4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
b'DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
2IPPB 5JA7A 4PP1A 3RVWA 2DJGB 1CB5A 4HWYA 4CDDB 1K3BB 4CDFA 3KSEA 1STFE 1KFUL 1YK7A 2FRAA 2HXZA 2R9NA 1BY8A 2BDLA 5CHTA 1JQPA 4CDEA 4W4UA 2G8EA 3OF8A 2P7UA 3BWKA 1PIPA 4AXMA 4I05A 2YJ8A 1POPA 1NLJA 4YYWA 2G6DA 3CH3X 2YJ2A 2DC8A 2E01A 5FPWA 4P6GA 2R9OA 2R6NA 4CDCB 1CSBB 6PADA 5A24A 2AS8A 1CQDA 1QOLA 1GLOA 2DCCA 4G54A 2VHSA 2XU4A 3BOWA 4QRXA 2G7YA 1NL6A 4PP2E 3U8EA 3H8BA 1NB5A 4FIPA 2NQAA 4Q8HA 1U5IA 1AYWA 2VHFA 2ATOA 3DF0A 1ATKA 1AU4A 3HD3A 4N4ZA 2Y5BA 5J94A 1PPDA 1TL9A 2OULA 1PXVA 4KLBA 2WBFX 3D6SA 4ZUXU 2BDZA 1A6RA 1QMYA 4BSQA 1KFXL 2XU1A 4QRVA 1YALA 1MHWA 3OVZA 3I3TA 4N79A 1ICFA 1O0EA 3F5VA 1KHPA 3S3RA 3QSDA 4AXLA 1AECA 2HD5A 3P5VA 2G8JA 2AYOA 5JH3A 1PPNA 1AYUA 3N3KA 4QH6A 2PBHA 3MHSA 1YT7A 3B79A 2YJCA 1VSNA 2Y6EA 1PBHA 1ZIVA 2FUDA 2DC9A 2R9FA 2XU3A 4RY2A 1PPOA 3K8UA 2AU1A 3HWNA 3M99A 4DMYA 3ERVA 1NPZA 4BQVA 3GCBA 2FQ9A 3CBKA 1BGOA 4W5CA 1GECE 1EWOA 3BCNA 3IHPA 1ME4A 4OELA 4X6IA 2DJFB 2AYNA 3PDFA 1SNKA 3BC3A 3E1ZB 3H8CA 4X6JA 1Y08A 1BQIA 2O6XA 1EWMA 1MEMA 1CV8A 2YJBA 3LXSA 1CVZA 1KXRA 2E03A 4XR7A 3N3GA 2NQGA 3P5WA 1ZCMA 4W5BA 3WXFA 3OVXA 1AYVA 2OP3A 5CHVA 1TLOA 5K16A 1CPJA 2PNSA 2YJ9A 2FRQA 3IUTA 3RVVA 4CDDA 1K3BA 2NQDB 3KWBX 1CS8A 1AIMA 3V6CA 4BPVA 2B1MA 1U9VA 2DZYA 2NQIA 3PBHA 1U9XA 3H6SA 4WA6A 4I04A 1PADA 4CDFB 2DCDA 3KW9A 3NHEA 4PI3A 1NB3A 1GMYA 4CDEB 2JQGR 1YVBA 3ZUAA 1M6DA 1YK8A 4CDCA 7PCKA 3BPMA 3F75A 2AUXA 2F7DA 4YVAA 3OISA 3KWZA 1U9QX 1ITOA 4FJCA 3HHAA 3CBJA 3S3QA 2CIOA 3N4CA 3BPFA 3IEJA 1NQCA 1QXPA 8PCHA 1CTEA 1HUCB 2CB5A 1F2CA 1GCBA 3PW3A 4K7CA 3MTNA 1F2AA 3H7DA 5EF4A 2B1NA 2C0YA 1S4VA 2FT2A 3LFYA 4X6HA 3KX1A 3P5XA 2HHNA 1DF0A 4Q8GA 2FO5A 3RVXA 3P5UA 4PADA 1PE6A 3C9EA 1MEGA 3H89A 2DCBA 3USVA 1Y4HA 2P86A 2FYEA 2OZ2A 5EGWA 5F02A 3OF9A 4YYVA 2E02A 2DC7A 4QBBA 4OEMA 4N8WA 2HH5A 1KHQA 2AUZA 2ACTA 2DC6A 2PADA 5CVNB 1X9YA 4I07A 3K24A 4BS5A 2F1GA 3WXEA 1FH0A 4FK5A 3IV2A 2R9CA 4CZWA 1TU6A 1XKGA 5CVOB 4DMXA 1IWDA 3KFQA 4YYQA 2DJGA 3QT4A 1CJLA 4XUIA 2IBIA 1MDWA 4P6EA 3QJ3A 1Q6KA 3K9MA 1MIRA 1PPPA 2DZZA 1EF7A 5CVMA 9PAPA 3IMAA 2DJFA 4MZSA 1AU2A 2E00A 1PCIA 3CH2X 4MZOA 3AI8A 5PADA 3PNRA 3IOQA 1AU3A 2AIMA 1THEA 3V6EA 3MORA 1DEUA 3KKUA 3I06A 2P0RA 4YYRA 2AVWA 2XU5A 4QRGA 2GHUA 1EWPA 2JQFR 1AU0A 4MSXA 3MHHA 1EWLA 2R9MA 3O1GA 2FTDA 3HHIA 2PREA 3TNXA 1ME3A 3WXGA 4YYUA 4YYSA 1U9WA 1BP4A 1SP4B 1VJVA 1MS6A 2DCAA 4YV8A 1QDQA 4BS6A 1F29A 2GFOA 2H7JA 1F2BA 3O0UA 2ARYA
chains in the Genus database with same CATH superfamily
3GAQA 4A1HA 1CBSA 5AEOA 1A3YA 3FW5A 1EI5A 3NX1A 3RDXA 4L3RA 3FR4A 4HWYA 1IFCA 1SLFB 5CHKA 4CDFA 2MJIA 2BT9A 5CHTA 2MM3A 4CDEA 5HTEA 4W4UA 3OF8A 3FYFA 4AXMA 1N9MA 3L4RA 1NGLA 2YJ8A 4MM3B 5DPQA 1NLJA 4YYWA 3CH3X 1DV9A 4BGFA 2FWVA 2DC8A 3CR6A 2E01A 2X55A 2WEWA 2ACPX 2UZJA 2EU7X 1CSBB 3APWA 4Y0RA 6PADA 4ZHDA 3RE6A 3F8AA 2JMBA 2UZ2A 1SY2A 1BSOA 4FQBB 1NB5A 1U5IA 1SY0A 1VWRB 4GUAA 3VE1A 1BSYA 2FKGA 2VHFA 2ATOA 4RF1A 3HD3A 4XMEA 2Y5BA 5J94A 1PPDA 3V8UA 3WYPA 4PSQA 3ELZA 4KLBA 4AZPA 1LKEA 2WBFX 4CPHA 4ZUXU 1AQBA 4IB7A 1QMYA 4BX7B 1BBPA 2CBSA 1TOUA 2JU3A 2IZGB 4Y0QA 3FENA 4EXZA 3OVZA 5B27A 4BOPA 1JJJA 1BLRA 1ICFA 3VHMA 3SLJA 1FE3A 1B8EA 2FE8A 1KQWA 3IA8A 1AECA 3APXA 4AYHA 4Z27A 5JH3A 1PPNA 3MHSA 3PEDA 5H9LA 1PBHA 2BS6A 4MISA 5EZSA 3PT2A 3E3CA 4N7DA 3G7XA 1VWJB 2ASNX 1ACDA 1YWAA 1EPBA 4FBOA 4ZH9A 1OBQA 3K8UA 2AU1A 3WYQA 3HK1A 4DMYA 4TJZA 3NQ3A 4BQVA 2RTFB 5B3MO 3U9PC 2FKJA 3BBAA 5LJHA 1VWBB 3ZW0A 3BCNA 3IHPA 5HCEC 4KH8A 2GJ5A 1Y55X 4X6IA 2DJFB 2OYBO 1EUOA 2AYNA 3BC3A 4UU3A 3FA8A 5EDCA 3WZOA 2FS6A 4MIRA 3DSZA 4XMFA 4Z28A 1BQIA 3PRMA 1CRBA 4AZMA 1LFOA 3LXSA 2VDFA 2G5LA 1PMPA 1BJ7A 1KL5A 3N3GA 4FBVA 3ZW1A 2VFCA 4W5BA 4OW0A 3RZYA 3MP2A 2OP3A 2RCTA 1A2DA 3FMZA 1CPJA 2PNSA 2RD7C 5JD2A 3HWFA 3MM0A 4ZHFA 3S26A 4BX6B 2NQDB 3FLLA 3KWBX 1JJXA 1CS8A 3V6CA 4BPVA 1LCZA 3VG5A 2DZYA 1E06A 1STSB 4HFOA 4BOQA 4I04A 4GETA 1ZNGA 1DZJA 1ZNLA 3B2LA 3FEKA 4ORSA 1NC9A 2J7QA 2NNEA 2E4JA 1FJ1E 5HCDC 1Y9TA 1O1VA 5HZ9A 3F75A 1AB0A 3H3IA 1W6FA 2Y3EA 4YVAA 2JTCA 1MDCA 4FJCA 1EQDA 3MG5A 3RKGA 2RTDB 4OKAA 1ERBA 1QXPA 1SWTA 4GK9A 1DZKA 1I4UA 4GU8A 4O3ZA 2Z84A 2FT2A 3BX7A 1OEKA 4YDAA 3TZSA 3RE5A 3HWGA 3BB7A 1FENA 2KD2A 1PE6A 2QO5A 4QGXA 3USVA 4U9CA 2IZHB 4IBAA 2FYEA 3EBKA 3EW2A 1JZUA 4QZUA 3BY4A 2R73A 1QG5A 2BS5A 4O4XA 2RTHB 3T6LA 1VWMB 1X9YA 4RUNA 4BS5A 2JW1A 1BSQA 4YBPA 2Q39A 5HWZA 4IUMA 1SWOA 4EQAC 5BYPA 1TU6A 1EPAA 1HMSA 3VHIA 3X00A 3PHUA 2DJGA 3ZUIA 3QT4A 2BHVA 2WUTA 1ZNHA 4YGZA 1YWCA 3VHHA 3KQ0A 2IBIA 2C1SA 3WBGA 1MDWA 1KL4A 2POAA 1QQSA 3STMX 4OMWA 1MIRA 3K9MA 2RTIB 1PPPA 3WVMA 4Y0SA 5CVMA 4YFRA 3KFFA 3O2YA 2OFRX 4UU2A 3QQ2A 3WJFA 2IFBA 2FR2A 1XCAA 4XMDA 3CH2X 2A8GA 4MVIA 4LQZA 2IZCB 2ACOA 