4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
1JQPA 4FJCA 1QMYA 1EWOA 3E1ZB 1AU4A 1PE6A 3IV2A 3H6SA 1QDQA 4BPVA 1MS6A 4N8WA 1BGOA 2E02A 4KLBA 4ZUXU 3OVXA 3I06A 4CDEA 4BS6A 1U9VA 1PPPA 4MSXA 1U9WA 3HWNA 1STFE 2PREA 3LFYA 2F1GA 2DZYA 1CTEA 4MZSA 2JQFR 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 1X9YA 3KW9A 1NL6A 2Y5BA 1KHQA 2DCBA 4CDEB 3RVWA 2Y6EA 3CH2X 1PPNA 1SNKA 4YYVA 2ATOA 1NB5A 2AU1A 2PBHA 1Y4HA 4YV8A 2AIMA 3PNRA 1PPDA 4BSQA 1ZCMA 3AI8A 2ARYA 2BDZA 1PXVA 3H7DA 4BQVA 3IMAA 1AU0A 2CB5A 1ME3A 1ME4A 1AECA 1F29A 5PADA 2R9FA 2NQGA 3QT4A 2NQAA 2AYOA 3NHEA 3WXFA 1AU3A 3PW3A 2R9OA 4CDFA 1NQCA 2E00A 5EF4A 1HUCB 3K8UA 2YJCA 4AXLA 5J94A 1BY8A 2YJ9A 1ATKA 3RVXA 1YVBA 1PBHA 1ZIVA 4I07A 2DC7A 3OF8A 2HXZA 2FO5A 2OZ2A 3BOWA 3WXEA 3USVA 1CSBB 5CHTA 2DCDA 1MIRA 4N79A 3H8CA 2FYEA 3WXGA 4N4ZA 3V6EA 4RY2A 3H8BA 2DC6A 1EWMA 3P5VA 1POPA 2DC9A 2FTDA 3N3KA 2R9CA 2P86A 3PBHA 1TLOA 2R9MA 2AUXA 4OEMA 1K3BB 4XUIA 5K16A 4AXMA 1GMYA 2FRQA 2HHNA 3ERVA 1CQDA 1U5IA 3O0UA 2DJGB 1EF7A 2G7YA 5JH3A 2O6XA 4YVAA 4CDFB 2B1MA 2H7JA 1AIMA 2G8JA 2XU5A 2DCAA 2XU3A 3IUTA 2F7DA 1MHWA 1CV8A 1YK7A 1EWLA 2AVWA 3C9EA 4Q8HA 3HHIA 2DJGA 4MZOA 3OF9A 1PIPA 3O1GA 2G8EA 4QRVA 3P5UA 2R6NA 1NB3A 4W5BA 3ZUAA 1KXRA 4FIPA 1ICFA 1BP4A 1GCBA 4W5CA 1PPOA 2DJFB 3HHAA 1KFUL 1YK8A 3CBJA 1F2CA 1A6RA 1KFXL 4QBBA 3N4CA 2YJBA 1EWPA 5CVNB 2IPPB 2YJ8A 5CVOB 4PADA 1U9XA 5F02A 5EGWA 3MTNA 4DMYA 2BDLA 4CDDB 4X6IA 1SP4B 3TNXA 3B79A 4P6GA 1DF0A 1Y08A 2PADA 3HD3A 3OISA 3KSEA 3F75A 3KX1A 2E01A 4YYWA 3KFQA 2ACTA 2AYNA 3N3GA 4OELA 2R9NA 1QOLA 3U8EA 1Q6KA 3MHHA 1VSNA 1VJVA 4CDCA 2AS8A 2AUZA 3I3TA 3CBKA 3KKUA 2B1NA 2DCCA 4FK5A 3V6CA 2FRAA 3CH3X 1CVZA 1ITOA 1MDWA 3IOQA 8PCHA 2FUDA 2E03A 1AYUA 1QXPA 2DJFA 1M6DA 3BWKA 