4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
2F1GA 1ME4A 1PPDA 3RVXA 4MZOA 2OULA 2NQIA 4CDDB 2NQAA 1F2BA 2AIMA 1ZIVA 4QRGA 4YVAA 3LFYA 2YJ9A 1PXVA 2HHNA 2B1MA 1IWDA 1QXPA 2HD5A 1SP4B 3CH2X 2DC8A 3IV2A 4FIPA 3KWZA 1PIPA 2H7JA 4CDEB 4XUIA 3N3KA 2G6DA 3GCBA 2DCCA 3H8BA 2E03A 2ATOA 1AU4A 4QRXA 3P5XA 3U8EA 4CDFB 2XU1A 4OELA 2VHSA 2WBFX 2AU1A 2PADA 4X6IA 3P5UA 3KWBX 3N3GA 3P5VA 1U9VA 3S3QA 8PCHA 1AYVA 1AIMA 3IUTA 5A24A 1PE6A 4I04A 1AU3A 1U9XA 2P0RA 1ICFA 3O0UA 4FK5A 1VJVA 1AU0A 3K24A 4YYQA 1NB3A 2FT2A 5JA7A 2FRQA 1BP4A 3OVXA 1CPJA 3QT4A 2CIOA 2XU3A 2R9MA 1JQPA 1POPA 2R9OA 3D6SA 1BGOA 1Y08A 1S4VA 2NQGA 1AECA 1YVBA 2AUXA 2XU5A 3KX1A 1QMYA 1X9YA 5CHVA 2E00A 1ITOA 1AYWA 3BCNA 3MHSA 4W5BA 1DF0A 2FTDA 1STFE 4CDDA 3K8UA 4N79A 2G8JA 3IEJA 1Y4HA 4AXLA 1TL9A 9PAPA 1KXRA 2DC9A 1AYUA 1AU2A 1QDQA 1CSBB 5FPWA 3DF0A 4CDEA 4CZWA 3F75A 2R9NA 1U9WA 2OZ2A 4BS6A 4BPVA 2DJFB 1M6DA 3H7DA 4CDFA 5CVOB 1HUCB 2AVWA 5JH3A 2ACTA 3MTNA 1PPPA 3H89A 1CVZA 3S3RA 3PDFA 1A6RA 1CTEA 1NPZA 2FUDA 1CB5A 1YT7A 3HHIA 1EWOA 1PBHA 1XKGA 3WXEA 3ERVA 3OISA 2FYEA 3I06A 4I05A 1MEGA 2AS8A 3WXGA 3WXFA 3CBKA 3B79A 4WA6A 3BWKA 1BQIA 1GLOA 3NHEA 1Q6KA 4Q8HA 1F29A 2DC7A 4PP2E 3P5WA 1PPOA 3OVZA 1PCIA 5K16A 5CVMA 6PADA 1EWLA 2YJ8A 2AYNA 4DMYA 2PNSA 2R6NA 2DJGB 3KW9A 2XU4A 2YJCA 1EWPA 3HD3A 1KHPA 3N4CA 3KKUA 1U9QX 2R9FA 2GFOA 4YYSA 1NL6A 1YK8A 2YJ2A 1CJLA 3F5VA 3HHAA 4HWYA 4RY2A 4ZUXU 2FRAA 3CBJA 3IHPA 2DJFA 3RVVA 2C0YA 2B1NA 3BC3A 1BY8A 4PI3A 2FQ9A 3QSDA 3MHHA 3E1ZB 1VSNA 4N8WA 4QH6A 2YJBA 3KSEA 4CDCB 3BPFA 3PNRA 3BOWA 3OF8A 2IPPB 3IMAA 4OEMA 7PCKA 1NLJA 4KLBA 3HWNA 1F2CA 1O0EA 1K3BB 1NQCA 1FH0A 4Q8GA 3H6SA 1GCBA 1CS8A 2AYOA 5CHTA 1KFXL 2E01A 2JQGR 4QBBA 3C9EA 3I3TA 4W5CA 5CVNB 1SNKA 1KFUL 4BQVA 1ME3A 1YK7A 5EF4A 3K9MA 5F02A 1EWMA 1PPNA 5EGWA 5PADA 1GMYA 2PBHA 2HH5A 2DCBA 4I07A 5J94A 3BPMA 1EF7A 4AXMA 2E02A 3M99A 4BS5A 4P6GA 2PREA 2DCDA 3RVWA 3CH3X 2Y6EA 1DEUA 2DJGA 1CQDA 2G8EA 2DCAA 1CV8A 3V6CA 1U5IA 1F2AA 1MIRA 2DZZA 4MSXA 4DMXA 2Y5BA 4G54A 4FJCA 3QJ3A 4YYUA 2DZYA 1YALA 4X6HA 1ATKA 3PBHA 2VHFA 4PADA 4MZSA 4X6JA 4YV8A 2BDZA 3KFQA 3IOQA 4K7CA 4N4ZA 1MEMA 3USVA 2ARYA 2GHUA 4CDCA 3MORA 2DC6A 4BSQA 3LXSA 2P86A 3TNXA 2G7YA 2O6XA 4YYWA 1KHQA 1MDWA 2AUZA 1PADA 3O1GA 3V6EA 1K3BA 1THEA 4QRVA 3OF9A 1ZCMA 1NB5A 1MS6A 4XR7A 2HXZA 2BDLA 1GECE 1TU6A 3H8CA 2F7DA 2NQDB 3AI8A 3ZUAA 4PP1A 2IBIA 2CB5A 4YYRA 1MHWA 2P7UA 4P6EA 2R9CA 2FO5A 3PW3A 1QOLA 2JQFR 2OP3A 4W4UA 4YYVA 1TLOA
chains in the Genus database with same CATH superfamily
2F1GA 4GNWA 4TNNA 4IMNA 4TLJA 1E00A 4O3XB 3FA6A 3RVXA 4QRGA 1SWPA 2ACOA 2Y3FA 4WBKA 4YVAA 4AYHA 4YFQA 1VYFA 2OFMX 2Q9SA 2R73A 1A2DA 4CPIA 1O1VA 3WZQA 3WYQA 3ZW2A 1PIPA 2RTCB 4ORYA 4RF1A 2A0AA 4XUIA 2G6DA 2E03A 2ATOA 2AT5X 3U8EA 4CDFB 2XU1A 4D8EA 3SLJA 4OELA 5AQ6A 2VHSA 2AU1A 2PADA 5B5FA 4X6IA 3RWXA 4EEJA 2IZKA 2ACPX 5F2BA 1U9VA 4OS0A 1JMXA 5A24A 1PE6A 1QABE 1LFOA 3RDQA 4Y0SA 2P0RA 1YP7A 1VWQB 2RTEB 3CKGA 2CZUA 5D48A 1AU0A 1GT1A 2XSTA 4XMHA 4O4UA 4YYQA 4XMFA 4QNIA 2BS5A 3OE3A 2K62A 5JA7A 3ZZVA 5C0NA 2PY1A 4A1HA 3OVXA 1CPJA 4M0WA 2R9MA 4Y0RA 1MK5A 1VWBB 1SWRA 1POPA 2CBSA 2R9OA 5B29A 1N9YA 1BGOA 1JIWI 4ZH9A 2AUXA 2XU5A 5HZ8A 5CHVA 2OY1O 3BY0A 3ZW1B 2E00A 4DNEA 1LICA 3NP1A 1GT5A 2OF9A 1E5PA 2FHNX 3D9WA 1U18A 1SWNA 3WZNA 3HWGA 3WJBA 1SRFA 4ORWA 4YFRA 2X8TA 3RBYA 1TL9A 9PAPA 1EPBA 2CAMA 1H91A 4ZCBA 3P02A 1RSUB 4ZR2A 1FJ1E 5FPWA 5IRUA 3DF0A 1LCZA 3VHIA 2GTLN 1U9WA 4BS6A 4BPVA 5CSEA 5AEOA 5IXGA 4QAEA 5JH3A 4MIRA 3RDMA 1LKEA 1R0UA 2AT0X 3MTNA 3CWKA 1PPPA 3H89A 3FA8A 2Z4HA 3D4RA 2FT9A 3WBGA 1VWOB 3UEVA 1YT7A 2RN4A 1CBRA 3KFGA 5K06A 2A5BA 3NR3A 2FYEA 1SWSA 4L1NA 4I3DA 1IJ8A 1I4UA 3MJ5A 2X46A 4Y0PA 1BQIA 3U9PC 1EUOA 1N4JA 1AVEA 1VWFB 2G79A 3RDXA 1GLOA 2A5CA 3CQRA 1E02A 1Q6KA 1PEEA 1SLDB 1U17A 2QM9A 1FE3A 4PSQA 4YCEA 1BRQA 3P5WA 1HXZA 4UU2A 1Y52X 3KFFA 4U46A 3P6CA 4YDAA 5CVMA 3VPJE 1SWCA 6PADA 3X00A 1DC9A 4IB9A 4EKVA 2DJGB 3HPEA 3ZW0A 3EBWA 1JJXA 1EWPA 1VWCB 2FRSA 1U0XA 1KHPA 1MVGA 4BGFA 2RTOB 3CBSA 4O9SA 1YK8A 4A8ZA 4GUAA 2FR3A 3WJCA 3WJDA 3F5VA 4HWYA 4ZUXU 2FRAA 4ORUA 2DJFA 3RVVA 5IO5A 1VPRA 1BY8A 4AW8A 5HTDA 3HWDA 4U9CA 2RTMA 1AVGI 1X8NA 2RTDB 5KO3A 2NNDA 4XMCA 3RSWA 1P6PA 3PNRA 1OBUA 2JTCA 3BOWA 5LKEA 3SZIA 2WPUA 3HOLA 1SWQA 1PBOA 1TOWA 3ELXA 1SWDA 3HWNA 2C1QA 2WQAE 2F73A 5K68A 1N0SA 2WWPA 3MVFA 1GCBA 2FKJA 5CVNB 1SNKA 1ME3A 5EF4A 4GJSA 2MJIA 1EWMA 4C5PA 2JRIA 4O4OA 3IA8A 5PADA 4B55A 2A8GA 3TMPA 1OPAA 3AKMA 1T8VA 3PQUA 5D4AA 4IABA 2OVAA 3BPMA 4L3RA 2E02A 3M99A 4GD9A 4P6GA 2RTFB 2PREA 1SRHA 5H9LA 1PTSA 2NNQA 5CHKA 2G8EA 4LZUA 2DCAA 2AMMX 5JR8A 1U5IA 4ZHCA 1TVQA 1CRBA 1F2AA 2JW1A 1X8PA 1HQPA 3FEKA 1BWYA 2DZZA 2Y5BA 5L8NA 4Z2VA 1LIEA 3FA9A 3QJ3A 2MHDA 2FGSA 1I05A 1ATKA 4CPHB 3NADA 1IKJA 4X6JA 1LNMA 3IOQA 3ZWEA 