3NADA 3IOQA 5CE4A 4I95A 2OFAA 1D2UA 3P6DA 3TGAA 3BY0A 5LJEA 1GGLA 4REZA 4M0WA 1ZNEA 1AVGI 4GKCA 2GHUA 1YP7A 1AU0A 4MSXA 4DCBA 2AT3X 1X8QA 3ZNHA 4GGRA 1HMRA 2HYSA 5FENA 1KT7A 4AW8A 4QGWA 1NP1A 1VJVA 1MS6A 1QDQA 1ML7A 3O0UA 4MVEA 4BCSA 4TKJA 1I04A 1U18A 5JA7A 4PP1A 1SWBA 4YH0A 5LJKA 2HKDA 2HWKA 1E00A 4CDDB 1K3BB 1EW3A 1STFE 2HXZA 2R56A 2R9NA 1BY8A 2BDLA 4YVBA 4AZNA 1BRPA 4ZHHA 4CPIA 2X8TA 2G8EA 2P7UA 2A3FX 4TKBA 3BWKA 1SRJA 2HMBA 1LUQA 2RQ0A 4O3WA 3CWKA 2RCQA 1EIOA 3I0AA 4KC7A 4I3CA 5EPQA 1O1UA 1NBXA 4IP3A 5K68A 1STPA 4A60A 5EEEA 2DCCA 5LKEA 2XU4A 4QRXA 1NL6A 3U8EA 2K23A 2A0AA 5LJBA 3H8BA 2Q2PA 2NQAA 4Q8HA 1AYWA 4KCAA 2W2AA 1HXZA 1YZBA 4MVLA 4N4ZA 3TGBA 1TOWA 2Z4HA 2CZTA 4QNIA 1GX8A 4ZHCA 1TL9A 1VWIB 2OL7A 4ZH6A 1VWHB 4I9SA 4LKPA 1I9HA 1VWNB 4YCEA 1L6MA 5IO5A 5HZ5A 4HWMA 4QQ1A 3PH6A 4N79A 5B29A 4YBUA 3N91A 1KL3A 1SXUA 1GX9A 1SRFA 3S5VA 4OVZA 1KHPA 3QSDA 3IFUA 2IZAA 2HZRA 2G8JA 4IABA 2LB6A 2ALLX 1YT7A 3B79A 5KICA 2IZLB 3MTVA 2XU3A 4RY2A 3LHNA 3NQKA 2OVSA 4P16A 1PPOA 2PI3O 1SXXA 3O65A 3ERVA 1U17A 4GDZA 3GCBA 4ES7A 2FQ9A 3RDMA 3U0DA 3PQUA 1QY1A 4ON1A 5D48A 1ME4A 2F01A 1PM1X 4CK4A 3W31A 5EZ2A 4CV7A 3PP6A 1OBUA 2RTCB 2IZJA 3H8CA 4EFGA 2JGSA 3MBTA 2O6XA 2RTNB 1LICA 1CV8A 2OF8A 3JS1A 2X34A 4ORXA 2RTKA 2E03A 3FA7A 4DNEA 2NQGA 1X8UA 2Y3FA 4XMHA 2QM9A 3FDCA 2O62A 1TLOA 5K16A 3RBYA 3FEPA 2WWPA 4IB6A 1HBQA 1JIWI 4JO6A 3RVVA 1WBIA 2KTSA 4FGIB 5D45A 1ICMA 1X8NA 4TLJA 5JR8A 2B1MA 3BLGA 1U9VA 1LPJA 3QKGA 1E5PA 2AL0X 3EM0A 3H6SA 4ZGFA 2YMSA 3PHWA 4PI3A 1RAVA 4GNWA 4IB8A 4Y0PA 4BOEA 3OD9A 1KZXA 2OVDA 1B4MA 3ZUAA 2FRSA 1SWHA 1QY2A 2AUXA 2F7DA 4ARHA 2X8FA 4NNTA 1X89A 3VU1A 1DZMA 1MK5A 1MM9A 1XKIA 4AZQA 3S3QA 3BPFA 5IXGA 4ZHGA 1HUCB 2CB5A 4NP1A 1BWYA 1F2CA 4K7CA 2BC3A 4JHQA 4ZGUA 2WR6A 1S4VA 3OJYC 1BRQA 4HPBA 4NNSA 1DF0A 1AVDA 2FO5A 3B2JA 4XMGA 1KT6A 4BX7A 5K67A 3IFBA 3FIDA 2AT5X 5LJCA 2DCBA 4CSBA 2I5ZO 2P86A 1QFTA 2AMMX 2AT6X 5F02A 2ZAGA 3OF9A 3P6EA 1MOYA 3WOVA 2DC7A 2E02A 4BOSA 1RSTB 4IMOA 5E6JA 3C78X 1OSPO 1SWLA 1DF8A 1GKAB 5CVNB 2PY1A 4N7CA 3K24A 2A2UA 1CBRA 2F1GA 2C1QA 4EEJA 1LNMA 1G5WA 1YWBA 1SLDB 5EZQA 3WXQA 4DMXA 5H8TA 3KZAA 1NQNA 3KFQA 1HMTA 1G74A 3D96A 5AJCA 3HOEA 5HCCC 2ZAIA 3BDRA 4P6EA 4O3YA 2FTBA 1Q6KA 3EC5A 1QFVA 1STRB 9PAPA 3CKFA 2DJFA 3SLOA 1KOIA 1CBQA 4CPFA 1AU2A 2Z4IA 1RLBE 1JYJA 1ZNDA 2OY7A 4ORUA 3WJCA 4RF0A 1VWOB 2IZBA 4AZOA 3VG3A 1O8VA 3BS2A 1D3SA 3C76X 3EMMA 3S60A 5D47A 4ZR2A 1DEUA 1HXLA 2P0RA 2NP1A 1SA8A 3EYCA 3PPTA 2AVWA 2OZQA 3SZHA 2JQFR 2A5CA 1EWLA 3SAOA 4U8UM 1KGLA 2PREA 1VWQB 1VWDB 1DC9A 1ME3A 3WXGA 4IMNA 5BVTA 5B11O 1SP4B 2BTWB 1P6PA 3SLTA 2IZKA 2H7JA 1QWDA 4NV7A 1R0UA 2OFBA 3VPJE 5L8IA 2IPPB 3ZW2A 1HY2A 1PBOA 3RVWA 2DJGB 1SWRA 5JZEA 1VPRA 1TW4A 2P8GA 2NNDA 2AKQA 1YK7A 2FRAA 5C0NA 3E9SA 4JGLA 2FHNX 4MVKA 1VYFA 4BBOA 3FR2A 3S5XA 1PIPA 5F7GA 5IRUA 2GC9A 1X71A 4Z2VA 3KFGA 4WFVA 4P6GA 3CQRA 4CDCB 5HA0A 4YFPA 4ALOA 4NLJA 5A24A 2GTLO 3W30A 2KTDA 1QOLA 1GLOA 5D8JA 2VHSA 3BOWA 3TGCA 4L1NA 4PP2E 1TXLA 4GJSA 4D6AA 1YP6A 3I17A 1SWNA 1IIUA 1KXOA 4JNJA 2A5BA 2M4LA 3DF0A 2XSTA 1ATKA 1SY3A 1BM5A 5B10O 2KT4B 1ERXA 3ELXA 2MWHA 1OPAA 1PXVA 1I78A 4IAXA 1GT3A 5HTDA 1RXJA 2AF5A 4LZVA 3CBCA 1SXYA 2BDZA 1A6RA 1B56A 1N0SA 3AKNA 4Z2OA 3C0RA 1MHWA 4YFQA 2OFMX 3D9WA 1K24A 1O0EA 1N43A 1ALBA 4AXLA 1OBPA 3UAQA 3WZQA 4KC8A 2HD5A 3P5VA 2DM5A 2WSJA 3ZUOA 1T0VA 2HNXA 3N3KA 2PBHA 2QOSC 4QYNA 2Y6EA 3ZWEA 2WQ9A 2FUDA 5F1EA 2DC9A 3CMPA 1VWFB 4XZXA 4ODDA 5F58A 1T8VA 1DF3A 3RNVA 1NPZA 5H9AA 5BVQA 3RDOA 3AUMO 5FQ7E 2OY5O 3CBKA 2N93A 3LTWA 4GD9A 5IO7A 1BGOA 2W2BA 4A8ZA 2QO4A 1GECE 4GRJA 1EWOA 4O4SA 4BX5A 2FLJA 5CSEA 1LIBA 1NQMA 4QYPA 1SNKA 2CBRA 2LFOA 3C77X 3RY2A 5B5GA 4X6JA 1Y08A 3RSWA 1YIVA 4GGZA 3RY1A 1MEMA 3SZJA 2OY8A 2YJBA 3KFIA 4GDAA 1CVZA 4WBKA 4B55A 5F2BA 2AT8X 3UEWA 1ZCMA 3P5WA 3STKA 4GH7A 4I3BA 2GTLN 1VYOA 3SZIA 1SWDA 5HBSA 3IUTA 1YUPA 3TRKA 1MVGA 1WUBA 4CDDA 2FT9A 1K3BA 3ZZVA 2RA6A 1AVEA 4CPEA 2RTLA 4OMXA 1AIMA 1IKEA 4TNNA 4INNA 4ZTBA 3CQNA 2MHDA 4R0BA 4HPCA 1KT5A 1QY0A 3FR5A 1PADA 4CDFB 3KVNA 3OQCA 1LCWA 3B21A 1G85A 4KT5A 2DCDA 2RTEB 4IAWA 4GJVA 3NHEA 1IFBA 1IKJA 2AT0X 2NNQA 4I9RA 1NB3A 1W4TA 1GMYA 4CDEB 3NP1A 3VG4A 2F09A 1DKIA 1M6DA 3B2KA 3APUA 2VFBA 3NPOA 1SWPA 1SY1A 3KWZA 1U9QX 3BU1A 2WQAE 3HHAA 3N4CA 1SWUA 4YMYA 5KHPA 1MX8A 1RXHA 2Q2MA 3TMPA 1A18A 1S7DA 3FA9A 4YGGA 4EKVA 3RDQA 1GCBA 4LKTA 1ZNKA 3PW3A 2AGAA 3MTNA 4YGHA 3H7DA 2J7QC 5EF4A 2B1NA 1E2TA 1SXWA 2CM9A 3D95A 2L9CA 2HHNA 3VG2A 2QCBA 3P5UA 1U0XA 3PRPA 1MEGA 3H89A 1FEMA 4CPHB 1GT4A 1Y52X 1A57A 4YCHA 1SWQA 3NR3A 3Q34A 2OZ2A 1S2PA 3UEVA 4ZCBA 4QZTA 4U3QA 1B0OA 4I3DA 5IO6A 4QBBA 4RNAA 1SWKA 2HH5A 1GT5A 1FELA 1KHQA 2AUZA 5DG4A 4IB9A 3CKGA 1Z24A 2ACTA 3O22A 2DC6A 3BU9A 5BVSA 2JN3A 4NYQA 2X45A 4ID2A 3WXEA 3UEUA 1FH0A 1SRGA 4OS8A 4TKHA 1XKGA 