2FQ9A 5CHVA 1CPJA 2GFOA 4P6EA 1CS8A 4XR7A 3H89A 3S3QA 1XKGA 2DZZA 4CDCB 3BPMA 2XU1A 5FPWA 2CIOA 2FT2A 9PAPA 2HH5A 1MEGA 1THEA 3RVVA 3D6SA 3K24A 3LXSA 1NLJA 5JA7A 3IEJA 2VHSA 3P5WA 1FH0A 2OULA 1AU2A 1TU6A 1YALA 4HWYA 4Q8GA 4W4UA 4X6HA 1O0EA 3KWBX 3QSDA 4I04A 1TL9A 2XU4A 2P7UA 4QRXA 1GECE 3QJ3A 1PADA 4YYUA 3S3RA 2DC8A 4YYRA 3BPFA 1U9QX 4X6JA 3OVZA 4G54A 2JQGR 1AYVA 3BCNA 2PNSA 4DMXA 1BQIA 3PDFA 6PADA 4YYQA 2P0RA 1F2AA 1F2BA 3DF0A 4CZWA 1CB5A 3GCBA 3KWZA 1CJLA 4PP1A 2IBIA 2HD5A 4PP2E 4QRGA 7PCKA 2YJ2A 2G6DA 2NQIA 2WBFX 5CVMA 1YT7A 3M99A 2VHFA 4YYSA 1GLOA 4BS5A 1PCIA 4CDDA 1IWDA 2NQDB 4WA6A 1AYWA 4QH6A 1K3BA 3P5XA 4K7CA 3MHSA 3IHPA 5A24A 4I05A 1NPZA 3F5VA 1KHPA 1DEUA 2GHUA 1MEMA 3K9MA 4PI3A
chains in the Genus database with same CATH superfamily
1JQPA 3S5VA 3VU1A 1SWEA 5IRUA 1EWOA 1VWGB 1N9MA 3EW1A 1RXKA 2HMBA 1DF3A 1I06A 1D2UA 3VG4A 3EC5A 3OVXA 1S2PA 3AEHA 1SWDA 2G8CO 1PPPA 4PSQA 3RKGA 3LFYA 1QFVA 1ZNHA 1OEJA 3CBSA 5H9KA 4GUAA 1CTEA 4TQ2A 3E9SA 2OY5O 3IFUA 3VHHA 1ICNA 2X56A 3LHNA 1DZJA 1S7DA 2DCBA 4CDEB 3RVWA 2RTJA 5HCCC 4YYVA 2YG2A 4YGHA 1QQSA 1Y4HA 3ZZVA 5FQ6E 4GK9A 2OY1O 4BSQA 5F6ZA 4TKHA 5EDCA 4YKMA 4IAWA 1PXVA 1SWHA 3RE6A 1LIDA 2CB5A 1GX8A 2QO5A 3QT4A 3NHEA 4YVBA 1YWDA 4QRLA 5BVTA 1I4UA 2R9OA 1NGLA 3KFGA 3OQCA 3PSEA 1K24A 3RY1A 5EF4A 4YBPA 1B0OA 4AXLA 5J94A 1HQQA 1YVBA 4HPCA 4GKCA 3SLJA 4ARHA 5LJGA 1VWLB 3USVA 3D97A 4N79A 1W5RA 3EMMA 2C4IA 1GXAA 3RWXA 1ICMA 4O49A 3WJGA 2RTQB 2DC6A 3FEPA 3KFIA 4QGXA 1POPA 5D47A 3VE1A 5K06A 3N3KA 2R9CA 2P86A 4GDZA 2R9MA 2AUXA 1K3BB 4XUIA 5K16A 3FW5A 1SXWA 5CE4A 2OFRX 1Y55X 3ERVA 2K62A 1SWLA 4AYHA 4GGZA 5F7GA 2RTCB 2DJGB 5DG4A 1KQWA 3F8AA 4CPEA 2O6XA 1SY2A 5JZEA 3WVMA 2NNEA 2BTWB 2H7JA 4KC7A 2W2BA 1RSUB 2XU3A 3FA9A 3TZSA 