2AF5A 5JD2A 2CM9A 4Z6JA 4NNSA 1A3YA 1HN2A 1L6MA 3MORA 2RTGB 4CV7A 5D8JA 4CPEA 2P86A 3TNXA 2FS7A 1ZNEA 2IZIA 1HMRA 3KZAA 4INNA 4GGTA 3V6EA 1KT7A 4O3YA 1KL4A 1YIVA 4BX7B 5E6JA 3STKA 1B8EA 2LBVA 1DZMA 3KQ0A 1SREA 2BDLA 3LV4A 1GECE 1KQXA 3WVMA 1VYOA 1KGLA 1YZBA 2NQDB 3AI8A 3ZUAA 4PP1A 2FLJA 3BSZE 1LDOA 1DV9A 4NYRA 1LCVA 2P7UA 4WFUA 1SWGA 2R9CA 2DM5A 1QOLA 2FS6A 1SY3A 4RF0A 5F7GA 1GXAA 2OY8A 4MVIA 1SWUA 1VWNB 5FFHA 3CKFA 4CDDB 2WSJA 4IB7A 5HCCC 5HA1A 1I04A 3P6GA 3TF6A 4ZHFA 5H9AA 2HHNA 4TQ2A 3FENA 4KC8A 1BRPA 1LF7A 1SP4B 3CH2X 2Y32A 2H7JA 1G74A 4R0BA 4JHQA 4AZOA 2X8FA 1SWAA 4QRXA 1EXSA 4O49A 3P5XA 4FBVA 4IP3A 1LELA 5H9KA 4NNTA 4IMOA 5L8IA 2NNEA 3EC5A 3WXQA 2AL0X 2AT6X 3P5VA 1SA8A 2RQ0A 1G5WA 1TOUA 4NV7A 2OVSA 3S3QA 3BRNA 3PEDA 1AIMA 2N93A 4GRJA 3IUTA 4I04A 3O2YA 1ICFA 2I5VO 4FK5A 4XMDA 1VJVA 3K24A 4OW0A 1NB3A 2FT2A 2AVIA 2QMIA 2FRQA 2BT9A 1DZKA 5F1EA 2CIOA 3ZNHA 4QYPA 1G7NA 3FEPA 2MM3A 2BU3A 2ASNX 3VGWA 4BOZA 5H9NA 2RTIB 1Y08A 3E9SA 4BBOA 4QZTA 1YVBA 4QGWA 3FLLA 5HCEC 1Z24A 3RY2A 1ITOA 2IZGB 3BCNA 3BY4A 2FHLA 1DF0A 2FTDA 2OY5O 5L8OA 3BDRA 3BX8A 3SZJA 5KICA 2G8JA 4AXLA 3HK1A 4I9RA 3LTWA 2AGAA 1ERBA 1AYUA 2G5LA 4ZHGA 2JN3A 3PRPA 1DF3A 3H7DA 4CDFA 2GTLO 1EIOA 1SLFB 4I3CA 3D95A 5EZ2A 5CVOB 2OF8A 4HWMA 1FEMA 4GGRA 2A13A 2HLVA 1NBXA 4GGZA 3GE2A 3UEXA 2ACTA 1BSOA 1SWJA 1CVZA 2Q2PA 3PDFA 2J7QA 1CTEA 1NPZA 1CB5A 4HPBA 2JOZA 1MUPA 1MX8A 1K24A 1PBHA 3WXEA 3ERVA 3OISA 4BX6B 4I05A 2AS8A 3WXFA 2G8CO 1KT4A 3CBKA 4WA6A 2A3FX 3HTYA 1ALBA 3BWKA 3OD9A 3F8AA 1SRGA 3NQ3A 1CJ5A 4PP2E 4WHIA 3F6ZB 1ZRYA 1QY2A 1LUQA 3MM0A 3ZW1A 4CK4A 3F9DA 2KTDA 4JGLA 1W6FA 1AB0A 2AYNA 2CZTA 2R6NA 4IB8A 3DSZA 1VWLB 5EDCA 1U9QX 1ZNHA 4O3WA 2JMBA 4ODDA 4YH0A 4RY2A 1Y55X 3MG5A 2F09A 4IAWA 3KVNA 1PVJA 2C0YA 4AZPA 3I0AA 3BC3A 1S7DA 4OS3A 3UEUA 2FQ9A 3QSDA 3ZI8A 3VHHA 1VWJB 2GTLM 3SLTA 1KXOA 3HWFA 4N8WA 3KSEA 1RXHA 2O62A 4Z27A 5HCDC 4CDCB 4OS8A 2IPPB 3UAQA 5DG4A 1OEKA 4KLBA 2L5PA 5LJDA 3WYPA 1O0EA 5B10O 1K3BB 1FH0A 2KTSA 2MO5A 3OBLA 1CS8A 4ZHDA 4YGGA 2AYOA 4W5CA 4QBBA 2OL7A 2FWVA 2ZAIA 1ZNDA 1KFUL 4BQVA 3C0RA 1YK7A 4MVEA 2IZAA 5IO7A 2FE8A 2EU7X 4ORRA 4BOPA 1DFVA 4BJ8A 3WOVA 3BU1A 4BOEA 1GKAB 2HH5A 4AZQA 4I07A 1YP6A 2IFBA 1HMTA 1SLGB 2Z84A 4YCHA 1XKIA 4K19A 1SWOA 2DJGA 3V8UA 4QYNA 5HZ9A 3PHUA 4GKCA 4IBAA 2R56A 3PQSA 1SXYA 3FR2A 2CBRA 2DZYA 2Q39A 3T6FA 1X89A 2X32A 1STRB 3PBHA 2VHFA 1EQDA 3OJYC 4YV8A 3DTQA 2ZSCA 4OMXA 1TW4A 3P6EA 1VWPB 3USVA 3FDCA 2ARYA 3BB7A 1HBPA 3G7XA 1YWBA 4BSQA 1SXXA 2G7YA 1SRIA 2L9CA 2QO5A 1MDWA 1LIDA 4AZNA 2AUZA 3KFHA 2BTWB 3O1GA 1EPAA 1MDCA 1TXLA 5L3YA 2WR6A 2LKKA 3APXA 1MS6A 4EFGA 1SY0A 4I9SA 5EPQA 3RE5A 1DZPA 4Y0QA 2WUTA 1TU6A 1KL5A 3Q6LA 4OVZB 2RTLA 4I95A 5B5GA 2OFBA 3L4RA 4YYRA 1ML7A 3ZW0B 1ACDA 3VHMA 3SLOA 2OFRX 2J7QC 2FO5A 3PW3A 1UZ2X 2JQFR 2GC9A 2WEWA 4IB6A 4ZFXA 3FIDA 1CBIA 3APWA 1ME4A 1PPDA 3PT2A 3BU9A 5HAEA 4QZUA 2HNXA 1LIBA 3W30A 3EYCA 2AIMA 1IKEA 1ZIVA 5EZQA 1UYNX 3VG4A 3LFYA 2OVEA 2B1MA 1HQQA 1IWDA 3PECA 1YWCA 4CPHA 2HD5A 1GGLA 2FKGA 4FIPA 3W31A 5EEDA 2QO6A 4CDEB 3N3KA 3GCBA 4ES7A 4IAXA 2UZ2A 4LKPA 3H8BA 1VYGA 1AU4A 4U8UN 4YKMA 3Q34A 2X34A 4GE1A 4YDBA 3RKGA 1GX3A 2WBFX 1QFVA 1GT3A 5FAZA 5HZ5A 3WZPA 3P5UA 3KWBX 3N3GA 4Z2PA 3STMX 3WZOA 4BX7A 1CBSA 1QG5A 1AYVA 1STPA 4BX5B 3P6FA 2RCTA 1ZNLA 4HFOA 2ALLX 1VWHB 2LBAA 3EW2A 3O0UA 2G7BA 5CE4A 1ICNA 4GDAA 5B3MO 4R3DA 5BVSA 2HKDA 3QT4A 3PPTA 4Z28A 1JJJA 4N7CA 3O22A 3RDUA 3HOEA 1OBQA 3FA7A 1HXLA 1A57A 2NQGA 1PMPA 3EW1A 1NC9A 1X9YA 1BEBA 3LHNA 3VG5A 5LJHA 1YUPA 4MISA 1E06A 1AYWA 4W5BA 3MHSA 4A5UA 4YKOA 3RNVA 4KC7A 4MEEA 2GJ5A 3T2XA 4CDDA 1T68X 1AELA 3K8UA 2KD2A 5K67A 3IEJA 1GM6A 2X55A 1AVDA 3C76X 3P24A 3KFIA 5HBSA 1KXRA 3FR5A 1SWEA 1YWAA 1S2PA 3FIQA 1LIFA 1QDQA 1KT3A 3TZSA 1HMSA 4BOUA 1D2UA 3FYFA 1D3SA 2HZRA 3F75A 3T2WA 2OZ2A 1AQBA 3SOTA 4I3BA 2MWHA 2X56A 1M6DA 1UKFA 1IFBA 3PK2A 4YGZA 1FTPA 4A60A 2IZCB 3CMPA 4BOSA 2AVWA 5IO6A 1X8UA 2IZHB 2QOSC 1JYJA 3S3RA 4D8BA 1DKIA 2MF6A 1A6RA 3ZQ3A 3BS2A 3EMMA 2HYSA 1OBPA 4KCAA 1T0VA 1B0OA 1XKGA 1MEGA 4ARHA 2LFOA 1RSTB 2RTAA 1KL3A 1MX7A 1I78A 1RXJA 1SXWA 3PHWA 5BVQA 2LA7A 2DOSA 3NHEA 3O65A 2RTQB 4GDZA 4EQAC 2DC7A 4GETA 2A2GA 1SLEB 1Y53X 2OL8O 1PPOA 2W2FA 4GU8A 4OMWA 1NP4A 4HPAA 1I06A 1N43A 3B2LA 2YJ8A 2BHVA 4HXDB 4DMYA 2PNSA 3BBAA 3RZYA 4U3QA 2YJCA 1STSB 4ORXA 4IUMA 1KZXA 2JU3A 1N7YA 2GFOA 5AJBA 5DPQA 1X8OA 1NL6A 2QO4A 4YVBA 2YJ2A 4ON1A 4ZGUA 4YFPA 1CJLA 2HZQA 2OYBO 3JSQA 3IHPA 2C1SA 4PI3A 3VG7A 3K3LA 3MHHA 3S26A 1RAVA 4RNAA 3MTVA 4TKJA 4ALOA 1KFFA 1VSNA 2BSZA 2WEXA 4QH6A 5HZQA 2XKLA 1SWKA 3BPFA 4GUZA 5FENA 4ORSA 4TJZA 3OF8A 7PCKA 1NLJA 3U03A 1N9MA 3D97A 3IFBA 4XMGA 1NQCA 3HWEA 4I60A 4Q8GA 3H6SA 4QGXA 4BX6A 5HZ6A 4NYQA 5KIDA 2RA6A 1B56A 5CHTA 5BVTA 1KFXL 2E01A 2JQGR 3C9EA 3B2IA 1VWAB 2UYWA 5FQ7E 2IZEB 5F02A 