5CVOB 1IWDA 1N9YA 4PT5A 3UEXA 1CJLA 1GXAA 2MO5A 3QJ3A 3RWXA 2RTOB 4ORRA 3VG7A 3WJGA 1PTSA 5KO3A 2DZZA 3IMAA 3ZW0B 1VWEB 4MZSA 5F6ZA 2OY1O 2LA7A 2HZQA 3WZNA 4GE1A 3U03A 3AI8A 3PNRA 2CZUA 3BSZE 1T68X 1THEA 3V6EA 1JBHA 4WURA 2BSZA 1Y0GA 2XU5A 4ZJ0A 3HPEA 4QRGA 4Y59A 2BLGA 1ADLA 3PHXA 2R9MA 3B2IA 3O1GA 1SLGB 3HHIA 1OEJA 1JJUA 2G79A 2RTBB 3ZW1B 1U9WA 4Z6JA 1BP4A 1VWKB 1X8PA 1KFFA 4YV8A 4BS6A 1F29A 1FDQA 3NQ9A 2GFOA 5H9KA 2G78A 4HPAA 1EIIA 4U8UO 2IZEB 2G8CO 2CM4A 2RN4A 2QO6A 1IJ8A 4WFUA 2CAMA 3TF6A 4MI7A 2OL6O 1CB5A 5HZQA 2X32A 3KSEA 1KFUL 5HZ6A 1JQPA 3P24A 4FBRA 1VWAB 2X46A 1VWCB 3VGWA 4BQUA 4I05A 1POPA 2G6DA 5AQ6A 5FFHA 2YJ2A 2JOZA 1SWCA 1DZPA 5FPWA 4R3DA 1KT4A 2R9OA 2R6NA 3APVA 3D97A 4O3XB 2R74A 2AS8A 1CQDA 1GM6A 3FW4A 2A13A 1KQXA 1ZRYA 3MX7A 4G54A 1IW2A 4NW4A 4YKOA 2G7YA 1SREA 1S44A 2RTJA 3PQSA 4FIPA 1LIDA 3BX8A 1OEEA 3NX2A 2C4IA 5F6BA 1SRHA 2WPUA 3AEHA 5LJGA 2OL8O 3VE2A 1AU4A 1MX7A 4GNYA 4QRLA 2OULA 1NDJA 2L67A 1RSUB 1KT3A 3D6SA 1JMZA 1SWAA 4U46A 4M7MA 4BSQA 1KFXL 4GGTA 2X56A 2JRIA 1PBYA 3FIQA 4ORWA 2XU1A 4EDEA 4QRVA 5FQ6E 2Y32A 5FQ8E 3GE2A 1MEPA 1YALA 2BU3A 1BEBA 2AH7X 3I3TA 1GKAA 3FELA 5HZ8A 4Y5DA 3F5VA 3S3RA 3P02A 1E02A 2AYOA 2X8SA 1AELA 4ALBA 4YKMA 1AYUA 2I5VO 4QH6A 2UYWA 2Q9SA 1HBPA 3T2WA 5LJDA 2YJCA 3RDUA 1VSNA 3ZQ3A 4BX6A 3BRNA 1ZIVA 4MEEA 3WJDA 2R9FA 4OS3A 3HWNA 4C5PA 3M99A 2GH7A 4O9SA 5CYBA 2X4MA 1KZWA 3WZPA 4U8UN 4W5CA 4ORYA 4QAEA 3P6GA 2XKLA 4A1YA 3P6CA 2Q4NA 4OELA 3MVFA 4A5UA 3PDFA 1W5RA 4NV8A 3E1ZB 2RTPB 3HWDA 3O19A 4D8BA 1EWMA 3PSEA 4BJ8A 5IRWA 1ICNA 1LF7A 2L68A 1KXRA 2RTQB 2RTRB 1SWGA 4XR7A 1VWLB 2HLVA 3PH5A 1UYNX 2RTAA 5LKFA 3ZI8A 2BTWA 3WXFA 3OVXA 1AYVA 1RXKA 2KW1A 5CHVA 5IRAA 1VWPB 1SWEA 2YJ9A 1JV4A 1EXSA 2IZFB 2FRQA 3OBLA 1I05A 3STNA 5B2AO 4KIIA 1NP4A 1TVQA 5HAEA 4BOZA 3HOLA 4O4OA 4DQ4A 2NQIA 3PBHA 1U9XA 4D6BA 4GZVA 2AVIA 2JU7A 3K3LA 4WA6A 2QOMA 2IZIA 2JU8A 3KW9A 2WEXA 4BVMA 3B2HA 4NYRA 4HPDA 5L8NA 4BX5B 4M6SA 2JQGR 1YVBA 2LBAA 1PVJA 1YK8A 4CDCA 7PCKA 3BPMA 1LCVA 4LZUA 2FS7A 3T2XA 3OISA 2ANSA 1I06A 1ITOA 2FGSA 4AZRA 4K19A 3CBJA 2CIOA 5K06A 2FR3A 3MJ5A 2YG2A 3IEJA 1NQCA 1EALA 1LDOA 8PCHA 1CTEA 1LIFA 4DQ3A 1SWFA 4I6SA 1OPBA 2RTMA 1F2AA 4NLIA 3KFHA 2C0YA 2F73A 4TQ2A 1CJ5A 3LFYA 4X6HA 4D8EA 1Y9LA 3KX1A 1SMPI 2QMIA 1SWSA 3P5XA 4COTA 5B5FA 1LIEA 2FHLA 2MF6A 4Q8GA 3LV4A 3RVXA 4PADA 3FA6A 3T6FA 1HN2A 3C9EA 3DTQA 1Y4HA 5FAZA 2RTGB 1Y53X 3PECA 1SWJA 2IZDB 1N4JA 3F6ZB 1HQQA 5AJBA 5EGWA 4YYVA 3PK2A 2A2GA 4OEMA 2GTLM 4N8WA 1UREA 1H91A 1RBPA 5D4AA 2L5PA 3D4RA 3WJEA 4O49A 2PADA 1G7NA 5EDBA 4I07A 4QGVA 1CBIA 4OVZB 4XMCA 5KIDA 4RUUA 1JYDA 3JSQA 3T1DA 4D8IA 2LBVA 4I60A 1VYGA 4FK5A 3IV2A 2R9CA 4CZWA 5L8OA 1PEEA 1UZ2X 1HQPA 4YDBA 4YYQA 4Z2PA 3NBXX 4XUIA 3VG6A 2LKKA 3EBWA 2OVEA 1GX3A 4OS0A 4O4UA 1N7YA 2K62A 4HXDB 3WJBA 1EF7A 2ARYA 5EEDA 4IRWA 3P6HA 1UYOX 3OE3A 4ML7B 4WHIA 3P6FA 1GT1A 2E00A 1PCIA 2DOSA 1QABE 4MZOA 3HWEA 1SLEB 5PADA 1JMXA 1AU3A 2AIMA 5HA1A 1UKFA 3MORA 1MUPA 3KKUA 3I06A 2W2FA 3SOTA 4YYRA 2GTFX 3HTYA 2ZSCA 1EWPA 1X8OA 4GUZA 4ZFXA 1SRIA 3JQOA 5L3YA 3Q6LA 3MHHA 1LELA 2FTDA 3AKMA 3TNXA 3RDSA 1LDQA 4YYUA 4YYSA 2OF9A 3EW1A 1YWDA 1VWGB 4BOUA 5H9NA 4RKXA 1FTPA 2DCAA 1F2BA 4PJ2A 3F9DA 2G7BA 2OVAA 3CBSA 1DFVA
chains in the Genus database with same CATH topology
2IPPB 5JA7A 4PP1A 3RVWA 2DJGB 1CB5A 4HWYA 4CDDB 1K3BB 4CDFA 3KSEA 1STFE 1KFUL 1YK7A 2FRAA 2HXZA 2R9NA 1BY8A 2BDLA 5CHTA 1JQPA 4CDEA 4W4UA 2G8EA 3OF8A 2P7UA 3BWKA 1PIPA 4AXMA 4I05A 2YJ8A 1POPA 1NLJA 4YYWA 2G6DA 3CH3X 2YJ2A 4BGFA 2DC8A 2E01A 5FPWA 4P6GA 2R9OA 2R6NA 4CDCB 1CSBB 6PADA 5A24A 2AS8A 1CQDA 1QOLA 1GLOA 2DCCA 4G54A 2VHSA 2XU4A 3BOWA 4QRXA 2G7YA 1NL6A 4PP2E 3U8EA 3H8BA 1NB5A 4FIPA 2NQAA 4Q8HA 1U5IA 1AYWA 2VHFA 2ATOA 3DF0A 1ATKA 1AU4A 3HD3A 4N4ZA 2Y5BA 5J94A 1PPDA 1TL9A 2OULA 1PXVA 4KLBA 2WBFX 3D6SA 4ZUXU 2BDZA 1A6RA 1QMYA 4BSQA 1KFXL 2XU1A 4QRVA 1YALA 1MHWA 3OVZA 3I3TA 4N79A 3D9WA 1ICFA 1O0EA 3F5VA 1KHPA 3S3RA 3QSDA 4AXLA 1AECA 2HD5A 3P5VA 2G8JA 2AYOA 5JH3A 1PPNA 1AYUA 3N3KA 4QH6A 2PBHA 3MHSA 1YT7A 3B79A 2YJCA 1VSNA 2Y6EA 1PBHA 1ZIVA 2FUDA 2DC9A 2R9FA 2XU3A 4RY2A 1PPOA 3K8UA 2AU1A 3HWNA 4C5PA 3M99A 4DMYA 3ERVA 1NPZA 4BQVA 3GCBA 2FQ9A 3CBKA 1BGOA 3LTWA 4W5CA 1GECE 1EWOA 3BCNA 3IHPA 1ME4A 4OELA 4X6IA 2DJFB 2AYNA 3PDFA 1SNKA 3BC3A 1W5RA 4NV8A 3E1ZB 3H8CA 4X6JA 1Y08A 1BQIA 2O6XA 1EWMA 1MEMA 1CV8A 2YJBA 3LXSA 1CVZA 1KXRA 4B55A 2E03A 4XR7A 3N3GA 2NQGA 2VFCA 1ZCMA 3P5WA 4W5BA 3WXFA 3OVXA 1AYVA 2OP3A 5CHVA 1TLOA 5K16A 1CPJA 2PNSA 2YJ9A 2FRQA 3IUTA 3RVVA 4CDDA 1K3BA 2NQDB 3KWBX 1CS8A 1AIMA 3V6CA 4BPVA 2B1MA 1U9VA 2DZYA 2NQIA 3PBHA 1U9XA 3H6SA 4WA6A 4I04A 1PADA 4CDFB 2DCDA 3KW9A 3NHEA 4PI3A 1NB3A 1W4TA 1GMYA 4CDEB 2JQGR 1YVBA 3ZUAA 1M6DA 1YK8A 4CDCA 7PCKA 3BPMA 3F75A 2VFBA 2AUXA 2F7DA 1W6FA 4YVAA 3OISA 3KWZA 1U9QX 