1PM1X 1HXLA 4XMEA 2XKLA 4QYNA 4Q8HA 1ADLA 1JV4A 3B2KA 1A3YA 1CJ5A 5LJEA 1X89A 5D4AA 1OSPO 3O1GA 3NBXX 4EQAC 1SWTA 2WPUA 1ICFA 1JYDA 4PT5A 5FFHA 4RF0A 1BP4A 1YP7A 2J7QC 1GCBA 2G7BA 4RKXA 1FENA 1O1UA 4MVLA 5EEEA 1LNMA 2DJFB 3ZW1A 1CBRA 1F2CA 1KFXL 1P6PA 4QBBA 1KZWA 4YFQA 4BCSA 5AJBA 2IPPB 5HZQA 5CVOB 3FA8A 4PADA 2GTLO 3DTQA 5D48A 2JU8A 4DMYA 3B2JA 4ORWA 3FEKA 1SP4B 4KCAA 1VWFB 4P6GA 1U0XA 1SWJA 4M7MA 4Y0QA 2BTWA 4CV7A 4XMDA 3KX1A 4GGRA 3KFQA 4AZOA 4YH0A 1RLBE 1EW3A 4I60A 2IZEB 4BOEA 1QOLA 3PK2A 1Q6KA 3U8EA 5LJHA 2FKJA 3UEWA 2JOZA 3DSZA 2L68A 4PJ2A 4IB9A 3LTWA 3P6FA 2NNDA 5HA0A 1N0SA 2HZRA 4BBOA 3KKUA 2B1NA 2WEWA 3CH3X 1GX9A 3IOQA 1SXUA 5HCDC 3PH6A 5HWZA 1QXPA 2BU3A 1AYUA 2DJFA 3BWKA 2KW1A 4KC8A 1U18A 5CHVA 4O4SA 1TOUA 5H9NA 5KO3A 3KZAA 3MTVA 4WHIA 1X8OA 1XKGA 5F1EA 2OL7A 2OZQA 4YMYA 1JBHA 2XU1A 5FPWA 2CIOA 9PAPA 4NYQA 4GRJA 4YFPA 1MEGA 1THEA 3C0RA 2IZLB 1E00A 2P8GA 3RDMA 1VWDB 3WZOA 5JA7A 2KTDA 2JU3A 1FH0A 2MHDA 2OFAA 2GJ5A 1YALA 1SWSA 4AZQA 3KWBX 3QSDA 1TL9A 2XU4A 2RTBB 3RDUA 4QRXA 3EM0A 3RZYA 2GTLN 1PADA 4YYUA 3VE2A 2DC8A 3BPFA 1Y53X 3AKMA 5H8TA 4ORRA 4G54A 4O4UA 1G74A 2JQGR 4Z2PA 2RQ0A 3BCNA 5B3MO 1BQIA 1T0VA 4NP1A 6PADA 1LIBA 5AEOA 1QY1A 1YWBA 3KWZA 4L3RA 4COTA 1ERXA 4TLJA 2CZUA 2RTMA 1SRFA 3TF6A 1SLFB 3O22A 1OBUA 1HQPA 4Y0SA 1LIEA 1DZKA 4JGLA 1ACDA 1FDQA 3L4RA 4IBAA 3RDOA 5L8OA 1OBPA 1JMZA 4CDDA 4M6SA 1FE3A 2NNQA 4QNIA 4NLIA 1Y9LA 5L8NA 3T1DA 4ID2A 5EZ2A 4ML7B 1N4JA 3BBAA 2RTDB 2J7QA 2ACPX 1DEUA 1MK5A 1LCVA 5EZSA 3K9MA 4PI3A 1O8VA 2BS5A 3RBYA 4GU8A 1GT4A 3NR3A 1KQXA 4OS8A 4D8EA 1B4MA 3PQUA 3S5XA 3I17A 2OFBA 1LDOA 1AU4A 3IV2A 1HMTA 2IZGB 5EPQA 1MS6A 1BGOA 1HY2A 5HBSA 4NV8A 3I06A 1JZUA 1SRHA 1ZNDA 1SWOA 3T2XA 1U9WA 3MJ5A 1SWBA 2PREA 2AF5A 1E5PA 1TW4A 