3H3IA 1KQWA 3AUMO 3SAOA 4O3ZA 5B27A 4QGVA 4CPFA 2W2AA 3ZUIA 2PBHA 3B21A 1JV4A 5J94A 1VWDB 5LKFA 3RDOA 1MEPA 1S44A 3GAQA 4AXMA 5LJCA 2KW1A 2RTJA 1JYDA 3PHXA 2DCDA 2Y6EA 3MP2A 3TGCA 4RUNA 1WBIA 1CV8A 3V6CA 2IZFB 4ZGFA 1MIRA 4MSXA 4DMXA 3VU1A 4G54A 4WFVA 4YYUA 1BJ7A 2Q4NA 1YALA 4X6HA 2AH7X 4PADA 2JU8A 4HPCA 2GH7A 1SWBA 1BSYA 4K7CA 3CR6A 2C4IA 4TKBA 1MEMA 2RTNB 2GHUA 4AZMA 2RCQA 3MX7A 4CDCA 1QQSA 2L67A 3LXSA 1SWHA 1SWLA 2O6XA 2PI3O 1KHQA 1QFTA 3B2HA 1K3BA 1THEA 2UZJA 4QRVA 4D6AA 1NB5A 3CQNA 2A2UA 4FBOA 3P6DA 1PBYA 4ML7B 2HXZA 3APUA 5BYPA 3BLGA 2F01A 2W2BA 2BC3A 2X4MA 1BM5A 1SXUA 2IBIA 2OZQA 3PH6A 2BLGA 3FW4A 1FDQA 4ZHHA 1QWDA 2FR2A 1X8QA 2Z4IA 4REZA 1GKAA 3JQOA 5IRWA 4P6EA 2LB6A 4KT5A 1LDQA 3S60A 4DQ3A 2X45A 4YYVA 4NV8A 1SMPI 1MOYA 3MBTA 5JZEA 4TKHA 4MM3B 2Q2MA 4I6SA 3RY1A 4YBUA 5EEEA 4MZOA 2OULA 2NQIA 2NQAA 2NP1A 1F2BA 4BOQA 3OQCA 2YJ9A 1PXVA 5HWZA 1GX8A 3T6LA 1QXPA 2AT3X 1EALA 4MI7A 1IW2A 3IV2A 2DC8A 2ZAGA 3FW5A 2AT8X 3KWZA 3D96A 1ADLA 5D45A 2RTKA 2DCCA 3T1DA 4BVMA 2JGSA 1E2TA 3ZUOA 4M6SA 2HWKA 2RTPB 1VWRB 4U8UO 3AKNA 1JZUA 4M7MA 3S5XA 2OY7A 1VWEB 2X8SA 2BTWA 4CSBA 8PCHA 2IZJA 1W4TA 1FELA 1JMZA 5LJBA 1AU3A 1DF8A 1U9XA 4Z2OA 4P16A 4OVZA 1W5RA 5B11O 3VE1A 2RD7C 5CYBA 2VFBA 4YMYA 1BP4A 3JS1A 2XU3A 5EZSA 1JQPA 2QOMA 4D6BA 4JO6A 3D6SA 3VG6A 3NX1A 1O1UA 1S4VA 1BLRA 1AECA 3KX1A 1QMYA 4FGIB 4YGHA 1EI5A 1Y9LA 3QQ2A 3APVA 1STFE 3CBCA 5F58A 1HBQA 2IZLB 4N79A 1CBQA 5AJCA 1Y4HA 1FENA 2GTFX 3E3CA 2JU7A 1OEEA 3FMZA 4JNJA 1OEJA 2DC9A 1AU2A 2K23A 3EBKA 1B4MA 2QCBA 1CSBB 4HPDA 2VFCA 3EM0A 4MVKA 5HTEA 1WUBA 4CDEA 3STNA 4CZWA 2R9NA 2L68A 3U0DA 2DJFB 4RUUA 2YG2A 4GZVA 1KT5A 1RBPA 1HUCB 2R74A 4Y5DA 3ELZA 3NX2A 3VG2A 4U8UM 2HMBA 4BX5A 1VWKB 2FUDA 4GK9A 3TRKA 3C77X 4MVLA 2ANSA 4N7DA 3HHIA 1VWGB 4FBRA 1EWOA 1A18A 1RLBE 3I06A 3TGBA 3WXGA 2RTBB 3B79A 4NP1A 3B2JA 3PRMA 4A1YA 5FQ6E 4YBPA 5HA0A 3QKGA 4BQUA 3IFUA 4RKXA 4Q8HA 1F29A 4UU3A 1UREA 1XCAA 5FQ8E 4QRLA 4O4SA 1G85A 3UEWA 4WURA 3OVZA 1PCIA 5K16A 3FELA 3NQKA 1EWLA 1VWIB 3PSEA 3KW9A 2XU4A 4IRWA 1BSQA 3HD3A 1OSPO 3N4CA 2FTBA 3KKUA 4ALBA 3NPOA 2R9FA 4AZRA 4KIIA 4YYSA 4COTA 1SY2A 2Y3EA 3AEHA 2YMSA 4LZVA 3HHAA 4EDEA 3CBJA 2B1NA 1OPBA 1SRJA 3E1ZB 1Y9TA 1NP1A 2E4JA 4BCSA 3RE6A 1SY1A 2M4LA 4NLIA 3C78X 5EDBA 5F6BA 2IZBA 1NQNA 2YJBA 3O19A 1EW3A 1I9HA 3IMAA 4EXZA 4OEMA 4GJVA 1F2CA 4ZTBA 3NBXX 3VE2A 1RXKA 1NGLA 2P8GA 4DQ4A 1O8VA 4NLJA 2OVDA 2WQ9A 3I3TA 2BS6A 1IFCA 3K9MA 1LCWA 1PM1X 4KH8A 4ZH6A 1DZJA 1PPNA 1BBPA 5EGWA 1GMYA 2RTRB 4GNYA 4LQZA 2DCBA 4PT5A 3B2KA 4GH7A 1EF7A 3I17A 4BS5A 3WJEA 3N91A 1GT4A 3RVWA 3CH3X 1DEUA 3BX7A 3WJFA 2OFAA 1CQDA 4FQBB 5H8TA 1SWTA 3WJGA 1KZWA 4LKTA 5IRAA 3VG3A 3PH5A 5KHPA 5LJKA 3NQ9A 3FR4A 1NQMA 1IIUA 4FJCA 2IZDB 2POAA 4OKAA 1ERXA 1JJUA 4MZSA 4D8IA 1X71A 2BDZA 1KOIA 3KFQA 1JBHA 1UYOX 4N4ZA 1HY2A 2OL6O 1MM9A 4XMEA 3SZHA 1ZNGA 5D47A 1KT6A 1ZNKA 4XZXA 1NDJA 4ZJ0A 3TGAA 2DC6A 1YWDA 1Y0GA 1ICMA 1SWFA 2KT4B 4YYWA 1LPJA 4Y59A 4PJ2A 1PADA 5LJEA 3OF9A 1ZCMA 5B2AO 5F6ZA 2CM4A 4QQ1A 2G78A 3P6HA 4XR7A 3PP6A 3S5VA 5LJGA 1EIIA 2VDFA 1VWMB 3H8CA 4DCBA 2F7DA 4NW4A 3RDSA 4O4XA 1QY1A 2AKQA 2CB5A 1MHWA 4ID2A 2I5ZO 1QY0A 2RTHB 2OP3A 4W4UA 1GX9A 1TLOA
chains in the Genus database with same CATH topology
2F1GA 1ME4A 1PPDA 3RVXA 4MZOA 2OULA 2NQIA 4CDDB 2NQAA 1F2BA 2AIMA 1ZIVA 4QRGA 4YVAA 3LFYA 2YJ9A 1PXVA 2HHNA 2B1MA 1IWDA 1QXPA 2HD5A 1SP4B 3CH2X 2DC8A 3IV2A 4FIPA 3KWZA 1PIPA 2H7JA 4CDEB 4XUIA 3N3KA 2G6DA 3GCBA 2DCCA 3H8BA 2E03A 2ATOA 1AU4A 4QRXA 1E2TA 3P5XA 3U8EA 4CDFB 2XU1A 4OELA 1GX3A 2VHSA 2WBFX 2AU1A 2PADA 4X6IA 3P5UA 3KWBX 3N3GA 3P5VA 1U9VA 4NV7A 3S3QA 8PCHA 1AYVA 1AIMA 1W4TA 3IUTA 5A24A 1PE6A 4I04A 1AU3A 1U9XA 2P0RA 1ICFA 3O0UA 4FK5A 1VJVA 1W5RA 1AU0A 3K24A 4YYQA 1NB3A 2FT2A 5JA7A 2VFBA 2FRQA 1BP4A 3OVXA 1CPJA 3QT4A 2CIOA 2XU3A 2R9MA 1JQPA 1POPA 2R9OA 3D6SA 1BGOA 1Y08A 1S4VA 2NQGA 1AECA 1YVBA 2AUXA 2XU5A 3KX1A 1QMYA 1X9YA 5CHVA 2E00A 1ITOA 1AYWA 3BCNA 3MHSA 4W5BA 1DF0A 2FTDA 1STFE 3D9WA 4CDDA 3K8UA 4N79A 2G8JA 3IEJA 1Y4HA 4AXLA 1TL9A 9PAPA 3LTWA 1KXRA 2DC9A 1AYUA 1AU2A 1QDQA 1CSBB 5FPWA 2VFCA 3DF0A 4CDEA 4CZWA 3F75A 2R9NA 1U9WA 2OZ2A 4BS6A 4BPVA 2DJFB 1M6DA 3H7DA 4CDFA 5CVOB 1HUCB 2AVWA 5JH3A 2ACTA 3MTNA 1PPPA 3H89A 1CVZA 3S3RA 3PDFA 1A6RA 1CTEA 1NPZA 2FUDA 1CB5A 1YT7A 3HHIA 1EWOA 1PBHA 1XKGA 3WXEA 3ERVA 3OISA 3I06A 2FYEA 4I05A 1MEGA 2AS8A 3WXGA 3WXFA 3CBKA 3B79A 4WA6A 3BWKA 1BQIA 1GLOA 3NHEA 1Q6KA 4Q8HA 1F29A 2DC7A 4PP2E 3P5WA 1PPOA 3OVZA 1PCIA 5K16A 5CVMA 6PADA 1EWLA 1W6FA 2YJ8A 2AYNA 4DMYA 2PNSA 2R6NA 2DJGB 3KW9A 2XU4A 2YJCA 1EWPA 3HD3A 1KHPA 3N4CA 3KKUA 1U9QX 4BGFA 2R9FA 2GFOA 4YYSA 1NL6A 1YK8A 2YJ2A 1CJLA 3F5VA 3HHAA 4HWYA 4RY2A 4ZUXU 2FRAA 3CBJA 3IHPA 2DJFA 3RVVA 2C0YA 2B1NA 3BC3A 1BY8A 4PI3A 2FQ9A 3QSDA 3MHHA 3E1ZB 1VSNA 2BSZA 4N8WA 