  1GX9 A;  4BOQ A;  5B10 O;  4HXD B;  3HOE A;  2MM3 A;  3ZQ3 A;  1PAD A;  1AEC A;  4YYW A;  4RF0 A;  2J7Q C;  1NP1 A;  4KT5 A;  1ZNE A;  2PNS A;  1X8O A;  5HCD C;  1SWB A;  2WQ9 A;  2OVS A;  1HMS A;  1I4U A;  1PPN A;  4AZQ A;  3OE3 A;  3RDO A;  1VWD B;  1CTE A;  4YYS A;  1F29 A;  3D95 A;  1BBP A;  1LID A;  2Q2M A;  4QRG A;  1BM5 A;  3LXS A;  4FJC A;  3EBW A;  4YGZ A;  1SY0 A;  3QJ3 A;  4A60 A;  1AU0 A;  4ORU A;  3M99 A;  2C1S A;  1CPJ A;  2XU4 A;  2OVA A;  3EC5 A;  4I04 A;  1ADL A;  4O3X B;  3C9E A;  1Y9L A;  4HPD A;  4Q8H A;  4ORX A;  3FA7 A;  1EW3 A;  3SLT A;  2OL6 O;  3E9S A;  2AIM A;  3HWE A;  3PHW A;  1DF3 A;  2Y5B A;  1O8V A;  3E3C A;  1N4J A;  3UAQ A;  4LKT A;  4DQ3 A;  4OMW A;  3VHI A;  3RWX A;  4AZO A;  1IJ8 A;  5CVN B;  2POA A;  3UEX A;  1AU3 A;  1LPJ A;  3KFG A;  2DZY A;  1IWD A;  2IZF B;  2VHF A;  3WZP A;  4YCE A;  2NP1 A;  1AEL A;  4HWY A;  3HWF A;  5B5G A;  3ZW0 A;  2JN3 A;  1W4T A;  4A1H A;  1SWQ A;  2OVD A;  2RTQ B;  3I06 A;  4W5C A;  3ZUI A;  5KHP A;  1ZNL A;  2G79 A;  2QM9 A;  1BRP A;  2FRS A;  1SXY A;  3FLL A;  3OD9 A;  2LB6 A;  4ZGU A;  2FRQ A;  2G8C O;  2E03 A;  4NP1 A;  1VWJ B;  4D8B A;  4YBP A;  1DZM A;  2AT6 X;  4ORS A;  1UKF A;  3ZUA A;  3WYQ A;  1QXP A;  4U9C A;  1TW4 A;  1DFV A;  5BVS A;  4AYH A;  2YJ2 A;  3OBL A;  4D8I A;  3NHE A;  2DC9 A;  1Y55 X;  1E2T A;  4LQZ A;  3MHS A;  3IFB A;  4TKH A;  1STS B;  2YJ8 A;  6PAD A;  1STP A;  1W6F A;  1U18 A;  1SWJ A;  5HZ6 A;  4BQU A;  4BOP A;  3AUM O;  2R9N A;  4RF1 A;  1KT3 A;  2BHV A;  3TMP A;  4QGW A;  1ME4 A;  1QG5 A;  1BSY A;  1JJU A;  1I04 A;  1SXX A;  4CPI A;  2JOZ A;  3FEK A;  1AB0 A;  4MZS A;  4ON1 A;  4R0B A;  2HLV A;  1EQD A;  2NQA A;  3P6D A;  1RXK A;  3O19 A;  2UZJ A;  4TLJ A;  3PT2 A;  2ACO A;  2R73 A;  1SY3 A;  4U8U O;  4ZTB A;  3Q34 A;  2FS7 A;  3MG5 A;  1JIW I;  3APU A;  1SWN A;  3PHX A;  1GT4 A;  5EZQ A;  3RY2 A;  3S5V A;  4NV7 A;  4BS6 A;  4REZ A;  2X8T A;  5D45 A;  1T8V A;  1SXU A;  5H9K A;  2X45 A;  4EXZ A;  