3BS2A 1Y52X 2LA7A 4GUZA 3PRPA 5CHKA 1LKEA 1ML7A 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 2MJIA 1JJUA 3G7XA 1MEPA 1HN2A 2F09A 1BRPA 4I3CA 1X8UA 2RCQA 3BU9A 4WBKA 1AB0A 3RY2A 2Y6EA 3CH2X 2A5CA 1PPNA 1SNKA 5IRWA 4NNSA 2PBHA 2IFBA 3PNRA 1PPDA 3AI8A 2ARYA 2BDZA 4BJ8A 3MM0A 1I05A 1LDQA 2GH7A 3IMAA 2BSZA 3ZW0B 3WJCA 1VWMB 4ZR2A 1SY0A 1MOYA 1XCAA 5HA1A 4YGZA 3HOLA 4AZNA 2AMMX 5KIDA 1QG5A 4YGGA 3P6EA 2E00A 1QFTA 4ZJ0A 3K8UA 3W30A 3RE5A 4EEJA 2RTOB 4MM3B 1Y0GA 4FBVA 5H9AA 4QZTA 2DC7A 2AT6X 2G79A 2JMBA 2FO5A 1TXLA 1ZNKA 4HPAA 2M4LA 3APWA 2DCDA 3HK1A 4I6SA 4RY2A 1AVEA 3H8BA 3SOTA 3WJFA 2Q39A 2DC9A 2FTDA 3BY4A 4FBRA 5HZ8A 1SREA 1TLOA 3TGAA 3NP1A 4TKBA 2FRQA 2KTSA 1FEMA 2HHNA 3BLGA 1U5IA 4YDBA 3O0UA 4IABA 4NW4A 1IKJA 1EF7A 1VWCB 2G7YA 4GH7A 3SAOA 3EBKA 5JH3A 5B5GA 2I5ZO 3STKA 3SZIA 1SWQA 1GT5A 2G8JA 2XU5A 4D6BA 4O4XA 2JU7A 5B11O 1YK7A 2ZSCA 4Y0PA 1I78A 1E2TA 4MZOA 3NADA 3S60A 3FENA 1QABE 2A0AA 3FLLA 2R6NA 2GTFX 1SXXA 2IZKA 3ZUAA 3TRKA 2OFMX 1VWNB 4FIPA 1S44A 2FGSA 2CM9A 2QM9A 1VPRA 3SZJA 2MM3A 3WOVA 2BHVA 1YK8A 1SY3A 4TJZA 4OMXA 3N4CA 1OPBA 2G5LA 4CSBA 1HBPA 2HLVA 1BJ7A 5LJKA 4BOUA 5F02A 5EGWA 2BDLA 1DFVA 2A2UA 3ZW1B 1KT7A 2Q2MA 3KSEA 3F75A 4REZA 1T8VA 2FHLA 5E6JA 3UAQA 2OVAA 4BX7A 3SZHA 1LELA 1VWQB 3WZNA 2AYNA 3N3GA 4OELA 5IO6A 4N7CA 3MVFA 4CDCA 2ZAGA 3HWEA 1KGLA 3D9WA 3MG5A 4HWMA 2IZBA 4QGVA 3I3TA 1SLGB 5B29A 4FK5A 4B55A 3ZWEA 3S26A 1MDWA 3ZW0A 2FUDA 3KQ0A 3VG6A 1U17A 3RNVA 1I9HA 1PVJA 1AVDA 2GFOA 4ALOA 3APXA 4P6EA 3TMPA 3BY0A 5IRAA 4INNA 3BPMA 4AZMA 1UREA 1KT5A 4ORYA 3VG5A 3ZI8A 2FT2A 3OJYC 1SY1A 2X8SA 4UU3A 4A8ZA 2RTHB 5F6BA 4O4OA 2WQ9A 3FELA 2L5PA 5H9LA 4GE1A 2ZAIA 2OULA 1TU6A 1R0UA 4Q8GA 1QWDA 5JR8A 2OY7A 2CBSA 4I04A 3SLTA 3U03A 1BSQA 1YUPA 4Z6JA 4BX5A 