4QH6A 2YJBA 3KSEA 4CDCB 3BPFA 3PNRA 4GUZA 3BOWA 3OF8A 2IPPB 3IMAA 4OEMA 7PCKA 1NLJA 4KLBA 3HWNA 1F2CA 1O0EA 1K3BB 1NQCA 1FH0A 4Q8GA 3H6SA 1GCBA 1CS8A 2AYOA 5CHTA 1KFXL 2E01A 2JQGR 4QBBA 3C9EA 3I3TA 4W5CA 5CVNB 1SNKA 1KFUL 4BQVA 1ME3A 1YK7A 5EF4A 3K9MA 5F02A 1EWMA 1PPNA 4C5PA 5EGWA 5PADA 1GMYA 4B55A 2PBHA 2HH5A 2DCBA 4I07A 5J94A 3BPMA 1EF7A 4AXMA 2E02A 3M99A 4BS5A 4P6GA 2PREA 2DCDA 3RVWA 3CH3X 2Y6EA 1DEUA 2DJGA 1CQDA 2G8EA 2DCAA 1CV8A 3V6CA 1U5IA 1F2AA 1MIRA 2DZZA 4MSXA 4DMXA 2Y5BA 4G54A 4FJCA 3QJ3A 4YYUA 2DZYA 1YALA 4X6HA 1ATKA 3PBHA 2VHFA 4MZSA 4PADA 4X6JA 4YV8A 2BDZA 3KFQA 3IOQA 4K7CA 4N4ZA 1MEMA 3USVA 2ARYA 2GHUA 4CDCA 3MORA 2DC6A 4BSQA 3LXSA 2P86A 3TNXA 2G7YA 2O6XA 4YYWA 1KHQA 1MDWA 2AUZA 1PADA 3O1GA 3V6EA 1K3BA 1THEA 4QRVA 3OF9A 1ZCMA 1NB5A 1MS6A 4XR7A 2HXZA 2BDLA 1GECE 1TU6A 3H8CA 2F7DA 2NQDB 3AI8A 3ZUAA 4PP1A 2IBIA 2CB5A 4YYRA 1MHWA 2P7UA 4P6EA 2R9CA 2FO5A 3PW3A 1QOLA 2JQFR 2OP3A 4W4UA 4YYVA 4NV8A 1TLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F1G A;  1ME4 A;  1PPD A;  3RVX A;  4MZO A;  2OUL A;  2NQI A;  4CDD B;  2NQA A;  1F2B A;  2AIM A;  1ZIV A;  4QRG A;  4YVA A;  3LFY A;  2YJ9 A;  1PXV A;  2HHN A;  2B1M A;  1IWD A;  1QXP A;  2HD5 A;  1SP4 B;  3CH2 X;  2DC8 A;  3IV2 A;  4FIP A;  3KWZ A;  1PIP A;  2H7J A;  4CDE B;  4XUI A;  3N3K A;  2G6D A;  3GCB A;  2DCC A;  3H8B A;  2E03 A;  2ATO A;  1AU4 A;  4QRX A;  3P5X A;  3U8E A;  4CDF B;  2XU1 A;  4OEL A;  2VHS A;  2WBF X;  2AU1 A;  2PAD A;  4X6I A;  3P5U A;  3KWB X;  3N3G A;  3P5V A;  1U9V A;  3S3Q A;  8PCH A;  1AYV A;  1AIM A;  3IUT A;  5A24 A;  1PE6 A;  4I04 A;  1AU3 A;  1U9X A;  2P0R A;  1ICF A;  3O0U A;  4FK5 A;  1VJV A;  1AU0 A;  3K24 A;  4YYQ A;  1NB3 A;  2FT2 A;  5JA7 A;  2FRQ A;  1BP4 A;  3OVX A;  1CPJ A;  3QT4 A;  2CIO A;  2XU3 A;  2R9M A;  1JQP A;  1POP A;  2R9O A;  3D6S A;  1BGO A;  1Y08 A;  1S4V A;  2NQG A;  1AEC A;  1YVB A;  2AUX A;  2XU5 A;  3KX1 A;  1QMY A;  1X9Y A;  5CHV A;  2E00 A;  1ITO A;  1AYW A;  3BCN A;  3MHS A;  4W5B A;  1DF0 A;  2FTD A;  1STF E;  4CDD A;  3K8U A;  4N79 A;  2G8J A;  3IEJ A;  1Y4H A;  4AXL A;  1TL9 A;  9PAP A;  1KXR A;  2DC9 A;  1AYU A;  1AU2 A;  1QDQ A;  1CSB B;  5FPW A;  3DF0 A;  4CDE A;  4CZW A;  3F75 A;  2R9N A;  1U9W A;  2OZ2 A;  4BS6 A;  4BPV A;  2DJF B;  1M6D A;  3H7D A;  4CDF A;  5CVO B;  1HUC B;  2AVW A;  5JH3 A;  2ACT A;  3MTN A;  1PPP A;  3H89 A;  1CVZ A;  3S3R A;  3PDF A;  1A6R A;  1CTE A;  1NPZ A;  2FUD A;  1CB5 A;  1YT7 A;  3HHI A;  1EWO A;  1PBH A;  1XKG A;  3WXE A;  3ERV A;  3OIS A;  2FYE A;  3I06 A;  4I05 A;  1MEG A;  2AS8 A;  3WXG A;  3WXF A;  3CBK A;  3B79 A;  4WA6 A;  3BWK A;  1BQI A;  1GLO A;  3NHE A;  1Q6K A;  4Q8H A;  1F29 A;  2DC7 A;  4PP2 E;  3P5W A;  1PPO A;  3OVZ A;  1PCI A;  5K16 A;  5CVM A;  6PAD A;  1EWL A;  2YJ8 A;  2AYN A;  4DMY A;  2PNS A;  2R6N A;  2DJG B;  3KW9 A;  2XU4 A;  2YJC A;  1EWP A;  3HD3 A;  1KHP A;  3N4C A;  3KKU A;  1U9Q X;  2R9F A;  2GFO A;  4YYS A;  1NL6 A;  1YK8 A;  2YJ2 A;  1CJL A;  3F5V A;  3HHA A;  4HWY A;  4RY2 A;  4ZUX U;  2FRA A;  3CBJ A;  3IHP A;  2DJF A;  3RVV A;  2C0Y A;  2B1N A;  3BC3 A;  1BY8 A;  4PI3 A;  2FQ9 A;  3QSD A;  3MHH A;  3E1Z B;  1VSN A;  4N8W A;  4QH6 A;  2YJB A;  3KSE A;  4CDC B;  3BPF A;  3PNR A;  3BOW A;  3OF8 A;  2IPP B;  3IMA A;  4OEM A;  7PCK A;  1NLJ A;  4KLB A;  3HWN A;  1F2C A;  1O0E A;  1K3B B;  1NQC A;  1FH0 A;  4Q8G A;  3H6S A;  1GCB A;  1CS8 A;  2AYO A;  5CHT A;  1KFX L;  2E01 A;  2JQG R;  4QBB A;  3C9E A;  3I3T A;  4W5C A;  5CVN B;  1SNK A;  1KFU L;  4BQV A;  1ME3 A;  1YK7 A;  5EF4 A;  3K9M A;  5F02 A;  1EWM A;  1PPN A;  5EGW A;  5PAD A;  1GMY A;  2PBH A;  2HH5 A;  2DCB A;  4I07 A;  5J94 A;  3BPM A;  1EF7 A;  4AXM A;  2E02 A;  3M99 A;  4BS5 A;  4P6G A;  2PRE A;  2DCD A;  3RVW A;  3CH3 X;  2Y6E A;  1DEU A;  2DJG A;  1CQD A;  2G8E A;  2DCA A;  1CV8 A;  3V6C A;  1U5I A;  1F2A A;  1MIR A;  2DZZ A;  4MSX A;  4DMX A;  2Y5B A;  4G54 A;  4FJC A;  3QJ3 A;  4YYU A;  2DZY A;  1YAL A;  4X6H A;  1ATK A;  3PBH A;  2VHF A;  4PAD A;  4MZS A;  4X6J A;  4YV8 A;  2BDZ A;  3KFQ A;  3IOQ A;  4K7C A;  4N4Z A;  1MEM A;  3USV A;  2ARY A;  2GHU A;  4CDC A;  3MOR A;  2DC6 A;  4BSQ A;  3LXS A;  2P86 A;  3TNX A;  2G7Y A;  2O6X A;  4YYW A;  1KHQ A;  1MDW A;  2AUZ A;  1PAD A;  3O1G A;  3V6E A;  1K3B A;  1THE A;  4QRV A;  3OF9 A;  1ZCM A;  1NB5 A;  1MS6 A;  4XR7 A;  2HXZ A;  2BDL A;  1GEC E;  1TU6 A;  3H8C A;  2F7D A;  2NQD B;  3AI8 A;  3ZUA A;  4PP1 A;  2IBI A;  2CB5 A;  4YYR A;  1MHW A;  2P7U A;  4P6E A;  2R9C A;  2FO5 A;  3PW3 A;  1QOL A;  2JQF R;  2OP3 A;  4W4U A;  4YYV A;  1TLO A; 
#chains in the Genus database with same CATH topology