1ITOA 4FJCA 3HHAA 3CBJA 3S3QA 2CIOA 3N4CA 3BPFA 3IEJA 1NQCA 1QXPA 8PCHA 1CTEA 1HUCB 2CB5A 1F2CA 1GCBA 3PW3A 4K7CA 3MTNA 1F2AA 3H7DA 5EF4A 2B1NA 1E2TA 2C0YA 1S4VA 2FT2A 3LFYA 4X6HA 3KX1A 3P5XA 2HHNA 1DF0A 4Q8GA 2FO5A 3RVXA 3P5UA 4PADA 1PE6A 3C9EA 1MEGA 3H89A 2DCBA 3USVA 1Y4HA 2P86A 2FYEA 2OZ2A 5EGWA 5F02A 3OF9A 4YYVA 2E02A 2DC7A 4QBBA 4OEMA 4N8WA 2HH5A 1KHQA 2AUZA 2ACTA 2DC6A 2PADA 5CVNB 1X9YA 4I07A 3K24A 4BS5A 2F1GA 3WXEA 1FH0A 4FK5A 3IV2A 2R9CA 4CZWA 1TU6A 1XKGA 5CVOB 4DMXA 1IWDA 3KFQA 4YYQA 2DJGA 3QT4A 1CJLA 4XUIA 2IBIA 1MDWA 4P6EA 3QJ3A 1GX3A 1Q6KA 3K9MA 1MIRA 1PPPA 2DZZA 1EF7A 5CVMA 9PAPA 3IMAA 2DJFA 4MZSA 1AU2A 2E00A 1PCIA 3CH2X 4MZOA 3AI8A 5PADA 3PNRA 3IOQA 1AU3A 2AIMA 1THEA 3V6EA 3MORA 1DEUA 3KKUA 2BSZA 2P0RA 3I06A 4YYRA 2AVWA 2XU5A 4QRGA 2GHUA 1EWPA 2JQFR 4GUZA 1AU0A 4MSXA 3MHHA 1EWLA 2R9MA 3O1GA 2FTDA 3HHIA 2PREA 3TNXA 1ME3A 3WXGA 4YYUA 4YYSA 1U9WA 1BP4A 1SP4B 1VJVA 1MS6A 2DCAA 4YV8A 1QDQA 4BS6A 1F29A 2GFOA 2H7JA 1F2BA 3O0UA 4NV7A 2ARYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP B;  5JA7 A;  4PP1 A;  3RVW A;  2DJG B;  1CB5 A;  4HWY A;  4CDD B;  1K3B B;  4CDF A;  3KSE A;  1STF E;  1KFU L;  1YK7 A;  2FRA A;  2HXZ A;  2R9N A;  1BY8 A;  2BDL A;  5CHT A;  1JQP A;  4CDE A;  4W4U A;  2G8E A;  3OF8 A;  2P7U A;  3BWK A;  1PIP A;  4AXM A;  4I05 A;  2YJ8 A;  1POP A;  1NLJ A;  4YYW A;  2G6D A;  3CH3 X;  2YJ2 A;  2DC8 A;  2E01 A;  5FPW A;  4P6G A;  2R9O A;  2R6N A;  4CDC B;  1CSB B;  6PAD A;  5A24 A;  2AS8 A;  1CQD A;  1QOL A;  1GLO A;  2DCC A;  4G54 A;  2VHS A;  2XU4 A;  3BOW A;  4QRX A;  2G7Y A;  1NL6 A;  4PP2 E;  3U8E A;  3H8B A;  1NB5 A;  4FIP A;  2NQA A;  4Q8H A;  1U5I A;  1AYW A;  2VHF A;  2ATO A;  3DF0 A;  1ATK A;  1AU4 A;  3HD3 A;  4N4Z A;  2Y5B A;  5J94 A;  1PPD A;  1TL9 A;  2OUL A;  1PXV A;  4KLB A;  2WBF X;  3D6S A;  4ZUX U;  2BDZ A;  1A6R A;  1QMY A;  4BSQ A;  1KFX L;  2XU1 A;  4QRV A;  1YAL A;  1MHW A;  3OVZ A;  3I3T A;  4N79 A;  1ICF A;  1O0E A;  3F5V A;  1KHP A;  3S3R A;  3QSD A;  4AXL A;  1AEC A;  2HD5 A;  3P5V A;  2G8J A;  2AYO A;  5JH3 A;  1PPN A;  1AYU A;  3N3K A;  4QH6 A;  2PBH A;  3MHS A;  1YT7 A;  3B79 A;  2YJC A;  1VSN A;  2Y6E A;  1PBH A;  1ZIV A;  2FUD A;  2DC9 A;  2R9F A;  2XU3 A;  4RY2 A;  1PPO A;  3K8U A;  2AU1 A;  3HWN A;  3M99 A;  4DMY A;  3ERV A;  1NPZ A;  4BQV A;  3GCB A;  2FQ9 A;  3CBK A;  1BGO A;  4W5C A;  1GEC E;  1EWO A;  3BCN A;  3IHP A;  1ME4 A;  4OEL A;  4X6I A;  2DJF B;  2AYN A;  3PDF A;  1SNK A;  3BC3 A;  3E1Z B;  3H8C A;  4X6J A;  1Y08 A;  1BQI A;  2O6X A;  1EWM A;  1MEM A;  1CV8 A;  2YJB A;  3LXS A;  1CVZ A;  1KXR A;  2E03 A;  4XR7 A;  3N3G A;  2NQG A;  3P5W A;  1ZCM A;  4W5B A;  3WXF A;  3OVX A;  1AYV A;  2OP3 A;  5CHV A;  1TLO A;  5K16 A;  1CPJ A;  2PNS A;  2YJ9 A;  2FRQ A;  3IUT A;  3RVV A;  4CDD A;  1K3B A;  2NQD B;  3KWB X;  1CS8 A;  1AIM A;  3V6C A;  4BPV A;  2B1M A;  1U9V A;  2DZY A;  2NQI A;  3PBH A;  1U9X A;  3H6S A;  4WA6 A;  4I04 A;  1PAD A;  4CDF B;  2DCD A;  3KW9 A;  3NHE A;  4PI3 A;  1NB3 A;  1GMY A;  4CDE B;  2JQG R;  1YVB A;  3ZUA A;  1M6D A;  1YK8 A;  4CDC A;  7PCK A;  3BPM A;  3F75 A;  2AUX A;  2F7D A;  4YVA A;  3OIS A;  3KWZ A;  1U9Q X;  1ITO A;  4FJC A;  3HHA A;  3CBJ A;  3S3Q A;  2CIO A;  3N4C A;  3BPF A;  3IEJ A;  1NQC A;  1QXP A;  8PCH A;  1CTE A;  1HUC B;  2CB5 A;  1F2C A;  1GCB A;  3PW3 A;  4K7C A;  3MTN A;  1F2A A;  3H7D A;  5EF4 A;  2B1N A;  2C0Y A;  1S4V A;  2FT2 A;  3LFY A;  4X6H A;  3KX1 A;  3P5X A;  2HHN A;  1DF0 A;  4Q8G A;  2FO5 A;  3RVX A;  3P5U A;  4PAD A;  1PE6 A;  3C9E A;  1MEG A;  3H89 A;  2DCB A;  3USV A;  1Y4H A;  2P86 A;  2FYE A;  2OZ2 A;  5EGW A;  5F02 A;  3OF9 A;  4YYV A;  2E02 A;  2DC7 A;  4QBB A;  4OEM A;  4N8W A;  2HH5 A;  1KHQ A;  2AUZ A;  2ACT A;  2DC6 A;  2PAD A;  5CVN B;  1X9Y A;  4I07 A;  3K24 A;  4BS5 A;  2F1G A;  3WXE A;  1FH0 A;  4FK5 A;  3IV2 A;  2R9C A;  4CZW A;  1TU6 A;  1XKG A;  5CVO B;  4DMX A;  1IWD A;  3KFQ A;  4YYQ A;  2DJG A;  3QT4 A;  1CJL A;  4XUI A;  2IBI A;  1MDW A;  4P6E A;  3QJ3 A;  1Q6K A;  3K9M A;  1MIR A;  1PPP A;  2DZZ A;  1EF7 A;  5CVM A;  9PAP A;  3IMA A;  2DJF A;  4MZS A;  1AU2 A;  2E00 A;  1PCI A;  3CH2 X;  4MZO A;  3AI8 A;  5PAD A;  3PNR A;  3IOQ A;  1AU3 A;  2AIM A;  1THE A;  3V6E A;  3MOR A;  1DEU A;  3KKU A;  3I06 A;  2P0R A;  4YYR A;  2AVW A;  2XU5 A;  4QRG A;  2GHU A;  1EWP A;  2JQF R;  1AU0 A;  4MSX A;  3MHH A;  1EWL A;  2R9M A;  3O1G A;  2FTD A;  3HHI A;  2PRE A;  3TNX A;  1ME3 A;  3WXG A;  4YYU A;  4YYS A;  1U9W A;  1BP4 A;  1SP4 B;  1VJV A;  1MS6 A;  2DCA A;  4YV8 A;  1QDQ A;  4BS6 A;  1F29 A;  2GFO A;  2H7J A;  1F2B A;  3O0U A;  2ARY A; 
#chains in the Genus database with same CATH topology