4Z2VA 3S3RA 1HXZA 1VWBB 1BWYA 4HXDB 3D96A 2X8FA 3MP2A 3FDCA 4K19A 4ZTBA 4X6JA 1SWGA 1G85A 2AT3X 1E06A 2A5BA 2GTLM 3FIDA 4C5PA 3VHMA 3WJBA 1F2AA 2OL8O 1G5WA 3NQKA 2K23A 3PEDA 4QRGA 3P02A 5HTDA 1MX8A 2E4JA 4GNWA 2NQIA 1GX3A 4LQZA 4Y59A 1YT7A 3M99A 4MIRA 2VHFA 3WZPA 1VWOB 3JQOA 4YYSA 5BVQA 1GLOA 1OPAA 1YZBA 2A8GA 4ON1A 3CR6A 4NNTA 4NLJA 1VWAB 3NX1A 3FA6A 4QH6A 3PH5A 1KT3A 3H3IA 4D8IA 3OD9A 4K7CA 3NQ3A 4I05A 1KXOA 3F5VA 2RTEB 2WR6A 1MEMA 3GE2A 3KFFA 3WXQA 4TKJA 3IA8A 5F2BA 1GKAB 3WJDA 1VYOA 2ACOA 1DC9A 2OYBO 4FJCA 4YCEA 1NQMA 1QMYA 1O1VA 1IFBA 1BEBA 3FA7A 3E1ZB 1PE6A 1B8EA 3LV4A 1QDQA 4CPHB 4N8WA 3I0AA 2E02A 1VWKB 1KT6A 3PRMA 1U9VA 1RBPA 2RTPB 4MSXA 4ODDA 1STFE 5BYPA 4XMFA 3VPJE 2DZYA 2RTIB 4AW8A 4RF1A 3AUMO 4MZSA 4WFVA 4Y0RA 2JQFR 1X9YA 2Y5BA 2Y3EA 4GETA 4LKPA 3FYFA 3VGWA 1RXJA 2ATOA 2FKGA 3UEUA 2AIMA 4D6AA 2Y3FA 1XKIA 1ZCMA 1STRB 4BQVA 1AU0A 2W2FA 1VYFA 1KL4A 3CWKA 1ME4A 1LCZA 2NQGA 4Y5DA 2AYOA 1UYNX 1AU3A 3EYCA 4BGFA 1EPBA 1TVQA 2X46A 5DPQA 1HUCB 3UEXA 2YJ9A 1ATKA 1SXYA 4RUUA 1VWHB 1ZIVA 4I07A 2LB6A 4MVIA 2KD2A 3OF8A 2HXZA 4A1HA 1H91A 3WXEA 4HPDA 3ELXA 4JO6A 3F6ZB 3H8CA 1PEEA 2BLGA 4N4ZA 1E02A 2WQAE 3P5VA 5L3YA 5JD2A 1X71A 3P6GA 3NQ9A 3SLOA 2KT4B 1UKFA 3PBHA 4OEMA 2RTFB 4QYPA 4ZHDA 1GMYA 2G78A 1CQDA 2RTLA 3ELZA 2RD7C 3WZQA 3D4RA 5FENA 4YVAA 3BRNA 4OS3A 5EDBA 1UYOX 1AIMA 1T68X 3BU1A 2IZCB 2DCAA 1L6MA 1VWPB 2F7DA 1MHWA 1CV8A 2AVWA 3APVA 3C9EA 2GC9A 1KL5A 1SLDB 4Z28A 1LUQA 1SLEB 1PIPA 2AH7X 4BOQA 4ZH9A 3P5UA 5FQ7E 2FR2A 4WFUA 5B10O 1BM5A 1MVGA 4W5BA 4DQ3A 1SRJA 1CBQA 1GKAA 2MWHA 4U8UM 2AL0X 1RAVA 1NBXA 2BC3A 4W5CA 4AZPA 1EIOA 3CBJA 2UYWA 3P24A 5LJCA 2ASNX 3C78X 4BX7B 1DZMA 3QKGA 1EPAA 3EBWA 3MTNA 1IIUA 2OVDA 3STNA 3TNXA 1EI5A 3B79A 5IO7A 4P16A 3ZW2A 3MBTA 