2NND A;  1NB5 A;  2PBH A;  1HBQ A;  4X6H A;  4Z2P A;  1GKA B;  2HD5 A;  4YMY A;  3FMZ A;  2JQF R;  1A3Y A;  3STN A;  4CDC A;  3WBG A;  1VWC B;  3OF8 A;  3GAQ A;  1IW2 A;  1DV9 A;  5H9N A;  2XKL A;  4YFP A;  5KID A;  1UYO X;  2F09 A;  4GNY A;  4GJS A;  1NDJ A;  1PVJ A;  3ERV A;  3P6F A;  1P6P A;  2OZ2 A;  1FEN A;  2HMB A;  2MHD A;  2HKD A;  4YYU A;  4KLB A;  1ZNG A;  3APX A;  1ICF A;  3MHH A;  1XKI A;  4INN A;  3KX1 A;  4OEM A;  5IRA A;  3FR2 A;  3SZJ A;  4PJ2 A;  2ACP X;  1S4V A;  3H6S A;  1U17 A;  5D8J A;  4PP1 A;  2R9F A;  2WEX A;  4IP3 A;  2C4I A;  3ELZ A;  3JS1 A;  2MWH A;  1U5I A;  3RZY A;  2RD7 C;  1TVQ A;  2IZL B;  3U9P C;  1TU6 A;  2WR6 A;  1CBQ A;  2RTN B;  1N9Y A;  3F5V A;  4CDC B;  4LKP A;  1CS8 A;  1KL4 A;  3U0D A;  4GET A;  4I6S A;  1LF7 A;  4NYR A;  1FEM A;  1ITO A;  1HQP A;  2DJG A;  5D4A A;  5EF4 A;  2Y3E A;  4O3Y A;  5CE4 A;  4I9S A;  3I17 A;  1SLG B;  2A2G A;  4R3D A;  2FRA A;  3P6E A;  4MVE A;  2I5V O;  2PAD A;  3NR3 A;  3PDF A;  1X89 A;  4YDB A;  2KTS A;  3P5W A;  3HWG A;  1LIB A;  1N0S A;  1HQQ A;  2LA7 A;  1IKJ A;  1RXJ A;  2AT0 X;  4M6S A;  1MX7 A;  1KL3 A;  4I3D A;  4MZO A;  2AKQ A;  4O9S A;  2NNQ A;  4ZCB A;  1LDO A;  3N3K A;  1NPZ A;  4QNI A;  3TF6 A;  1CBS A;  3OF9 A;  5PAD A;  1PBO A;  2RTE B;  2Z4I A;  2KT4 B;  1SWS A;  1LEL A;  3KFH A;  2BC3 A;  3FIQ A;  1SWO A;  1AIM A;  4RY2 A;  3RDX A;  4A8Z A;  5K16 A;  3L4R A;  4BBO A;  1F2B A;  2WQA E;  4WUR A;  4MI7 A;  4GE1 A;  3APV A;  1ZND A;  3TGA A;  4CPH B;  1DZJ A;  4BGF A;  5HA0 A;  2F7D A;  3O0U A;  4C5P A;  3SZI A;  3D9W A;  1VJV A;  2KD2 A;  4ZHD A;  3VG7 A;  2PY1 A;  2Q9S A;  4QBB A;  1NP4 A;  1PBY A;  3FYF A;  3CKF A;  2JTC A;  4YGH A;  4ORY A;  2OUL A;  4RUU A;  5CHV A;  2GHU A;  3NAD A;  1STR B;  3HWN A;  3OIS A;  3FEN A;  1OBQ A;  2B1M A;  3DSZ A;  4OMX A;  1EWP A;  1EXS A;  1QQS A;  4GGT A;  2VHS A;  1JJJ A;  4TJZ A;  1SLE B;  2H7J A;  5CHT A;  2R9O A;  3PED A;  5EEE A;  2DJF B;  1BSO A;  2L68 A;  4BOZ A;  3HOL