 2F1G A;  4GNW A;  4TNN A;  4IMN A;  4TLJ A;  1E00 A;  4O3X B;  3FA6 A;  3RVX A;  4QRG A;  1SWP A;  2ACO A;  2Y3F A;  4WBK A;  4YVA A;  4AYH A;  4YFQ A;  1VYF A;  2OFM X;  2Q9S A;  2R73 A;  1A2D A;  4CPI A;  1O1V A;  3WZQ A;  3WYQ A;  3ZW2 A;  1PIP A;  2RTC B;  4ORY A;  4RF1 A;  2A0A A;  4XUI A;  2G6D A;  2E03 A;  2ATO A;  2AT5 X;  3U8E A;  4CDF B;  2XU1 A;  4D8E A;  3SLJ A;  4OEL A;  5AQ6 A;  2VHS A;  2AU1 A;  2PAD A;  5B5F A;  4X6I A;  3RWX A;  4EEJ A;  2IZK A;  2ACP X;  5F2B A;  1U9V A;  4OS0 A;  1JMX A;  5A24 A;  1PE6 A;  1QAB E;  1LFO A;  3RDQ A;  4Y0S A;  2P0R A;  1YP7 A;  1VWQ B;  2RTE B;  3CKG A;  2CZU A;  5D48 A;  1AU0 A;  1GT1 A;  2XST A;  4XMH A;  4O4U A;  4YYQ A;  4XMF A;  4QNI A;  2BS5 A;  3OE3 A;  2K62 A;  5JA7 A;  3ZZV A;  5C0N A;  2PY1 A;  4A1H A;  3OVX A;  1CPJ A;  4M0W A;  2R9M A;  4Y0R A;  1MK5 A;  1VWB B;  1SWR A;  1POP A;  2CBS A;  2R9O A;  5B29 A;  1N9Y A;  1BGO A;  1JIW I;  4ZH9 A;  2AUX A;  2XU5 A;  5HZ8 A;  5CHV A;  2OY1 O;  3BY0 A;  3ZW1 B;  2E00 A;  4DNE A;  1LIC A;  3NP1 A;  1GT5 A;  2OF9 A;  1E5P A;  2FHN X;  3D9W A;  1U18 A;  1SWN A;  3WZN A;  3HWG A;  3WJB A;  1SRF A;  4ORW A;  4YFR A;  2X8T A;  3RBY A;  1TL9 A;  9PAP A;  1EPB A;  2CAM A;  1H91 A;  4ZCB A;  3P02 A;  1RSU B;  4ZR2 A;  1FJ1 E;  5FPW A;  5IRU A;  3DF0 A;  1LCZ A;  3VHI A;  2GTL N;  1U9W A;  4BS6 A;  4BPV A;  5CSE A;  5AEO A;  5IXG A;  4QAE A;  5JH3 A;  4MIR A;  3RDM A;  1LKE A;  1R0U A;  2AT0 X;  3MTN A;  3CWK A;  1PPP A;  3H89 A;  3FA8 A;  2Z4H A;  3D4R A;  2FT9 A;  3WBG A;  1VWO B;  3UEV A;  1YT7 A;  2RN4 A;  1CBR A;  3KFG A;  5K06 A;  2A5B A;  3NR3 A;  2FYE A;  1SWS A;  4L1N A;  4I3D A;  1IJ8 A;  1I4U A;  3MJ5 A;  2X46 A;  4Y0P A;  1BQI A;  3U9P C;  1EUO A;  1N4J A;  1AVE A;  1VWF B;  2G79 A;  3RDX A;  1GLO A;  2A5C A;  3CQR A;  1E02 A;  1Q6K A;  1PEE A;  1SLD B;  1U17 A;  2QM9 A;  1FE3 A;  4PSQ A;  4YCE A;  1BRQ A;  3P5W A;  1HXZ A;  4UU2 A;  1Y52 X;  3KFF A;  4U46 A;  3P6C A;  4YDA A;  5CVM A;  3VPJ E;  1SWC A;  6PAD A;  3X00 A;  1DC9 A;  4IB9 A;  4EKV A;  2DJG B;  3HPE A;  3ZW0 A;  3EBW A;  1JJX A;  1EWP A;  1VWC B;  2FRS A;  1U0X A;  1KHP A;  1MVG A;  4BGF A;  2RTO B;  3CBS A;  4O9S A;  1YK8 A;  4A8Z A;  4GUA A;  2FR3 A;  3WJC A;  3WJD A;  3F5V A;  4HWY A;  4ZUX U;  2FRA A;  4ORU A;  2DJF A;  3RVV A;  5IO5 A;  1VPR A;  1BY8 A;  4AW8 A;  5HTD A;  3HWD A;  4U9C A;  2RTM A;  1AVG I;  1X8N A;  2RTD B;  5KO3 A;  2NND A;  4XMC A;  3RSW A;  1P6P A;  3PNR A;  1OBU A;  2JTC A;  3BOW A;  5LKE A;  3SZI A;  2WPU A;  3HOL A;  1SWQ A;  1PBO A;  1TOW A;  3ELX A;  1SWD A;  3HWN A;  2C1Q A;  2WQA E;  2F73 A;  5K68 A;  1N0S A;  2WWP A;  3MVF A;  1GCB A;  2FKJ A;  5CVN B;  1SNK A;  1ME3 A;  5EF4 A;  4GJS A;  2MJI A;  1EWM A;  4C5P A;  2JRI A;  4O4O A;  3IA8 A;  5PAD A;  4B55 A;  2A8G A;  3TMP A;  1OPA A;  3AKM A;  1T8V A;  3PQU A;  5D4A A;  4IAB A;  2OVA A;  3BPM A;  4L3R A;  2E02 A;  3M99 A;  4GD9 A;  4P6G A;  2RTF B;  2PRE A;  1SRH A;  5H9L A;  1PTS A;  2NNQ A;  5CHK A;  2G8E A;  4LZU A;  2DCA A;  2AMM X;  5JR8 A;  1U5I A;  4ZHC A;  1TVQ A;  1CRB A;  1F2A A;  2JW1 A;  1X8P A;  1HQP A;  3FEK A;  1BWY A;  2DZZ A;  2Y5B A;  5L8N A;  4Z2V A;  1LIE A;  3FA9 A;  3QJ3 A;  2MHD A;  2FGS A;  1I05 A;  1ATK A;  4CPH B;  3NAD A;  1IKJ A;  4X6J A;  1LNM A;  3IOQ A;  3ZWE A;  2AF5 A;  5JD2 A;  2CM9 A;  4Z6J A;  4NNS A;  1A3Y A;  1HN2 A;  1L6M A;  3MOR A;  2RTG B;  4CV7 A;  5D8J A;  4CPE A;  2P86 A;  3TNX A;  2FS7 A;  1ZNE A;  2IZI A;  1HMR A;  3KZA A;  4INN A;  4GGT A;  3V6E A;  1KT7 A;  4O3Y A;  1KL4 A;  1YIV A;  4BX7 B;  5E6J A;  3STK A;  1B8E A;  2LBV A;  1DZM A;  3KQ0 A;  1SRE A;  2BDL A;  3LV4 A;  1GEC E;  1KQX A;  3WVM A;  1VYO A;  1KGL A;  1YZB A;  2NQD B;  3AI8 A;  3ZUA A;  4PP1 A;  2FLJ A;  3BSZ E;  1LDO A;  1DV9 A;  4NYR A;  1LCV A;  2P7U A;  4WFU A;  1SWG A;  2R9C A;  2DM5 A;  1QOL A;  2FS6 A;  1SY3 A;  4RF0 A;  5F7G A;  1GXA A;  2OY8 A;  4MVI A;  1SWU A;  1VWN B;  5FFH A;  3CKF A;  4CDD B;  2WSJ A;  4IB7 A;  5HCC C;  5HA1 A;  1I04 A;  3P6G A;  3TF6 A;  4ZHF A;  5H9A A;  2HHN A;  4TQ2 A;  3FEN A;  4KC8 A;  1BRP A;  1LF7 A;  1SP4 B;  3CH2 X;  2Y32 A;  2H7J A;  1G74 A;  4R0B A;  4JHQ A;  4AZO A;  2X8F A;  1SWA A;  4QRX A;  1EXS A;  4O49 A;  3P5X A;  4FBV A;  4IP3 A;  1LEL A;  5H9K A;  4NNT A;  4IMO A;  5L8I A;  2NNE A;  3EC5 A;  3WXQ A;  2AL0 X;  2AT6 X;  3P5V A;  1SA8 A;  2RQ0 A;  1G5W A;  1TOU A;  4NV7 A;  2OVS A;  3S3Q A;  3BRN A;  3PED A;  1AIM A;  2N93 A;  4GRJ A;  3IUT A;  4I04 A;  3O2Y A;  1ICF A;  2I5V O;  4FK5 A;  4XMD A;  1VJV A;  3K24 A;  4OW0 A;  1NB3 A;  2FT2 A;  2AVI A;  2QMI A;  2FRQ A;  2BT9 A;  1DZK A;  5F1E A;  2CIO A;  3ZNH A;  4QYP A;  1G7N A;  3FEP A;  2MM3 A;  2BU3 A;  2ASN X;  3VGW A;  4BOZ A;  5H9N A;  2RTI B;  1Y08 A;  3E9S A;  