3T6FA 4YCHA 3HD3A 3OISA 3Q6LA 5HZ9A 4YYWA 2HYSA 3B2IA 2YMSA 1SWUA 4U8UN 1MDCA 3KVNA 5C0NA 4CPFA 3U0DA 2R9NA 2QCBA 2FWVA 5BVSA 3MHHA 1VSNA 3UEVA 1VJVA 1QY0A 2AS8A 2AUZA 2RA6A 2IZFB 2AVIA 5CSEA 3FMZA 3P6CA 1SA8A 1AVGI 1NP4A 2CBRA 4DNEA 4BOPA 2RTAA 2X8TA 3O19A 5HZ6A 4O3WA 3FR4A 4ES7A 1CS8A 4XR7A 1CBSA 4CDCB 2VFCA 3TGCA 2O62A 4YBUA 2PY1A 3EW2A 4ORXA 2FHNX 1EQDA 4BX5B 2HH5A 5AJCA 3RVVA 2A13A 1PTSA 3K24A 4O3YA 4OKAA 5LKFA 2DM5A 3P5WA 1LICA 3CMPA 4HWYA 4W4UA 2N93A 1O0EA 2OVSA 1DZPA 1ZNEA 2P7UA 2FLJA 1DF8A 3BX7A 2AT0X 4RUNA 1LIFA 1Z24A 1DV9A 3JSQA 4YYRA 4HFOA 2IZDB 3HPEA 2AKQA 1U9QX 2R56A 3OVZA 3BB7A 2LBVA 4IAXA 1EALA 2A2GA 4DMXA 1YWAA 1STSB 2FS6A 2P0RA 1F2BA 1LFOA 4EDEA 2X4MA 5EZQA 1CB5A 1N9YA 1HBQA 3FW4A 4PP1A 1SRIA 2X34A 1SWFA 4PP2E 3PHWA 3T6LA 7PCKA 4BX6B 2AT8X 5F58A 5KICA 4ZGUA 1KL3A 2LBAA 5CVMA 4QGWA 4GJSA 3HWFA 3Q34A 2FRSA 4BS5A 1PCIA 5B5FA 5FAZA 1RSTB 2RCTA 5LKEA 1EXSA 3F9DA 2XSTA 2VFBA 1NP1A 2NQDB 3QQ2A 4I9RA 4ZHHA 2WEXA 1LPJA 1FTPA 1K3BA 5CYBA 1OEKA 1GT1A 2WUTA 2IZAA 4A5UA 4CPHA 4MISA 4IP3A 1BSYA 2Q4NA 2GHUA 4YFRA 4JHQA 4GDAA 1A18A 4KIIA 3KFHA 2MF6A 4XMGA 3ZUIA 1LF7A 2L67A 3FR5A 2FR3A 2R73A 1BRQA 5K67A 1ZNLA 3IFBA 1EIIA 2OF8A 4KT5A 3H6SA 4LZVA 4U9CA 5HTEA 3BSZE 4BPVA 2QO4A 1GGLA 4IB6A 2JTCA 3NX2A 1GM6A 4KLBA 4ZUXU 1VWRB 4ZFXA 4NYRA 4OS0A 1X8NA 4CDEA 5KHPA 4BS6A 3X00A 2QO6A 4MI7A 1Y9TA 3HWNA 1NQNA 1SWPA 3VG7A 4MVEA 1MM9A 3PHXA 4A60A 2F1GA 2IZHB 1CRBA 4QAEA 4BQUA 4O3ZA 2X55A 1D3SA 3KW9A 1NL6A 2LKKA 2FTBA 2JN3A 3RDSA 1KHQA 3PP6A 3CBCA 1A2DA 5LJDA 2Z4HA 2RN4A 3WBGA 1NB5A 2AU1A 4YV8A 2QMIA 4ZHGA 4YKOA 1NC9A 3E3CA 5LJBA 3H7DA 3P6DA 2VDFA 1ME3A 1AECA 1F29A 5PADA 2R9FA 3FR2A 2NQAA 3WXFA 1X8QA 3OBLA 3PW3A 3HOEA 3APUA 4IB7A 1MUPA 1KT4A 4CDFA 1NQCA 1NDJA 4U46A 