 3GAQ A;  4A1H A;  1CBS A;  5AEO A;  1A3Y A;  3FW5 A;  1EI5 A;  3NX1 A;  3RDX A;  4L3R A;  3FR4 A;  4HWY A;  1IFC A;  1SLF B;  5CHK A;  4CDF A;  2MJI A;  2BT9 A;  5CHT A;  2MM3 A;  4CDE A;  5HTE A;  4W4U A;  3OF8 A;  3FYF A;  4AXM A;  1N9M A;  3L4R A;  1NGL A;  2YJ8 A;  4MM3 B;  5DPQ A;  1NLJ A;  4YYW A;  3CH3 X;  1DV9 A;  4BGF A;  2FWV A;  2DC8 A;  3CR6 A;  2E01 A;  2X55 A;  2WEW A;  2ACP X;  2UZJ A;  2EU7 X;  1CSB B;  3APW A;  4Y0R A;  6PAD A;  4ZHD A;  3RE6 A;  3F8A A;  2JMB A;  2UZ2 A;  1SY2 A;  1BSO A;  4FQB B;  1NB5 A;  1U5I A;  1SY0 A;  1VWR B;  4GUA A;  3VE1 A;  1BSY A;  2FKG A;  2VHF A;  2ATO A;  4RF1 A;  3HD3 A;  4XME A;  2Y5B A;  5J94 A;  1PPD A;  3V8U A;  3WYP A;  4PSQ A;  3ELZ A;  4KLB A;  4AZP A;  1LKE A;  2WBF X;  4CPH A;  4ZUX U;  1AQB A;  4IB7 A;  1QMY A;  4BX7 B;  1BBP A;  2CBS A;  1TOU A;  2JU3 A;  2IZG B;  4Y0Q A;  3FEN A;  4EXZ A;  3OVZ A;  5B27 A;  4BOP A;  1JJJ A;  1BLR A;  1ICF A;  3VHM A;  3SLJ A;  1FE3 A;  1B8E A;  2FE8 A;  1KQW A;  3IA8 A;  1AEC A;  3APX A;  4AYH A;  4Z27 A;  5JH3 A;  1PPN A;  3MHS A;  3PED A;  5H9L A;  1PBH A;  2BS6 A;  4MIS A;  5EZS A;  3PT2 A;  3E3C A;  4N7D A;  3G7X A;  1VWJ B;  2ASN X;  1ACD A;  1YWA A;  1EPB A;  4FBO A;  4ZH9 A;  1OBQ A;  3K8U A;  2AU1 A;  3WYQ A;  3HK1 A;  4DMY A;  4TJZ A;  3NQ3 A;  4BQV A;  2RTF B;  5B3M O;  3U9P C;  2FKJ A;  3BBA A;  5LJH A;  1VWB B;  3ZW0 A;  3BCN A;  3IHP A;  5HCE C;  4KH8 A;  2GJ5 A;  1Y55 X;  4X6I A;  2DJF B;  2OYB O;  1EUO A;  2AYN A;  3BC3 A;  4UU3 A;  3FA8 A;  5EDC A;  3WZO A;  2FS6 A;  4MIR A;  3DSZ A;  4XMF A;  4Z28 A;  1BQI A;  3PRM A;  1CRB A;  4AZM A;  1LFO A;  3LXS A;  2VDF A;  2G5L A;  1PMP A;  1BJ7 A;  1KL5 A;  3N3G A;  4FBV A;  3ZW1 A;  2VFC A;  4W5B A;  4OW0 A;  3RZY A;  3MP2 A;  2OP3 A;  2RCT A;  1A2D A;  3FMZ A;  1CPJ A;  2PNS A;  2RD7 C;  5JD2 A;  3HWF A;  3MM0 A;  4ZHF A;  3S26 A;  4BX6 B;  2NQD B;  3FLL A;  3KWB X;  1JJX A;  1CS8 A;  3V6C A;  4BPV A;  1LCZ A;  3VG5 A;  2DZY A;  1E06 A;  1STS B;  4HFO A;  4BOQ A;  4I04 A;  4GET A;  1ZNG A;  1DZJ A;  1ZNL A;  3B2L A;  3FEK A;  4ORS A;  1NC9 A;  2J7Q A;  2NNE A;  2E4J A;  1FJ1 E;  5HCD C;  1Y9T A;  1O1V A;  5HZ9 A;  3F75 A;  1AB0 A;  3H3I A;  1W6F A;  2Y3E A;  4YVA A;  2JTC A;  1MDC A;  4FJC A;  1EQD A;  3MG5 A;  3RKG A;  2RTD B;  4OKA A;  1ERB A;  1QXP A;  1SWT A;  4GK9 A;  1DZK A;  1I4U A;  4GU8 A;  4O3Z A;  2Z84 A;  2FT2 A;  3BX7 A;  1OEK A;  4YDA A;  3TZS A;  3RE5 A;  3HWG A;  3BB7 A;  1FEN A;  2KD2 A;  1PE6 A;  2QO5 A;  4QGX A;  3USV A;  4U9C A;  2IZH B;  4IBA A;  2FYE A;  3EBK A;  3EW2 A;  1JZU A;  4QZU A;  3BY4 A;  2R73 A;  1QG5 A;  2BS5 A;  4O4X A;  2RTH B;  3T6L A;  1VWM B;  1X9Y A;  4RUN A;  4BS5 A;  2JW1 A;  1BSQ A;  4YBP A;  2Q39 A;  5HWZ A;  4IUM A;  1SWO A;  4EQA C;  5BYP A;  1TU6 A;  1EPA A;  1HMS A;  3VHI A;  3X00 A;  3PHU A;  2DJG A;  3ZUI A;  3QT4 A;  2BHV A;  2WUT A;  1ZNH A;  4YGZ A;  1YWC A;  3VHH A;  3KQ0 A;  2IBI A;  2C1S A;  3WBG A;  1MDW A;  1KL4 A;  2POA A;  1QQS A;  3STM X;  4OMW A;  1MIR A;  3K9M A;  2RTI B;  1PPP A;  3WVM A;  4Y0S A;  5CVM A;  4YFR A;  3KFF A;  3O2Y A;  2OFR X;  4UU2 A;  3QQ2 A;  3WJF A;  2IFB A;  2FR2 A;  1XCA A;  4XMD A;  3CH2 X;  2A8G A;  4MVI A;  4LQZ A;  2IZC B;  2ACO A;  3NAD A;  3IOQ A;  5CE4 A;  4I95 A;  2OFA A;  1D2U A;  3P6D A;  3TGA A;  3BY0 A;  5LJE A;  1GGL A;  4REZ A;  4M0W A;  1ZNE A;  1AVG I;  4GKC A;  2GHU A;  1YP7 A;  1AU0 A;  4MSX A;  4DCB A;  2AT3 X;  1X8Q A;  3ZNH A;  4GGR A;  1HMR A;  2HYS A;  5FEN A;  1KT7 A;  4AW8 A;  4QGW A;  1NP1 A;  1VJV A;  1MS6 A;  1QDQ A;  1ML7 A;  3O0U A;  4MVE A;  4BCS A;  4TKJ A;  1I04 A;  1U18 A;  5JA7 A;  4PP1 A;  1SWB A;  4YH0 A;  5LJK A;  2HKD A;  2HWK A;  1E00 A;  4CDD B;  1K3B B;  1EW3 A;  1STF E;  2HXZ A;  2R56 A;  2R9N A;  1BY8 A;  2BDL A;  4YVB A;  4AZN A;  1BRP A;  4ZHH A;  4CPI A;  2X8T A;  2G8E A;  2P7U A;  2A3F X;  4TKB A;  3BWK A;  1SRJ A;  2HMB A;  1LUQ A;  2RQ0 A;  4O3W A;  3CWK A;  2RCQ A;  1EIO A;  3I0A A;  4KC7 A;  4I3C A;  5EPQ A;  1O1U A;  1NBX A;  4IP3 A;  5K68 A;  1STP A;  4A60 A;  5EEE A;  2DCC A;  5LKE A;  2XU4 A;  4QRX A;  1NL6 A;  3U8E A;  2K23 A;  2A0A A;  5LJB A;  3H8B A;  2Q2P A;  2NQA A;  4Q8H A;  1AYW A;  4KCA A;  2W2A A;  1HXZ A;  1YZB A;  4MVL A;  4N4Z A;  3TGB A;  1TOW A;  2Z4H A;  2CZT A;  4QNI A;  1GX8 A;  4ZHC A;  1TL9 A;  1VWI B;  2OL7 A;  4ZH6 A;  1VWH B;  4I9S A;  4LKP A;  1I9H A;  1VWN B;  4YCE A;  1L6M A;  5IO5 A;  5HZ5 A;  4HWM A;  4QQ1 A;  3PH6 A;  4N79 A;  5B29 A;  4YBU A;  3N91 A;  1KL3 A;  1SXU A;  1GX9 A;  1SRF A;  3S5V A;  4OVZ A;  1KHP A;  3QSD A;  3IFU A;  2IZA A;  2HZR A;  2G8J A;  4IAB A;  2LB6 A;  2ALL X;  1YT7 A;  3B79 A;  5KIC A;  2IZL B;  3MTV A;  2XU3 A;  4RY2 A;  3LHN A;  3NQK A;  2OVS A;  4P16 A;  1PPO A;  