A;  3FW5 A;  2Q4N A;  3MJ5 A;  3N3G A;  2E02 A;  3B2J A;  2R9C A;  3LTW A;  2XU5 A;  1VWQ B;  3CKG A;  2R9M A;  1LCV A;  1ICN A;  5EED A;  2RTC B;  4OS8 A;  3VG3 A;  1A6R A;  1SWD A;  3P6H A;  3RBY A;  1IFB A;  3ZZV A;  5CHK A;  4UU2 A;  2OY5 O;  3T1D A;  1TL9 A;  1U9W A;  1YZB A;  3O2Y A;  1FE3 A;  3QQ2 A;  4XUI A;  2A0A A;  4O4S A;  3FA8 A;  1X8P A;  2RTM A;  3IEJ A;  3FID A;  4TQ2 A;  1DZP A;  5AEO A;  1SRE A;  4B55 A;  1HMR A;  1EPB A;  2AVW A;  1GT3 A;  4CDE A;  1YWA A;  4L3R A;  2IZG B;  3MTN A;  2RTJ A;  4BX7 A;  4GU8 A;  5B5F A;  2WUT A;  3EW1 A;  1OBU A;  4Z28 A;  1OEK A;  1ZIV A;  2AH7 X;  5FEN A;  2UZ2 A;  3VG2 A;  5DG4 A;  3UEU A;  5KO3 A;  4Z2O A;  1SRI A;  3PH6 A;  3FA6 A;  3B21 A;  4CDF A;  3BCN A;  4BJ8 A;  4KII A;  1SLF B;  2W2F A;  4QGX A;  3P6C A;  4BX6 A;  1N7Y A;  1KT4 A;  4HPA A;  1HBP A;  3NX1 A;  3SAO A;  3UEV A;  5A24 A;  3ZWE A;  3T6L A;  2OFM X;  3O22 A;  3WOV A;  4Z27 A;  3D6S A;  3B2L A;  1G85 A;  4Z6J A;  1DF8 A;  1KT6 A;  4TKB A;  3STK A;  4N8W A;  3FDC A;  3T2X A;  1ZRY A;  1N9M A;  1SWA A;  1PE6 A;  2RCQ A;  1MIR A;  2NNE A;  2ZAI A;  4ALB A;  4YFQ A;  2QMI A;  5HZ9 A;  2DJF A;  2JGS A;  2FWV A;  1VWH B;  1QY0 A;  4ML7 B;  1MDC A;  2IZJ A;  1KQX A;  3VHH A;  1MDW A;  5EDB A;  2JU8 A;  4AW8 A;  2L67 A;  1KXR A;  4MVI A;  4ZJ0 A;  1RSU B;  4YKO A;  4AXM A;  3BU1 A;  3ZW0 B;  1X9Y A;  1SY1 A;  1I9H A;  4I60 A;  4QH6 A;  1JYJ A;  4GDA A;  4XMG A;  4GJV A;  2HH5 A;  1SY2 A;  2CBR A;  2YJ9 A;  2RTI B;  4OEL A;  1AYU A;  1VWE B;  2M4L A;  1VWA B;  2X8F A;  4GRJ A;  2L9C A;  3RDQ A;  1KT7 A;  3VU1 A;  2P86 A;  3KWB X;  1OBP A;  1AQB A;  1I06 A;  1PIP A;  3ZNH A;  3PRM A;  4XZX A;  4GKC A;  1BWY A;  1POP A;  3RVX A;  5AJB A;  5J94 A;  4YVA A;  4YVB A;  5CYB A;  5BVQ A;  2WBF X;  1DKI A;  3I0A A;  4KC7 A;  2OL7 A;  4YKM A;  2OFR X;  4Q8G A;  3MTV A;  4I3C A;  1ERB A;  1JJX A;  3DF0 A;  3K24 A;  3USV A;  2RTA A;  2OY1 O;  2BT9 A;  3HD3 A;  3CQN A;  4NNS A;  4Y5D A;  3F9D A;  