4BBO A;  4QZT A;  1YVB A;  4QGW A;  3FLL A;  5HCE C;  1Z24 A;  3RY2 A;  1ITO A;  2IZG B;  3BCN A;  3BY4 A;  2FHL A;  1DF0 A;  2FTD A;  2OY5 O;  5L8O A;  3BDR A;  3BX8 A;  3SZJ A;  5KIC A;  2G8J A;  4AXL A;  3HK1 A;  4I9R A;  3LTW A;  2AGA A;  1ERB A;  1AYU A;  2G5L A;  4ZHG A;  2JN3 A;  3PRP A;  1DF3 A;  3H7D A;  4CDF A;  2GTL O;  1EIO A;  1SLF B;  4I3C A;  3D95 A;  5EZ2 A;  5CVO B;  2OF8 A;  4HWM A;  1FEM A;  4GGR A;  2A13 A;  2HLV A;  1NBX A;  4GGZ A;  3GE2 A;  3UEX A;  2ACT A;  1BSO A;  1SWJ A;  1CVZ A;  2Q2P A;  3PDF A;  2J7Q A;  1CTE A;  1NPZ A;  1CB5 A;  4HPB A;  2JOZ A;  1MUP A;  1MX8 A;  1K24 A;  1PBH A;  3WXE A;  3ERV A;  3OIS A;  4BX6 B;  4I05 A;  2AS8 A;  3WXF A;  2G8C O;  1KT4 A;  3CBK A;  4WA6 A;  2A3F X;  3HTY A;  1ALB A;  3BWK A;  3OD9 A;  3F8A A;  1SRG A;  3NQ3 A;  1CJ5 A;  4PP2 E;  4WHI A;  3F6Z B;  1ZRY A;  1QY2 A;  1LUQ A;  3MM0 A;  3ZW1 A;  4CK4 A;  3F9D A;  2KTD A;  4JGL A;  1W6F A;  1AB0 A;  2AYN A;  2CZT A;  2R6N A;  4IB8 A;  3DSZ A;  1VWL B;  5EDC A;  1U9Q X;  1ZNH A;  4O3W A;  2JMB A;  4ODD A;  4YH0 A;  4RY2 A;  1Y55 X;  3MG5 A;  2F09 A;  4IAW A;  3KVN A;  1PVJ A;  2C0Y A;  4AZP A;  3I0A A;  3BC3 A;  1S7D A;  4OS3 A;  3UEU A;  2FQ9 A;  3QSD A;  3ZI8 A;  3VHH A;  1VWJ B;  2GTL M;  3SLT A;  1KXO A;  3HWF A;  4N8W A;  3KSE A;  1RXH A;  2O62 A;  4Z27 A;  5HCD C;  4CDC B;  4OS8 A;  2IPP B;  3UAQ A;  5DG4 A;  1OEK A;  4KLB A;  2L5P A;  5LJD A;  3WYP A;  1O0E A;  5B10 O;  1K3B B;  1FH0 A;  2KTS A;  2MO5 A;  3OBL A;  1CS8 A;  4ZHD A;  4YGG A;  2AYO A;  4W5C A;  4QBB A;  2OL7 A;  2FWV A;  2ZAI A;  1ZND A;  1KFU L;  4BQV A;  3C0R A;  1YK7 A;  4MVE A;  2IZA A;  5IO7 A;  2FE8 A;  2EU7 X;  4ORR A;  4BOP A;  1DFV A;  4BJ8 A;  3WOV A;  3BU1 A;  4BOE A;  1GKA B;  2HH5 A;  4AZQ A;  4I07 A;  1YP6 A;  2IFB A;  1HMT A;  1SLG B;  2Z84 A;  4YCH A;  1XKI A;  4K19 A;  1SWO A;  2DJG A;  3V8U A;  4QYN A;  5HZ9 A;  3PHU A;  4GKC A;  4IBA A;  2R56 A;  3PQS A;  1SXY A;  3FR2 A;  2CBR A;  2DZY A;  2Q39 A;  3T6F A;  1X89 A;  2X32 A;  1STR B;  3PBH A;  2VHF A;  1EQD A;  3OJY C;  4YV8 A;  3DTQ A;  2ZSC A;  4OMX A;  1TW4 A;  3P6E A;  1VWP B;  3USV A;  3FDC A;  2ARY A;  3BB7 A;  1HBP A;  3G7X A;  1YWB A;  4BSQ A;  1SXX A;  2G7Y A;  1SRI A;  2L9C A;  2QO5 A;  1MDW A;  1LID A;  4AZN A;  2AUZ A;  3KFH A;  2BTW B;  3O1G A;  1EPA A;  1MDC A;  1TXL A;  5L3Y A;  2WR6 A;  2LKK A;  3APX A;  1MS6 A;  4EFG A;  1SY0 A;  4I9S A;  5EPQ A;  3RE5 A;  1DZP A;  4Y0Q A;  2WUT A;  1TU6 A;  1KL5 A;  3Q6L A;  4OVZ B;  2RTL A;  4I95 A;  5B5G A;  2OFB A;  3L4R A;  4YYR A;  1ML7 A;  3ZW0 B;  1ACD A;  3VHM A;  3SLO A;  2OFR X;  2J7Q C;  2FO5 A;  3PW3 A;  1UZ2 X;  2JQF R;  2GC9 A;  2WEW A;  4IB6 A;  4ZFX A;  3FID A;  1CBI A;  3APW A;  1ME4 A;  1PPD A;  3PT2 A;  3BU9 A;  5HAE A;  4QZU A;  2HNX A;  1LIB A;  3W30 A;  3EYC A;  2AIM A;  1IKE A;  1ZIV A;  5EZQ A;  1UYN X;  3VG4 A;  3LFY A;  2OVE A;  2B1M A;  1HQQ A;  1IWD A;  3PEC A;  1YWC A;  4CPH A;  2HD5 A;  1GGL A;  2FKG A;  4FIP A;  3W31 A;  5EED A;  2QO6 A;  4CDE B;  3N3K A;  3GCB A;  4ES7 A;  4IAX A;  2UZ2 A;  4LKP A;  3H8B A;  1VYG A;  1AU4 A;  4U8U N;  4YKM A;  3Q34 A;  2X34 A;  4GE1 A;  4YDB A;  3RKG A;  1GX3 A;  2WBF X;  1QFV A;  1GT3 A;  5FAZ A;  5HZ5 A;  3WZP A;  3P5U A;  3KWB X;  3N3G A;  4Z2P A;  3STM X;  3WZO A;  4BX7 A;  1CBS A;  1QG5 A;  1AYV A;  1STP A;  4BX5 B;  3P6F A;  2RCT A;  1ZNL A;  4HFO A;  2ALL X;  1VWH B;  2LBA A;  3EW2 A;  3O0U A;  2G7B A;  5CE4 A;  1ICN A;  4GDA A;  5B3M O;  4R3D A;  5BVS A;  2HKD A;  3QT4 A;  3PPT A;  4Z28 A;  1JJJ A;  4N7C A;  3O22 A;  3RDU A;  3HOE A;  1OBQ A;  3FA7 A;  1HXL A;  1A57 A;  2NQG A;  1PMP A;  3EW1 A;  1NC9 A;  1X9Y A;  1BEB A;  3LHN A;  3VG5 A;  5LJH A;  1YUP A;  4MIS A;  1E06 A;  1AYW A;  4W5B A;  3MHS A;  4A5U A;  4YKO A;  3RNV A;  4KC7 A;  4MEE A;  2GJ5 A;  3T2X A;  4CDD A;  1T68 X;  1AEL A;  3K8U A;  2KD2 A;  5K67 A;  3IEJ A;  1GM6 A;  2X55 A;  1AVD A;  3C76 X;  3P24 A;  3KFI A;  5HBS A;  1KXR A;  3FR5 A;  1SWE A;  1YWA A;  1S2P A;  3FIQ A;  1LIF A;  1QDQ A;  1KT3 A;  3TZS A;  1HMS A;  4BOU A;  1D2U A;  3FYF A;  1D3S A;  2HZR A;  3F75 A;  3T2W A;  2OZ2 A;  1AQB A;  3SOT A;  4I3B A;  2MWH A;  2X56 A;  1M6D A;  1UKF A;  1IFB A;  3PK2 A;  4YGZ A;  1FTP A;  4A60 A;  2IZC B;  3CMP A;  4BOS A;  2AVW A;  5IO6 A;  1X8U A;  2IZH B;  2QOS C;  1JYJ A;  3S3R A;  4D8B A;  1DKI A;  2MF6 A;  1A6R A;  3ZQ3 A;  3BS2 A;  3EMM A;  2HYS A;  1OBP A;  4KCA A;  1T0V A;  1B0O A;  1XKG A;  1MEG A;  4ARH A;  2LFO A;  1RST B;  2RTA A;  1KL3 A;  1MX7 A;  1I78 A;  1RXJ A;  1SXW A;  3PHW A;  5BVQ A;  2LA7 A;  2DOS A;  3NHE A;  3O65 A;  2RTQ B;  4GDZ A;  4EQA C;  2DC7 A;  4GET A;  2A2G A;  1SLE B;  1Y53 X;  2OL8 O;  1PPO