2PI3 O;  1SXX A;  3O65 A;  3ERV A;  1U17 A;  4GDZ A;  3GCB A;  4ES7 A;  2FQ9 A;  3RDM A;  3U0D A;  3PQU A;  1QY1 A;  4ON1 A;  5D48 A;  1ME4 A;  2F01 A;  1PM1 X;  4CK4 A;  3W31 A;  5EZ2 A;  4CV7 A;  3PP6 A;  1OBU A;  2RTC B;  2IZJ A;  3H8C A;  4EFG A;  2JGS A;  3MBT A;  2O6X A;  2RTN B;  1LIC A;  1CV8 A;  2OF8 A;  3JS1 A;  2X34 A;  4ORX A;  2RTK A;  2E03 A;  3FA7 A;  4DNE A;  2NQG A;  1X8U A;  2Y3F A;  4XMH A;  2QM9 A;  3FDC A;  2O62 A;  1TLO A;  5K16 A;  3RBY A;  3FEP A;  2WWP A;  4IB6 A;  1HBQ A;  1JIW I;  4JO6 A;  3RVV A;  1WBI A;  2KTS A;  4FGI B;  5D45 A;  1ICM A;  1X8N A;  4TLJ A;  5JR8 A;  2B1M A;  3BLG A;  1U9V A;  1LPJ A;  3QKG A;  1E5P A;  2AL0 X;  3EM0 A;  3H6S A;  4ZGF A;  2YMS A;  3PHW A;  4PI3 A;  1RAV A;  4GNW A;  4IB8 A;  4Y0P A;  4BOE A;  3OD9 A;  1KZX A;  2OVD A;  1B4M A;  3ZUA A;  2FRS A;  1SWH A;  1QY2 A;  2AUX A;  2F7D A;  4ARH A;  2X8F A;  4NNT A;  1X89 A;  3VU1 A;  1DZM A;  1MK5 A;  1MM9 A;  1XKI A;  4AZQ A;  3S3Q A;  3BPF A;  5IXG A;  4ZHG A;  1HUC B;  2CB5 A;  4NP1 A;  1BWY A;  1F2C A;  4K7C A;  2BC3 A;  4JHQ A;  4ZGU A;  2WR6 A;  1S4V A;  3OJY C;  1BRQ A;  4HPB A;  4NNS A;  1DF0 A;  1AVD A;  2FO5 A;  3B2J A;  4XMG A;  1KT6 A;  4BX7 A;  5K67 A;  3IFB A;  3FID A;  2AT5 X;  5LJC A;  2DCB A;  4CSB A;  2I5Z O;  2P86 A;  1QFT A;  2AMM X;  2AT6 X;  5F02 A;  2ZAG A;  3OF9 A;  3P6E A;  1MOY A;  3WOV A;  2DC7 A;  2E02 A;  4BOS A;  1RST B;  4IMO A;  5E6J A;  3C78 X;  1OSP O;  1SWL A;  1DF8 A;  1GKA B;  5CVN B;  2PY1 A;  4N7C A;  3K24 A;  2A2U A;  1CBR A;  2F1G A;  2C1Q A;  4EEJ A;  1LNM A;  1G5W A;  1YWB A;  1SLD B;  5EZQ A;  3WXQ A;  4DMX A;  5H8T A;  3KZA A;  1NQN A;  3KFQ A;  1HMT A;  1G74 A;  3D96 A;  5AJC A;  3HOE A;  5HCC C;  2ZAI A;  3BDR A;  4P6E A;  4O3Y A;  2FTB A;  1Q6K A;  3EC5 A;  1QFV A;  1STR B;  9PAP A;  3CKF A;  2DJF A;  3SLO A;  1KOI A;  1CBQ A;  4CPF A;  1AU2 A;  2Z4I A;  1RLB E;  1JYJ A;  1ZND A;  2OY7 A;  4ORU A;  3WJC A;  4RF0 A;  1VWO B;  2IZB A;  4AZO A;  3VG3 A;  1O8V A;  3BS2 A;  1D3S A;  3C76 X;  3EMM A;  3S60 A;  5D47 A;  4ZR2 A;  1DEU A;  1HXL A;  2P0R A;  2NP1 A;  1SA8 A;  3EYC A;  3PPT A;  2AVW A;  2OZQ A;  3SZH A;  2JQF R;  2A5C A;  1EWL A;  3SAO A;  4U8U M;  1KGL A;  2PRE A;  1VWQ B;  1VWD B;  1DC9 A;  1ME3 A;  3WXG A;  4IMN A;  5BVT A;  5B11 O;  1SP4 B;  2BTW B;  1P6P A;  3SLT A;  2IZK A;  2H7J A;  1QWD A;  4NV7 A;  1R0U A;  2OFB A;  3VPJ E;  5L8I A;  2IPP B;  3ZW2 A;  1HY2 A;  1PBO A;  3RVW A;  2DJG B;  1SWR A;  5JZE A;  1VPR A;  1TW4 A;  2P8G A;  2NND A;  2AKQ A;  1YK7 A;  2FRA A;  5C0N A;  3E9S A;  4JGL A;  2FHN X;  4MVK A;  1VYF A;  4BBO A;  3FR2 A;  3S5X A;  1PIP A;  5F7G A;  5IRU A;  2GC9 A;  1X71 A;  4Z2V A;  3KFG A;  4WFV A;  4P6G A;  3CQR A;  4CDC B;  5HA0 A;  4YFP A;  4ALO A;  4NLJ A;  5A24 A;  2GTL O;  3W30 A;  2KTD A;  1QOL A;  1GLO A;  5D8J A;  2VHS A;  3BOW A;  3TGC A;  4L1N A;  4PP2 E;  1TXL A;  4GJS A;  4D6A A;  1YP6 A;  3I17 A;  1SWN A;  1IIU A;  1KXO A;  4JNJ A;  2A5B A;  2M4L A;  3DF0 A;  2XST A;  1ATK A;  1SY3 A;  1BM5 A;  5B10 O;  2KT4 B;  1ERX A;  3ELX A;  2MWH A;  1OPA A;  1PXV A;  1I78 A;  4IAX A;  1GT3 A;  5HTD A;  1RXJ A;  2AF5 A;  4LZV A;  3CBC A;  1SXY A;  2BDZ A;  1A6R A;  1B56 A;  1N0S A;  3AKN A;  4Z2O A;  3C0R A;  1MHW A;  4YFQ A;  2OFM X;  3D9W A;  1K24 A;  1O0E A;  1N43 A;  1ALB A;  4AXL A;  1OBP A;  3UAQ A;  3WZQ A;  4KC8 A;  2HD5 A;  3P5V A;  2DM5 A;  2WSJ A;  3ZUO A;  1T0V A;  2HNX A;  3N3K A;  2PBH A;  2QOS C;  4QYN A;  2Y6E A;  3ZWE A;  2WQ9 A;  2FUD A;  5F1E A;  2DC9 A;  3CMP A;  1VWF B;  4XZX A;  4ODD A;  5F58 A;  1T8V A;  1DF3 A;  3RNV A;  1NPZ A;  5H9A A;  5BVQ A;  3RDO A;  3AUM O;  5FQ7 E;  2OY5 O;  3CBK A;  2N93 A;  3LTW A;  4GD9 A;  5IO7 A;  1BGO A;  2W2B A;  4A8Z A;  2QO4 A;  1GEC E;  4GRJ A;  1EWO A;  4O4S A;  4BX5 A;  2FLJ A;  5CSE A;  1LIB A;  1NQM A;  4QYP A;  1SNK A;  2CBR A;  2LFO A;  3C77 X;  3RY2 A;  5B5G A;  4X6J A;  1Y08 A;  3RSW A;  1YIV A;  4GGZ A;  3RY1 A;  1MEM A;  3SZJ A;  2OY8 A;  2YJB A;  3KFI A;  4GDA A;  1CVZ A;  4WBK A;  4B55 A;  5F2B A;  2AT8 X;  3UEW A;  1ZCM A;  3P5W A;  3STK A;  4GH7 A;  4I3B A;  2GTL N;  1VYO A;  3SZI A;  1SWD A;  5HBS A;  3IUT A;  1YUP A;  3TRK A;  1MVG A;  1WUB A;  4CDD A;  2FT9 A;  1K3B A;  3ZZV A;  2RA6 A;  1AVE A;  4CPE A;  2RTL A;  4OMX A;  1AIM A;  1IKE A;  4TNN A;  4INN A;  4ZTB A;  3CQN A;  2MHD A;  4R0B A;  4HPC A;  1KT5 A;  1QY0 A;  3FR5 A;  1PAD A;  4CDF B;  3KVN A;  3OQC A;  1LCW A;  3B21 A;  1G85 A;  4KT5 A;  2DCD A;  2RTE B;  4IAW A;  4GJV A;  3NHE A;  1IFB A;  1IKJ A;  2AT0 X;  2NNQ A;  4I9R A;  1NB3 A;  1W4T A;  1GMY A;  4CDE B;  3NP1 A;  3VG4 A;  2F09 A;  1DKI A;  1M6D A;  3B2K A;  3APU A;  2VFB A;  3NPO A;  1SWP A;  