3RDXA 2YJCA 3O2YA 2C1QA 4IRWA 2FE8A 2CAMA 3B2LA 1BY8A 5IO5A 3CKFA 4ZHFA 2X32A 4IB8A 3RVXA 1WUBA 1PBHA 1IKEA 2LFOA 4Z27A 3VG3A 1AQBA 1G7NA 2OZ2A 3BOWA 2OL6O 1CSBB 1WBIA 5CHTA 3VHIA 5HAEA 1MIRA 4OVZA 1AELA 3GAQA 2FYEA 3WXGA 4EFGA 3V6EA 1SRGA 2AT5X 1EWMA 2HZQA 3HWDA 1KFFA 2AGAA 5B27A 2UZ2A 4XZXA 3B2HA 3PECA 3CQRA 4MEEA 3RDQA 4AXMA 4BOZA 1FJ1E 4EXZA 1W4TA 4A1YA 3W31A 2JRIA 4ALBA 1BSOA 1RXHA 2RTKA 3U9PC 1PMPA 3RSWA 3PHUA 4ZH6A 4RNAA 2WWPA 4AZRA 4GGTA 4CDFB 4CK4A 4ORUA 2A3FX 3JS1A 1ZNGA 2FS7A 2B1MA 2POAA 2EU7X 4CPIA 1LCWA 3IUTA 1MX7A 3B21A 1EWLA 4IMNA 2F73A 3HHIA 3D95A 3MX7A 2DJGA 4MVKA 3OF9A 2G8EA 4QRVA 4O3XB 4UU2A 3VG2A 1YIVA 2IZIA 3K3LA 1NB3A 3PT2A 2OVEA 1KXRA 1BLRA 3STMX 4GD9A 1BBPA 1PPOA 1B56A 3V8UA 3HHAA 4I95A 5HCEC 1KFUL 3O65A 1A6RA 4XMHA 1KOIA 4DCBA 2OF9A 2YJBA 4WURA 1SWKA 1EWPA 5CVNB 2JW1A 4ORSA 1JJXA 2YJ8A 1U9XA 3P6HA 2Y32A 2ALLX 3NPOA 2DOSA 4CDDB 4X6IA 2Z84A 1SMPI 3AKNA 4KH8A 1KZXA 1DF0A 2PI3O 1Y08A 2FT9A 1I04A 2Q9SA 2BS6A 2PADA 3OE3A 2QOSC 4U3QA 1ERBA 2E01A 5L8IA 4M0WA 2ACTA 2BT9A 4EKVA 2C1SA 5D8JA 3ZUOA 4FQBB 3BDRA 5EEDA 2RTGB 4ZHCA 1VYGA 3WYPA 2ANSA 3CBKA 3ZQ3A 2CZTA 2DCCA 3V6CA 2FRAA 1CVZA 1TOWA 1ITOA 2JGSA 8PCHA 1OEEA 2I5VO 4LKTA 1JJJA 2E03A 1FELA 3HTYA 4HPBA 4D8BA 1QY2A 2RTRB 1M6DA 2MO5A 2FQ9A 1VWEB 5IXGA 2UZJA 1CPJA 1JYJA 2WSJA 3H89A 3S3QA 3C77X 4R3DA 3HWGA 4QQ1A 5FQ8E 2DZZA 2HKDA 1YWCA 1CBIA 2RTNB 1HMRA 3FIQA 3CKGA 4GZVA 1HMSA 1ZRYA 1GT3A 3BX8A 1IJ8A 1IW2A 4XMCA 3D6SA 4IUMA 3LXSA 4GJVA 4I3DA 3PPTA 1NLJA 3TGBA 3IEJA 2VHSA 4OW0A 1DKIA 2Q2PA 4OVZB 1AU2A 4Z2OA 4ZGFA 2OY8A 4QZUA 1SWAA 4IMOA 4X6HA 5K68A 1EUOA 4U8UO 2HWKA 3T2WA 1JMXA 3PQSA 1GECE 3QJ3A 4BOSA 4LZUA 1YP6A 4BX6A 4BVMA 4FBOA 1AYVA 2PNSA 3PDFA 4L1NA 2QOMA 1SWRA 4I3BA 4YYQA 1X8PA 3DF0A 4CZWA 