2FLJ A;  4DCB A;  2DC6 A;  4BOS A;  4XMF A;  4BQV A;  2X55 A;  1VWN B;  2FTB A;  2RTH B;  1EWM A;  4L1N A;  1WBI A;  3H3I A;  2FE8 A;  3RNV A;  1KFF A;  2EU7 X;  3S26 A;  5LJE A;  3K8U A;  5LJK A;  4CPH A;  2QO6 A;  4YYR A;  1PBH A;  4ORR A;  4N7D A;  4IB9 A;  4HWM A;  1HMT A;  3PHU A;  1GX8 A;  1YK7 A;  3WXQ A;  1RST B;  3KFQ A;  8PCH A;  4FK5 A;  1VWI B;  1SWC A;  4FQB B;  2Y32 A;  3P5U A;  1ML7 A;  1SWL A;  3G7X A;  3O65 A;  4RUN A;  4DMY A;  5AJC A;  3QKG A;  1VWM B;  3PQU A;  1VWR B;  3PRP A;  5IO5 A;  3MX7 A;  3RE6 A;  4I05 A;  3NQK A;  1LUQ A;  1I78 A;  4COT A;  5JD2 A;  3BWK A;  4GUA A;  3VGW A;  3RY1 A;  1ZCM A;  1BSQ A;  1MUP A;  1NBX A;  4ZH9 A;  2C1Q A;  1GM6 A;  4AXL A;  2JRI A;  2JU7 A;  1PEE A;  3MP2 A;  1LCZ A;  2B1N A;  3I3T A;  1QDQ A;  1SWP A;  1IFC A;  1NQM A;  1VWB B;  4IAB A;  2IZK A;  5F2B A;  1KXO A;  5HWZ A;  4CPE A;  2GFO A;  1YK8 A;  4I07 A;  1Y9T A;  1CSB B;  4EEJ A;  5FAZ A;  3B79 A;  2P0R A;  2OF9 A;  5JH3 A;  1SWH A;  1MVG A;  3RSW A;  5F1E A;  4XME A;  2DCC A;  3IV2 A;  1UYN X;  1CBR A;  1MM9 A;  4Z2V A;  3GCB A;  1RBP A;  1LIE A;  5DPQ A;  4JHQ A;  1SLD B;  2YJC A;  3P02 A;  1CVZ A;  1G7N A;  2RTD B;  4D8E A;  2G7Y A;  4OW0 A;  3W31 A;  4QAE A;  4XMD A;  3KWZ A;  1QFT A;  3IHP A;  4BX5 B;  4IB8 A;  1FTP A;  1F2A A;  5H9L A;  3IA8 A;  3VG6 A;  1DZK A;  1S2P A;  1TOU A;  2OFB A;  2Y6E A;  4MSX A;  4KH8 A;  3VG5 A;  3F6Z B;  1TOW A;  3D97 A;  5L3Y A;  4IB6 A;  3EW2 A;  2GC9 A;  3X00 A;  4QRX A;  1EIO A;  3VHM A;  3P5V A;  1DF0 A;  3OVX A;  4HPC A;  1GXA A;  2ASN X;  2ALL X;  2G7B A;  4IAX A;  2P7U A;  4ORW A;  1ACD A;  4OS3 A;  1YWD A;  1Y08 A;  4GK9 A;  3BX8 A;  3ZW1 A;  1K24 A;  2Q2P A;  2DJG B;  4XMC A;  1VPR A;  4M7M A;  1FJ1 E;  1U9Q X;  2IZE B;  4DMX A;  2IFB A;  1JZU A;  2PI3 O;  2A13 A;  5IO6 A;  1CB5 A;  1AVE A;  1KZW A;  1NB3 A;  3BS2 A;  5HBS A;  1MEP A;  4DNE A;  5L8O A;  3MM0 A;  1BGO A;  4CZW A;  1LIC A;  5KIC A;  2O6X A;  3EYC A;  2Z4H A;  4QYP A;  3NBX