1SY1 A;  3KWZ A;  1U9Q X;  3BU1 A;  2WQA E;  3HHA A;  3N4C A;  1SWU A;  4YMY A;  5KHP A;  1MX8 A;  1RXH A;  2Q2M A;  3TMP A;  1A18 A;  1S7D A;  3FA9 A;  4YGG A;  4EKV A;  3RDQ A;  1GCB A;  4LKT A;  1ZNK A;  3PW3 A;  2AGA A;  3MTN A;  4YGH A;  3H7D A;  2J7Q C;  5EF4 A;  2B1N A;  1E2T A;  1SXW A;  2CM9 A;  3D95 A;  2L9C A;  2HHN A;  3VG2 A;  2QCB A;  3P5U A;  1U0X A;  3PRP A;  1MEG A;  3H89 A;  1FEM A;  4CPH B;  1GT4 A;  1Y52 X;  1A57 A;  4YCH A;  1SWQ A;  3NR3 A;  3Q34 A;  2OZ2 A;  1S2P A;  3UEV A;  4ZCB A;  4QZT A;  4U3Q A;  1B0O A;  4I3D A;  5IO6 A;  4QBB A;  4RNA A;  1SWK A;  2HH5 A;  1GT5 A;  1FEL A;  1KHQ A;  2AUZ A;  5DG4 A;  4IB9 A;  3CKG A;  1Z24 A;  2ACT A;  3O22 A;  2DC6 A;  3BU9 A;  5BVS A;  2JN3 A;  4NYQ A;  2X45 A;  4ID2 A;  3WXE A;  3UEU A;  1FH0 A;  1SRG A;  4OS8 A;  4TKH A;  1XKG A;  5CVO B;  1IWD A;  1N9Y A;  4PT5 A;  3UEX A;  1CJL A;  1GXA A;  2MO5 A;  3QJ3 A;  3RWX A;  2RTO B;  4ORR A;  3VG7 A;  3WJG A;  1PTS A;  5KO3 A;  2DZZ A;  3IMA A;  3ZW0 B;  1VWE B;  4MZS A;  5F6Z A;  2OY1 O;  2LA7 A;  2HZQ A;  3WZN A;  4GE1 A;  3U03 A;  3AI8 A;  3PNR A;  2CZU A;  3BSZ E;  1T68 X;  1THE A;  3V6E A;  1JBH A;  4WUR A;  2BSZ A;  1Y0G A;  2XU5 A;  4ZJ0 A;  3HPE A;  4QRG A;  4Y59 A;  2BLG A;  1ADL A;  3PHX A;  2R9M A;  3B2I A;  3O1G A;  1SLG B;  3HHI A;  1OEJ A;  1JJU A;  2G79 A;  2RTB B;  3ZW1 B;  1U9W A;  4Z6J A;  1BP4 A;  1VWK B;  1X8P A;  1KFF A;  4YV8 A;  4BS6 A;  1F29 A;  1FDQ A;  3NQ9 A;  2GFO A;  5H9K A;  2G78 A;  4HPA A;  1EII A;  4U8U O;  2IZE B;  2G8C O;  2CM4 A;  2RN4 A;  2QO6 A;  1IJ8 A;  4WFU A;  2CAM A;  3TF6 A;  4MI7 A;  2OL6 O;  1CB5 A;  5HZQ A;  2X32 A;  3KSE A;  1KFU L;  5HZ6 A;  1JQP A;  3P24 A;  4FBR A;  1VWA B;  2X46 A;  1VWC B;  3VGW A;  4BQU A;  4I05 A;  1POP A;  2G6D A;  5AQ6 A;  5FFH A;  2YJ2 A;  2JOZ A;  1SWC A;  1DZP A;  5FPW A;  4R3D A;  1KT4 A;  2R9O A;  2R6N A;  3APV A;  3D97 A;  4O3X B;  2R74 A;  2AS8 A;  1CQD A;  1GM6 A;  3FW4 A;  2A13 A;  1KQX A;  1ZRY A;  3MX7 A;  4G54 A;  1IW2 A;  4NW4 A;  4YKO A;  2G7Y A;  1SRE A;  1S44 A;  2RTJ A;  3PQS A;  4FIP A;  1LID A;  3BX8 A;  1OEE A;  3NX2 A;  2C4I A;  5F6B A;  1SRH A;  2WPU A;  3AEH A;  5LJG A;  2OL8 O;  3VE2 A;  1AU4 A;  1MX7 A;  4GNY A;  4QRL A;  2OUL A;  1NDJ A;  2L67 A;  1RSU B;  1KT3 A;  3D6S A;  1JMZ A;  1SWA A;  4U46 A;  4M7M A;  4BSQ A;  1KFX L;  4GGT A;  2X56 A;  2JRI A;  1PBY A;  3FIQ A;  4ORW A;  2XU1 A;  4EDE A;  4QRV A;  5FQ6 E;  2Y32 A;  5FQ8 E;  3GE2 A;  1MEP A;  1YAL A;  2BU3 A;  1BEB A;  2AH7 X;  3I3T A;  1GKA A;  3FEL A;  5HZ8 A;  4Y5D A;  3F5V A;  3S3R A;  3P02 A;  1E02 A;  2AYO A;  2X8S A;  1AEL A;  4ALB A;  4YKM A;  1AYU A;  2I5V O;  4QH6 A;  2UYW A;  2Q9S A;  1HBP A;  3T2W A;  5LJD A;  2YJC A;  3RDU A;  1VSN A;  3ZQ3 A;  4BX6 A;  3BRN A;  1ZIV A;  4MEE A;  3WJD A;  2R9F A;  4OS3 A;  3HWN A;  4C5P A;  3M99 A;  2GH7 A;  4O9S A;  5CYB A;  2X4M A;  1KZW A;  3WZP A;  4U8U N;  4W5C A;  4ORY A;  4QAE A;  3P6G A;  2XKL A;  4A1Y A;  3P6C A;  2Q4N A;  4OEL A;  3MVF A;  4A5U A;  3PDF A;  1W5R A;  4NV8 A;  3E1Z B;  2RTP B;  3HWD A;  3O19 A;  4D8B A;  1EWM A;  3PSE A;  4BJ8 A;  5IRW A;  1ICN A;  1LF7 A;  2L68 A;  1KXR A;  2RTQ B;  2RTR B;  1SWG A;  4XR7 A;  1VWL B;  2HLV A;  3PH5 A;  1UYN X;  2RTA A;  5LKF A;  3ZI8 A;  2BTW A;  3WXF A;  3OVX A;  1AYV A;  1RXK A;  2KW1 A;  5CHV A;  5IRA A;  1VWP B;  1SWE A;  2YJ9 A;  1JV4 A;  1EXS A;  2IZF B;  2FRQ A;  3OBL A;  1I05 A;  3STN A;  5B2A O;  4KII A;  1NP4 A;  1TVQ A;  5HAE A;  4BOZ A;  3HOL A;  4O4O A;  4DQ4 A;  2NQI A;  3PBH A;  1U9X A;  4D6B A;  4GZV A;  2AVI A;  2JU7 A;  3K3L A;  4WA6 A;  2QOM A;  2IZI A;  2JU8 A;  3KW9 A;  2WEX A;  4BVM A;  3B2H A;  4NYR A;  4HPD A;  5L8N A;  4BX5 B;  4M6S A;  2JQG R;  1YVB A;  2LBA A;  1PVJ A;  1YK8 A;  4CDC A;  7PCK A;  3BPM A;  1LCV A;  4LZU A;  2FS7 A;  3T2X A;  3OIS A;  2ANS A;  1I06 A;  1ITO A;  2FGS A;  4AZR A;  4K19 A;  3CBJ A;  2CIO A;  5K06 A;  2FR3 A;  3MJ5 A;  2YG2 A;  3IEJ A;  1NQC A;  1EAL A;  1LDO A;  8PCH A;  1CTE A;  1LIF A;  4DQ3 A;  1SWF A;  4I6S A;  1OPB A;  2RTM A;  1F2A A;  4NLI A;  3KFH A;  2C0Y A;  2F73 A;  4TQ2 A;  1CJ5 A;  3LFY A;  4X6H A;  4D8E A;  1Y9L A;  3KX1 A;  1SMP I;  2QMI A;  1SWS A;  3P5X A;  4COT A;  5B5F A;  1LIE A;  2FHL A;  2MF6 A;  4Q8G A;  3LV4 A;  3RVX A;  4PAD A;  3FA6 A;  3T6F A;  1HN2 A;  3C9E A;  3DTQ A;  1Y4H A;  5FAZ A;  2RTG B;  1Y53 X;  3PEC A;  1SWJ A;  2IZD B;  1N4J A;  3F6Z B;  1HQQ A;  5AJB A;  5EGW A;  4YYV A;  3PK2 A;  2A2G A;  4OEM A;  2GTL M;  4N8W A;  1URE A;  1H91 A;  1RBP A;  5D4A A;  2L5P A;  3D4R A;  3WJE A;  4O49 A;  2PAD A;  1G7N A;  5EDB A;  4I07 A;  4QGV A;  1CBI A;  4OVZ B;  4XMC A;  5KID A;  4RUU A;  1JYD A;  3JSQ A;  3T1D A;  