A;  2W2F A;  4GU8 A;  4OMW A;  1NP4 A;  4HPA A;  1I06 A;  1N43 A;  3B2L A;  2YJ8 A;  2BHV A;  4HXD B;  4DMY A;  2PNS A;  3BBA A;  3RZY A;  4U3Q A;  2YJC A;  1STS B;  4ORX A;  4IUM A;  1KZX A;  2JU3 A;  1N7Y A;  2GFO A;  5AJB A;  5DPQ A;  1X8O A;  1NL6 A;  2QO4 A;  4YVB A;  2YJ2 A;  4ON1 A;  4ZGU A;  4YFP A;  1CJL A;  2HZQ A;  2OYB O;  3JSQ A;  3IHP A;  2C1S A;  4PI3 A;  3VG7 A;  3K3L A;  3MHH A;  3S26 A;  1RAV A;  4RNA A;  3MTV A;  4TKJ A;  4ALO A;  1KFF A;  1VSN A;  2BSZ A;  2WEX A;  4QH6 A;  5HZQ A;  2XKL A;  1SWK A;  3BPF A;  4GUZ A;  5FEN A;  4ORS A;  4TJZ A;  3OF8 A;  7PCK A;  1NLJ A;  3U03 A;  1N9M A;  3D97 A;  3IFB A;  4XMG A;  1NQC A;  3HWE A;  4I60 A;  4Q8G A;  3H6S A;  4QGX A;  4BX6 A;  5HZ6 A;  4NYQ A;  5KID A;  2RA6 A;  1B56 A;  5CHT A;  5BVT A;  1KFX L;  2E01 A;  2JQG R;  3C9E A;  3B2I A;  1VWA B;  2UYW A;  5FQ7 E;  2IZE B;  5F02 A;  3H3I A;  1KQW A;  3AUM O;  3SAO A;  4O3Z A;  5B27 A;  4QGV A;  4CPF A;  2W2A A;  3ZUI A;  2PBH A;  3B21 A;  1JV4 A;  5J94 A;  1VWD B;  5LKF A;  3RDO A;  1MEP A;  1S44 A;  3GAQ A;  4AXM A;  5LJC A;  2KW1 A;  2RTJ A;  1JYD A;  3PHX A;  2DCD A;  2Y6E A;  3MP2 A;  3TGC A;  4RUN A;  1WBI A;  1CV8 A;  3V6C A;  2IZF B;  4ZGF A;  1MIR A;  4MSX A;  4DMX A;  3VU1 A;  4G54 A;  4WFV A;  4YYU A;  1BJ7 A;  2Q4N A;  1YAL A;  4X6H A;  2AH7 X;  4PAD A;  2JU8 A;  4HPC A;  2GH7 A;  1SWB A;  1BSY A;  4K7C A;  3CR6 A;  2C4I A;  4TKB A;  1MEM A;  2RTN B;  2GHU A;  4AZM A;  2RCQ A;  3MX7 A;  4CDC A;  1QQS A;  2L67 A;  3LXS A;  1SWH A;  1SWL A;  2O6X A;  2PI3 O;  1KHQ A;  1QFT A;  3B2H A;  1K3B A;  1THE A;  2UZJ A;  4QRV A;  4D6A A;  1NB5 A;  3CQN A;  2A2U A;  4FBO A;  3P6D A;  1PBY A;  4ML7 B;  2HXZ A;  3APU A;  5BYP A;  3BLG A;  2F01 A;  2W2B A;  2BC3 A;  2X4M A;  1BM5 A;  1SXU A;  2IBI A;  2OZQ A;  3PH6 A;  2BLG A;  3FW4 A;  1FDQ A;  4ZHH A;  1QWD A;  2FR2 A;  1X8Q A;  2Z4I A;  4REZ A;  1GKA A;  3JQO A;  5IRW A;  4P6E A;  2LB6 A;  4KT5 A;  1LDQ A;  3S60 A;  4DQ3 A;  2X45 A;  4YYV A;  4NV8 A;  1SMP I;  1MOY A;  3MBT A;  5JZE A;  4TKH A;  4MM3 B;  2Q2M A;  4I6S A;  3RY1 A;  4YBU A;  5EEE A;  4MZO A;  2OUL A;  2NQI A;  2NQA A;  2NP1 A;  1F2B A;  4BOQ A;  3OQC A;  2YJ9 A;  1PXV A;  5HWZ A;  1GX8 A;  3T6L A;  1QXP A;  2AT3 X;  1EAL A;  4MI7 A;  1IW2 A;  3IV2 A;  2DC8 A;  2ZAG A;  3FW5 A;  2AT8 X;  3KWZ A;  3D96 A;  1ADL A;  5D45 A;  2RTK A;  2DCC A;  3T1D A;  4BVM A;  2JGS A;  1E2T A;  3ZUO A;  4M6S A;  2HWK A;  2RTP B;  1VWR B;  4U8U O;  3AKN A;  1JZU A;  4M7M A;  3S5X A;  2OY7 A;  1VWE B;  2X8S A;  2BTW A;  4CSB A;  8PCH A;  2IZJ A;  1W4T A;  1FEL A;  1JMZ A;  5LJB A;  1AU3 A;  1DF8 A;  1U9X A;  4Z2O A;  4P16 A;  4OVZ A;  1W5R A;  5B11 O;  3VE1 A;  2RD7 C;  5CYB A;  2VFB A;  4YMY A;  1BP4 A;  3JS1 A;  2XU3 A;  5EZS A;  1JQP A;  2QOM A;  4D6B A;  4JO6 A;  3D6S A;  3VG6 A;  3NX1 A;  1O1U A;  1S4V A;  1BLR A;  1AEC A;  3KX1 A;  1QMY A;  4FGI B;  4YGH A;  1EI5 A;  1Y9L A;  3QQ2 A;  3APV A;  1STF E;  3CBC A;  5F58 A;  1HBQ A;  2IZL B;  4N79 A;  1CBQ A;  5AJC A;  1Y4H A;  1FEN A;  2GTF X;  3E3C A;  2JU7 A;  1OEE A;  3FMZ A;  4JNJ A;  1OEJ A;  2DC9 A;  1AU2 A;  2K23 A;  3EBK A;  1B4M A;  2QCB A;  1CSB B;  4HPD A;  2VFC A;  3EM0 A;  4MVK A;  5HTE A;  1WUB A;  4CDE A;  3STN A;  4CZW A;  2R9N A;  2L68 A;  3U0D A;  2DJF B;  4RUU A;  2YG2 A;  4GZV A;  1KT5 A;  1RBP A;  1HUC B;  2R74 A;  4Y5D A;  3ELZ A;  3NX2 A;  3VG2 A;  4U8U M;  2HMB A;  4BX5 A;  1VWK B;  2FUD A;  4GK9 A;  3TRK A;  3C77 X;  4MVL A;  2ANS A;  4N7D A;  3HHI A;  1VWG B;  4FBR A;  1EWO A;  1A18 A;  1RLB E;  3I06 A;  3TGB A;  3WXG A;  2RTB B;  3B79 A;  4NP1 A;  3B2J A;  3PRM A;  4A1Y A;  5FQ6 E;  4YBP A;  5HA0 A;  3QKG A;  4BQU A;  3IFU A;  4RKX A;  4Q8H A;  1F29 A;  4UU3 A;  1URE A;  1XCA A;  5FQ8 E;  4QRL A;  4O4S A;  1G85 A;  3UEW A;  4WUR A;  3OVZ A;  1PCI A;  5K16 A;  3FEL A;  3NQK A;  1EWL A;  1VWI B;  3PSE A;  3KW9 A;  2XU4 A;  4IRW A;  1BSQ A;  3HD3 A;  1OSP O;  3N4C A;  2FTB A;  3KKU A;  4ALB A;  3NPO A;  2R9F A;  4AZR A;  4KII A;  4YYS A;  4COT A;  1SY2 A;  2Y3E A;  3AEH A;  2YMS A;  4LZV A;  3HHA A;  4EDE A;  3CBJ A;  2B1N A;  1OPB A;  1SRJ A;  3E1Z B;  1Y9T A;  1NP1 A;  2E4J A;  4BCS A;  3RE6 A;  1SY1 A;  2M4L A;  4NLI A;  3C78 X;  5EDB A;  5F6B A;  2IZB A;  1NQN A;  2YJB A;  3O19 A;  1EW3 A;  1I9H A;  3IMA A;  4EXZ A;  4OEM A;  4GJV A;  1F2C A;  4ZTB A;  3NBX X;  3VE2 A;  1RXK A;  1NGL A;  2P8G A;  4DQ4 A;  1O8V A;  4NLJ A;  2OVD A;  2WQ9 A;  3I3T A;  2BS6 A;  1IFC A;  3K9M A;  1LCW A;  1PM1 X;  4KH8 A;  4ZH6 A;  1DZJ A;  1PPN A;  1BBP A;  5EGW A;  1GMY A;  2RTR B;  4GNY A;  4LQZ A;  2DCB A;  4PT5 A;  3B2K A;  4GH7 A;  1EF7 A;  3I17 A;  4BS5 A;  3WJE A;  3N91 A;  1GT4 A;  3RVW