X;  2XU1 A;  3AKN A;  1U9V A;  2RN4 A;  2FQ9 A;  2MF6 A;  2AS8 A;  1LNM A;  1U9X A;  3V6C A;  4QYN A;  2OF8 A;  1QY2 A;  4CK4 A;  3WJB A;  1QY1 A;  2OL8 O;  4BS5 A;  3KSE A;  2RTR B;  2GJ5 A;  4D6A A;  1VSN A;  3D96 A;  2CIO A;  5F02 A;  2AYN A;  4IMO A;  5FPW A;  1T0V A;  4CDD B;  2BDZ A;  2W2B A;  3BU9 A;  4O4X A;  4QQ1 A;  3WJD A;  4UU3 A;  1GX3 A;  2PRE A;  2HYS A;  2NQD B;  5FQ7 E;  5HA1 A;  2GTL O;  2J7Q A;  5EZ2 A;  1LKE A;  3QSD A;  3TGB A;  1A57 A;  1GT5 A;  1ZNH A;  1E00 A;  5D48 A;  1SRG A;  2E4J A;  2HNX A;  4WFV A;  4Y0P A;  3S3R A;  3PEC A;  3SLJ A;  3PPT A;  3FA9 A;  5FQ8 E;  5B27 A;  4PSQ A;  4YFR A;  5H9A A;  4ZHF A;  2IZC B;  1AU4 A;  1BLR A;  1RAV A;  3SZH A;  4IBA A;  3JSQ A;  2MJI A;  4IMN A;  3CWK A;  2DOS A;  1KZX A;  3HHI A;  1GGL A;  2GTF X;  3KKU A;  1XCA A;  1SWG A;  1KOI A;  5LKE A;  1T68 X;  5BVT A;  3S60 A;  1UZ2 X;  4ARH A;  1SWU A;  3PSE A;  4PAD A;  3WXE A;  2G8J A;  4NYQ A;  3PBH A;  3DTQ A;  2DM5 A;  1BRQ A;  3BDR A;  2JW1 A;  3U03 A;  1U0X A;  3MVF A;  1CJ5 A;  2AUZ A;  3IMA A;  2BTW B;  2QO5 A;  1QFV A;  3FW4 A;  3WYP A;  5F6Z A;  2IZB A;  3EM0 A;  4BOE A;  2FKJ A;  3WZO A;  2RTF B;  1ERX A;  5L8I A;  1GT1 A;  2R56 A;  1QMY A;  3CBJ A;  4MVK A;  5K06 A;  5IRU A;  4IAW A;  1QWD A;  1STF E;  4CDE B;  1SRH A;  1O0E A;  1YP7 A;  4WBK A;  2G78 A;  5H8T A;  1RXH A;  3CR6 A;  4K19 A;  4NW4 A;  4MIR A;  4FBO A;  1SRF A;  4Y0Q A;  2ZSC A;  2I5Z O;  4NV8 A;  4ZFX A;  4TNN A;  1YUP A;  1YIV A;  1NL6 A;  3CBS A;  3LHN A;  3LFY A;  1EWL A;  5EGW A;  2BDL A;  5FQ6 E;  3RKG A;  7PCK A;  2UYW A;  2FS6 A;  3O1G A;  1W5R A;  4ZR2 A;  3RDU A;  3APW A;  2DCA A;  3ZI8 A;  1X71 A;  2IZD B;  3FR5 A;  2AGA A;  3CMP A;  4OKA A;  4ALO A;  4KC8 A;  3AKM A;  4PI3 A;  5IXG A;  4MM3 B;  3BX7 A;  1EUO A;  3FEP A;  2FHN X;  2CZT A;  3WZN A;  3W30 A;  2RA6 A;  2A3F X;  4PT5 A;  1OPA A;  4FBV A;  2CBS A;  2RTK A;  5IO7 A;  5EZS A;  3ZW1 B;  4EFG A;  1S7D A;  1AYW A;  1OPB A;  5B3M O;  2AMM X;  3BBA A;  3H7D A;  1HY2 A;  3PQS A;  3VE1 A;  2HZQ A;  4OS0 A;  3BPF A;  1VWF B;  2BSZ A;  3RDS A;  2XU3 A;  2C0Y A;  1JBH A;  1X8N A;  2LKK A;  1YWB A;  3RVV A; 