4D8I A;  2LBV A;  4I60 A;  1VYG A;  4FK5 A;  3IV2 A;  2R9C A;  4CZW A;  5L8O A;  1PEE A;  1UZ2 X;  1HQP A;  4YDB A;  4YYQ A;  4Z2P A;  3NBX X;  4XUI A;  3VG6 A;  2LKK A;  3EBW A;  2OVE A;  1GX3 A;  4OS0 A;  4O4U A;  1N7Y A;  2K62 A;  4HXD B;  3WJB A;  1EF7 A;  2ARY A;  5EED A;  4IRW A;  3P6H A;  1UYO X;  3OE3 A;  4ML7 B;  4WHI A;  3P6F A;  1GT1 A;  2E00 A;  1PCI A;  2DOS A;  1QAB E;  4MZO A;  3HWE A;  1SLE B;  5PAD A;  1JMX A;  1AU3 A;  2AIM A;  5HA1 A;  1UKF A;  3MOR A;  1MUP A;  3KKU A;  3I06 A;  2W2F A;  3SOT A;  4YYR A;  2GTF X;  3HTY A;  2ZSC A;  1EWP A;  1X8O A;  4GUZ A;  4ZFX A;  1SRI A;  3JQO A;  5L3Y A;  3Q6L A;  3MHH A;  1LEL A;  2FTD A;  3AKM A;  3TNX A;  3RDS A;  1LDQ A;  4YYU A;  4YYS A;  2OF9 A;  3EW1 A;  1YWD A;  1VWG B;  4BOU A;  5H9N A;  4RKX A;  1FTP A;  2DCA A;  1F2B A;  4PJ2 A;  3F9D A;  2G7B A;  2OVA A;  3CBS A;  1DFV A; 
#chains in the Genus database with same CATH homology
 2IPP B;  5JA7 A;  4PP1 A;  3RVW A;  2DJG B;  1CB5 A;  4HWY A;  4CDD B;  1K3B B;  4CDF A;  3KSE A;  1STF E;  1KFU L;  1YK7 A;  2FRA A;  2HXZ A;  2R9N A;  1BY8 A;  2BDL A;  5CHT A;  1JQP A;  4CDE A;  4W4U A;  2G8E A;  3OF8 A;  2P7U A;  3BWK A;  1PIP A;  4AXM A;  4I05 A;  2YJ8 A;  1POP A;  1NLJ A;  4YYW A;  2G6D A;  3CH3 X;  2YJ2 A;  4BGF A;  2DC8 A;  2E01 A;  5FPW A;  4P6G A;  2R9O A;  2R6N A;  4CDC B;  1CSB B;  6PAD A;  5A24 A;  2AS8 A;  1CQD A;  1QOL A;  1GLO A;  2DCC A;  4G54 A;  2VHS A;  2XU4 A;  3BOW A;  4QRX A;  2G7Y A;  1NL6 A;  4PP2 E;  3U8E A;  3H8B A;  1NB5 A;  4FIP A;  2NQA A;  4Q8H A;  1U5I A;  1AYW A;  2VHF A;  2ATO A;  3DF0 A;  1ATK A;  1AU4 A;  3HD3 A;  4N4Z A;  2Y5B A;  5J94 A;  1PPD A;  1TL9 A;  2OUL A;  1PXV A;  4KLB A;  2WBF X;  3D6S A;  4ZUX U;  2BDZ A;  1A6R A;  1QMY A;  4BSQ A;  1KFX L;  2XU1 A;  4QRV A;  1YAL A;  1MHW A;  3OVZ A;  3I3T A;  4N79 A;  3D9W A;  1ICF A;  1O0E A;  3F5V A;  1KHP A;  3S3R A;  3QSD A;  4AXL A;  1AEC A;  2HD5 A;  3P5V A;  2G8J A;  2AYO A;  5JH3 A;  1PPN A;  1AYU A;  3N3K A;  4QH6 A;  2PBH A;  3MHS A;  1YT7 A;  3B79 A;  2YJC A;  1VSN A;  2Y6E A;  1PBH A;  1ZIV A;  2FUD A;  2DC9 A;  2R9F A;  2XU3 A;  4RY2 A;  1PPO A;  3K8U A;  2AU1 A;  3HWN A;  4C5P A;  3M99 A;  4DMY A;  3ERV A;  1NPZ A;  4BQV A;  3GCB A;  2FQ9 A;  3CBK A;  1BGO A;  3LTW A;  4W5C A;  1GEC E;  1EWO A;  3BCN A;  3IHP A;  1ME4 A;  4OEL A;  4X6I A;  2DJF B;  2AYN A;  3PDF A;  1SNK A;  3BC3 A;  1W5R A;  4NV8 A;  3E1Z B;  3H8C A;  4X6J A;  1Y08 A;  1BQI A;  2O6X A;  1EWM A;  1MEM A;  1CV8 A;  2YJB A;  3LXS A;  1CVZ A;  1KXR A;  4B55 A;  2E03 A;  4XR7 A;  3N3G A;  2NQG A;  2VFC A;  1ZCM A;  3P5W A;  4W5B A;  3WXF A;  3OVX A;  1AYV A;  2OP3 A;  5CHV A;  1TLO A;  5K16 A;  1CPJ A;  2PNS A;  2YJ9 A;  2FRQ A;  3IUT A;  3RVV A;  4CDD A;  1K3B A;  2NQD B;  3KWB X;  1CS8 A;  1AIM A;  3V6C A;  4BPV A;  2B1M A;  1U9V A;  2DZY A;  2NQI A;  3PBH A;  1U9X A;  3H6S A;  4WA6 A;  4I04 A;  1PAD A;  4CDF B;  2DCD A;  3KW9 A;  3NHE A;  4PI3 A;  1NB3 A;  1W4T A;  1GMY A;  4CDE B;  2JQG R;  1YVB A;  3ZUA A;  1M6D A;  1YK8 A;  4CDC A;  7PCK A;  3BPM A;  3F75 A;  2VFB A;  2AUX A;  2F7D A;  1W6F A;  4YVA A;  3OIS A;  3KWZ A;  1U9Q X;  1ITO A;  4FJC A;  3HHA A;  3CBJ A;  3S3Q A;  2CIO A;  3N4C A;  3BPF A;  3IEJ A;  1NQC A;  1QXP A;  8PCH A;  1CTE A;  1HUC B;  2CB5 A;  1F2C A;  1GCB A;  3PW3 A;  4K7C A;  3MTN A;  1F2A A;  3H7D A;  5EF4 A;  2B1N A;  1E2T A;  2C0Y A;  1S4V A;  2FT2 A;  3LFY A;  4X6H A;  3KX1 A;  3P5X A;  2HHN A;  1DF0 A;  4Q8G A;  2FO5 A;  3RVX A;  3P5U A;  4PAD A;  1PE6 A;  3C9E A;  1MEG A;  3H89 A;  2DCB A;  3USV A;  1Y4H A;  2P86 A;  2FYE A;  2OZ2 A;  5EGW A;  5F02 A;  3OF9 A;  4YYV A;  2E02 A;  2DC7 A;  4QBB A;  4OEM A;  4N8W A;  2HH5 A;  1KHQ A;  2AUZ A;  2ACT A;  2DC6 A;  2PAD A;  5CVN B;  1X9Y A;  4I07 A;  3K24 A;  4BS5 A;  2F1G A;  3WXE A;  1FH0 A;  4FK5 A;  3IV2 A;  2R9C A;  4CZW A;  1TU6 A;  1XKG A;  5CVO B;  4DMX A;  1IWD A;  3KFQ A;  4YYQ A;  2DJG A;  3QT4 A;  1CJL A;  4XUI A;  2IBI A;  1MDW A;  4P6E A;  3QJ3 A;  1GX3 A;  1Q6K A;  3K9M A;  1MIR A;  1PPP A;  2DZZ A;  1EF7 A;  5CVM A;  9PAP A;  3IMA A;  2DJF A;  4MZS A;  1AU2 A;  2E00 A;  1PCI A;  3CH2 X;  4MZO A;  3AI8 A;  5PAD A;  3PNR A;  3IOQ A;  1AU3 A;  2AIM A;  1THE A;  3V6E A;  3MOR A;  1DEU A;  3KKU A;  2BSZ A;  2P0R A;  3I06 A;  4YYR A;  2AVW A;  2XU5 A;  4QRG A;  2GHU A;  1EWP A;  2JQF R;  4GUZ A;  1AU0 A;  4MSX A;  3MHH A;  1EWL A;  2R9M A;  3O1G A;  2FTD A;  3HHI A;  2PRE A;  3TNX A;  1ME3 A;  3WXG A;  4YYU A;  4YYS A;  1U9W A;  1BP4 A;  1SP4 B;  1VJV A;  1MS6 A;  2DCA A;  4YV8 A;  1QDQ A;  4BS6 A;  1F29 A;  2GFO A;  2H7J A;  1F2B A;  3O0U A;  4NV7 A;  2ARY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...