A;  3CH3 X;  1DEU A;  3BX7 A;  3WJF A;  2OFA A;  1CQD A;  4FQB B;  5H8T A;  1SWT A;  3WJG A;  1KZW A;  4LKT A;  5IRA A;  3VG3 A;  3PH5 A;  5KHP A;  5LJK A;  3NQ9 A;  3FR4 A;  1NQM A;  1IIU A;  4FJC A;  2IZD B;  2POA A;  4OKA A;  1ERX A;  1JJU A;  4MZS A;  4D8I A;  1X71 A;  2BDZ A;  1KOI A;  3KFQ A;  1JBH A;  1UYO X;  4N4Z A;  1HY2 A;  2OL6 O;  1MM9 A;  4XME A;  3SZH A;  1ZNG A;  5D47 A;  1KT6 A;  1ZNK A;  4XZX A;  1NDJ A;  4ZJ0 A;  3TGA A;  2DC6 A;  1YWD A;  1Y0G A;  1ICM A;  1SWF A;  2KT4 B;  4YYW A;  1LPJ A;  4Y59 A;  4PJ2 A;  1PAD A;  5LJE A;  3OF9 A;  1ZCM A;  5B2A O;  5F6Z A;  2CM4 A;  4QQ1 A;  2G78 A;  3P6H A;  4XR7 A;  3PP6 A;  3S5V A;  5LJG A;  1EII A;  2VDF A;  1VWM B;  3H8C A;  4DCB A;  2F7D A;  4NW4 A;  3RDS A;  4O4X A;  1QY1 A;  2AKQ A;  2CB5 A;  1MHW A;  4ID2 A;  2I5Z O;  1QY0 A;  2RTH B;  2OP3 A;  4W4U A;  1GX9 A;  1TLO A; 
#chains in the Genus database with same CATH homology
 2F1G A;  1ME4 A;  1PPD A;  3RVX A;  4MZO A;  2OUL A;  2NQI A;  4CDD B;  2NQA A;  1F2B A;  2AIM A;  1ZIV A;  4QRG A;  4YVA A;  3LFY A;  2YJ9 A;  1PXV A;  2HHN A;  2B1M A;  1IWD A;  1QXP A;  2HD5 A;  1SP4 B;  3CH2 X;  2DC8 A;  3IV2 A;  4FIP A;  3KWZ A;  1PIP A;  2H7J A;  4CDE B;  4XUI A;  3N3K A;  2G6D A;  3GCB A;  2DCC A;  3H8B A;  2E03 A;  2ATO A;  1AU4 A;  4QRX A;  1E2T A;  3P5X A;  3U8E A;  4CDF B;  2XU1 A;  4OEL A;  1GX3 A;  2VHS A;  2WBF X;  2AU1 A;  2PAD A;  4X6I A;  3P5U A;  3KWB X;  3N3G A;  3P5V A;  1U9V A;  4NV7 A;  3S3Q A;  8PCH A;  1AYV A;  1AIM A;  1W4T A;  3IUT A;  5A24 A;  1PE6 A;  4I04 A;  1AU3 A;  1U9X A;  2P0R A;  1ICF A;  3O0U A;  4FK5 A;  1VJV A;  1W5R A;  1AU0 A;  3K24 A;  4YYQ A;  1NB3 A;  2FT2 A;  5JA7 A;  2VFB A;  2FRQ A;  1BP4 A;  3OVX A;  1CPJ A;  3QT4 A;  2CIO A;  2XU3 A;  2R9M A;  1JQP A;  1POP A;  2R9O A;  3D6S A;  1BGO A;  1Y08 A;  1S4V A;  2NQG A;  1AEC A;  1YVB A;  2AUX A;  2XU5 A;  3KX1 A;  1QMY A;  1X9Y A;  5CHV A;  2E00 A;  1ITO A;  1AYW A;  3BCN A;  3MHS A;  4W5B A;  1DF0 A;  2FTD A;  1STF E;  3D9W A;  4CDD A;  3K8U A;  4N79 A;  2G8J A;  3IEJ A;  1Y4H A;  4AXL A;  1TL9 A;  9PAP A;  3LTW A;  1KXR A;  2DC9 A;  1AYU A;  1AU2 A;  1QDQ A;  1CSB B;  5FPW A;  2VFC A;  3DF0 A;  4CDE A;  4CZW A;  3F75 A;  2R9N A;  1U9W A;  2OZ2 A;  4BS6 A;  4BPV A;  2DJF B;  1M6D A;  3H7D A;  4CDF A;  5CVO B;  1HUC B;  2AVW A;  5JH3 A;  2ACT A;  3MTN A;  1PPP A;  3H89 A;  1CVZ A;  3S3R A;  3PDF A;  1A6R A;  1CTE A;  1NPZ A;  2FUD A;  1CB5 A;  1YT7 A;  3HHI A;  1EWO A;  1PBH A;  1XKG A;  3WXE A;  3ERV A;  3OIS A;  3I06 A;  2FYE A;  4I05 A;  1MEG A;  2AS8 A;  3WXG A;  3WXF A;  3CBK A;  3B79 A;  4WA6 A;  3BWK A;  1BQI A;  1GLO A;  3NHE A;  1Q6K A;  4Q8H A;  1F29 A;  2DC7 A;  4PP2 E;  3P5W A;  1PPO A;  3OVZ A;  1PCI A;  5K16 A;  5CVM A;  6PAD A;  1EWL A;  1W6F A;  2YJ8 A;  2AYN A;  4DMY A;  2PNS A;  2R6N A;  2DJG B;  3KW9 A;  2XU4 A;  2YJC A;  1EWP A;  3HD3 A;  1KHP A;  3N4C A;  3KKU A;  1U9Q X;  4BGF A;  2R9F A;  2GFO A;  4YYS A;  1NL6 A;  1YK8 A;  2YJ2 A;  1CJL A;  3F5V A;  3HHA A;  4HWY A;  4RY2 A;  4ZUX U;  2FRA A;  3CBJ A;  3IHP A;  2DJF A;  3RVV A;  2C0Y A;  2B1N A;  3BC3 A;  1BY8 A;  4PI3 A;  2FQ9 A;  3QSD A;  3MHH A;  3E1Z B;  1VSN A;  2BSZ A;  4N8W A;  4QH6 A;  2YJB A;  3KSE A;  4CDC B;  3BPF A;  3PNR A;  4GUZ A;  3BOW A;  3OF8 A;  2IPP B;  3IMA A;  4OEM A;  7PCK A;  1NLJ A;  4KLB A;  3HWN A;  1F2C A;  1O0E A;  1K3B B;  1NQC A;  1FH0 A;  4Q8G A;  3H6S A;  1GCB A;  1CS8 A;  2AYO A;  5CHT A;  1KFX L;  2E01 A;  2JQG R;  4QBB A;  3C9E A;  3I3T A;  4W5C A;  5CVN B;  1SNK A;  1KFU L;  4BQV A;  1ME3 A;  1YK7 A;  5EF4 A;  3K9M A;  5F02 A;  1EWM A;  1PPN A;  4C5P A;  5EGW A;  5PAD A;  1GMY A;  4B55 A;  2PBH A;  2HH5 A;  2DCB A;  4I07 A;  5J94 A;  3BPM A;  1EF7 A;  4AXM A;  2E02 A;  3M99 A;  4BS5 A;  4P6G A;  2PRE A;  2DCD A;  3RVW A;  3CH3 X;  2Y6E A;  1DEU A;  2DJG A;  1CQD A;  2G8E A;  2DCA A;  1CV8 A;  3V6C A;  1U5I A;  1F2A A;  1MIR A;  2DZZ A;  4MSX A;  4DMX A;  2Y5B A;  4G54 A;  4FJC A;  3QJ3 A;  4YYU A;  2DZY A;  1YAL A;  4X6H A;  1ATK A;  3PBH A;  2VHF A;  4MZS A;  4PAD A;  4X6J A;  4YV8 A;  2BDZ A;  3KFQ A;  3IOQ A;  4K7C A;  4N4Z A;  1MEM A;  3USV A;  2ARY A;  2GHU A;  4CDC A;  3MOR A;  2DC6 A;  4BSQ A;  3LXS A;  2P86 A;  3TNX A;  2G7Y A;  2O6X A;  4YYW A;  1KHQ A;  1MDW A;  2AUZ A;  1PAD A;  3O1G A;  3V6E A;  1K3B A;  1THE A;  4QRV A;  3OF9 A;  1ZCM A;  1NB5 A;  1MS6 A;  4XR7 A;  2HXZ A;  2BDL A;  1GEC E;  1TU6 A;  3H8C A;  2F7D A;  2NQD B;  3AI8 A;  3ZUA A;  4PP1 A;  2IBI A;  2CB5 A;  4YYR A;  1MHW A;  2P7U A;  4P6E A;  2R9C A;  2FO5 A;  3PW3 A;  1QOL A;  2JQF R;  2OP3 A;  4W4U A;  4YYV A;  4NV8 A;  1TLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...