#chains in the Genus database with same CATH homology
 1ZCM A;  1PPO A;  2PAD A;  4G54 A;  1AU2 A;  3PDF A;  4AXL A;  3P5W A;  1F2C A;  2B1N A;  2G8E A;  3I3T A;  2FTD A;  2DZZ A;  1QDQ A;  4YYV A;  2DCB A;  4MZO A;  1BP4 A;  3N3K A;  2GFO A;  3V6E A;  1NPZ A;  1YK8 A;  1EF7 A;  4I07 A;  4P6E A;  1CSB B;  3U8E A;  3B79 A;  2P0R A;  3OF9 A;  5JH3 A;  5PAD A;  1BY8 A;  2DCC A;  3IV2 A;  3AI8 A;  3GCB A;  2FUD A;  3IUT A;  3P5X A;  2NQG A;  1AIM A;  4RY2 A;  1K3B B;  2YJC A;  1BQI A;  1CVZ A;  4GUZ A;  2ATO A;  1XKG A;  2G7Y A;  3RVW A;  3S3Q A;  5K16 A;  4BSQ A;  1F2B A;  3KWZ A;  3OVZ A;  1NQC A;  3IHP A;  1F2A A;  2R6N A;  4BGF A;  2HHN A;  2AUX A;  2F7D A;  3O0U A;  4C5P A;  3D9W A;  1Y4H A;  2Y6E A;  1MS6 A;  3H8B A;  4MSX A;  1VJV A;  1SP4 B;  5CVO B;  4QBB A;  4ZUX U;  1GLO A;  4QRX A;  4PP2 E;  3P5V A;  2ARY A;  1DF0 A;  1PPP A;  2FYE A;  1ATK A;  3H89 A;  1YT7 A;  3OVX A;  2OUL A;  5CHV A;  2P7U A;  2GHU A;  1KFU L;  1Y08 A;  3HWN A;  3OIS A;  1HUC B;  4K7C A;  3MOR A;  2B1M A;  2DJG B;  4W4U A;  3KW9 A;  4X6I A;  3BC3 A;  1EWP A;  1K3B A;  2DCD A;  2VHS A;  3PNR A;  2E00 A;  2H7J A;  2FO5 A;  1U9Q X;  5CHT A;  2E01 A;  3BPM A;  2R9O A;  3H8C A;  4DMX A;  2DJF B;  3E1Z B;  2VFC A;  1CB5 A;  1NB3 A;  3N3G A;  3WXF A;  2E02 A;  1PAD A;  1AEC A;  3IOQ A;  4YYW A;  2R9C A;  2HXZ A;  1BGO A;  2PNS A;  4CZW A;  3LTW A;  2XU5 A;  2AYO A;  2R9M A;  1PPN A;  2O6X A;  1A6R A;  1CTE A;  4YYS A;  1F29 A;  4N79 A;  4QRG A;  3LXS A;  4FJC A;  4CDD A;  1TL9 A;  1U9W A;  2XU1 A;  1U9V A;  4QRV A;  3QJ3 A;  3M99 A;  1AU0 A;  1PPD A;  4XUI A;  1CPJ A;  2FQ9 A;  2XU4 A;  4I04 A;  3C9E A;  3IEJ A;  2AS8 A;  4Q8H A;  1U9X A;  3V6C A;  4B55 A;  2FT2 A;  2AVW A;  4CDE A;  3MTN A;  1EWO A;  4BS5 A;  3KSE A;  2VFB A;  2AIM A;  1VSN A;  3TNX A;  2CIO A;  4BPV A;  2Y5B A;  5F02 A;  2AYN A;  5FPW A;  3CH2 X;  3CH3 X;  1JQP A;  4CDD B;  2BDZ A;  2DC7 A;  1ZIV A;  2AU1 A;  2PRE A;  1GX3 A;  2NQD B;  5CVN B;  4CDF A;  3BCN A;  1AU3 A;  1YVB A;  2DZY A;  1IWD A;  2VHF A;  4HWY A;  3QSD A;  1W4T A;  9PAP A;  3S3R A;  5A24 A;  3I06 A;  4W5C A;  4N4Z A;  1ME3 A;  1AU4 A;  3D6S A;  2FRQ A;  2ACT A;  2E03 A;  4N8W A;  3HHI A;  1PE6 A;  1MIR A;  3KKU A;  3ZUA A;  1QXP A;  3CBK A;  2YJ2 A;  4PAD A;  3WXE A;  2DJF A;  3NHE A;  2DC9 A;  3BOW A;  2G8J A;  1E2T A;  3MHS A;  3PBH A;  1KHQ A;  4WA6 A;  4FIP A;  6PAD A;  2YJ8 A;  2OP3 A;  1MDW A;  1W6F A;  2YJB A;  1MEG A;  1KXR A;  4AXM A;  1X9Y A;  1MHW A;  2AUZ A;  2R9N A;  1GCB A;  3IMA A;  1PXV A;  1ME4 A;  4QH6 A;  1NLJ A;  2HH5 A;  2YJ9 A;  4MZS A;  1DEU A;  4OEL A;  2NQA A;  1AYU A;  1QOL A;  1KHP A;  1QMY A;  3CBJ A;  2DC8 A;  1THE A;  2P86 A;  3KWB X;  4P6G A;  1PIP A;  4CDE B;  1STF E;  1KFX L;  1MEM A;  1O0E A;  3RVX A;  1POP A;  5J94 A;  4YVA A;  2WBF X;  4W5B A;  4X6J A;  4NV7 A;  4BS6 A;  2NQI A;  4YV8 A;  4Q8G A;  1NB5 A;  2PBH A;  3DF0 A;  3K24 A;  3USV A;  2CB5 A;  4NV8 A;  4X6H A;  1GEC E;  2HD5 A;  3HD3 A;  1GMY A;  2JQF R;  2F1G A;  4YYQ A;  1NL6 A;  4CDC A;  1CJL A;  1TLO A;  3LFY A;  3OF8 A;  2DC6 A;  1EWL A;  5EGW A;  2BDL A;  4BQV A;  7PCK A;  3O1G A;  1W5R A;  1YAL A;  1EWM A;  3ERV A;  2OZ2 A;  2DCA A;  3K9M A;  3K8U A;  3HHA A;  5CVM A;  4YYU A;  4KLB A;  4YYR A;  1PBH A;  1ICF A;  3MHH A;  3KX1 A;  4OEM A;  3H6S A;  1S4V A;  1YK7 A;  4PI3 A;  4PP1 A;  2R9F A;  3KFQ A;  8PCH A;  4FK5 A;  1U5I A;  3WXG A;  1TU6 A;  3N4C A;  1SNK A;  3P5U A;  1AYV A;  3PW3 A;  3F75 A;  3QT4 A;  4DMY A;  2JQG R;  4CDC B;  1M6D A;  3F5V A;  1CS8 A;  1PCI A;  1CQD A;  1AYW A;  4CDF B;  3H7D A;  5JA7 A;  1ITO A;  1FH0 A;  2DJG A;  5EF4 A;  4I05 A;  3BPF A;  2BSZ A;  1Q6K A;  1CV8 A;  2XU3 A;  2C0Y A;  2IBI A;  3BWK A;  4XR7 A;  2G6D A;  2IPP B;  2FRA A;  3RVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...