3GCBA 1N43A 1A57A 1ALBA 1CJLA 2IBIA 4GNYA 3WJEA 2HD5A 1JIWI 4OMWA 1N7YA 2YJ2A 1SWNA 2G6DA 1UZ2X 2WBFX 1VWIB 4O9SA 1VWJB 3WYQA 3ZNHA 3N91A 4TNNA 1SWCA 2L9CA 5HZ5A 1IWDA 2F01A 2NP1A 2R74A 3C76X 1IFCA 4YDAA 3CQNA 4WA6A 2W2AA 1AYWA 1STPA 5B2AO 1OBQA 3P5XA 4JNJA 4ZCBA 3MHSA 4R0BA 3IHPA 2HNXA 5A24A 1NPZA 1W6FA 5AQ6A 1KHPA 4N7DA 4DQ4A 1PBYA 2CM4A 2X45A 1PBOA 4NV7A 2Z4IA 4I9SA 2IZJA 5D45A 4FGIB
chains in the Genus database with same CATH topology
1JQPA 4FJCA 1QMYA 1EWOA 3E1ZB 1AU4A 1PE6A 3IV2A 3H6SA 1QDQA 4BPVA 1MS6A 4N8WA 1BGOA 2E02A 4KLBA 4ZUXU 4NV8A 3OVXA 3I06A 4CDEA 4BS6A 1U9VA 1PPPA 4MSXA 1U9WA 3HWNA 1STFE 2PREA 3LFYA 2F1GA 2DZYA 4GUZA 1CTEA 4MZSA 2JQFR 2OP3A 1S4VA 2C0YA 3BC3A 3MORA 1X9YA 3KW9A 1NL6A 2Y5BA 1KHQA 2DCBA 4CDEB 3RVWA 2Y6EA 3CH2X 1PPNA 1SNKA 4YYVA 2ATOA 1NB5A 2AU1A 2PBHA 1Y4HA 4YV8A 2AIMA 3PNRA 1PPDA 4BSQA 1ZCMA 3AI8A 2ARYA 2BDZA 1PXVA 3H7DA 4BQVA 3IMAA 1AU0A 2CB5A 2BSZA 1ME3A 1ME4A 1AECA 1F29A 5PADA 2R9FA 2NQGA 3QT4A 2NQAA 2AYOA 3NHEA 3WXFA 1AU3A 4BGFA 3PW3A 2R9OA 4CDFA 1NQCA 2E00A 5EF4A 1HUCB 3K8UA 2YJCA 4AXLA 5J94A 1BY8A 2YJ9A 1ATKA 3RVXA 1YVBA 1PBHA 1ZIVA 4I07A 2DC7A 3OF8A 2HXZA 2FO5A 2OZ2A 3BOWA 3WXEA 3USVA 1CSBB 5CHTA 2DCDA 1MIRA 4N79A 1W5RA 3H8CA 2FYEA 3WXGA 4N4ZA 3V6EA 4RY2A 3H8BA 2DC6A 1EWMA 3P5VA 1POPA 2DC9A 2FTDA 3N3KA 2R9CA 2P86A 3PBHA 1TLOA 2R9MA 2AUXA 4OEMA 1K3BB 4XUIA 5K16A 4AXMA 1GMYA 2FRQA 2HHNA 1W4TA 3ERVA 1CQDA 1U5IA 3O0UA 2DJGB 1EF7A 2G7YA 5JH3A 2O6XA 4YVAA 4CDFB 2B1MA 2H7JA 1AIMA 2G8JA 2XU5A 2DCAA 2XU3A 3IUTA 2F7DA 1MHWA 1CV8A 1YK7A 1EWLA 2AVWA 3C9EA 4Q8HA 3HHIA 1E2TA 2DJGA 4MZOA 3OF9A 1PIPA 3O1GA 2G8EA 4QRVA 3P5UA 2R6NA 1NB3A 4W5BA 3ZUAA 1KXRA 4FIPA 1ICFA 1BP4A 1GCBA 4W5CA 1PPOA 2DJFB 3HHAA 1KFUL 1YK8A 3CBJA 1F2CA 1A6RA 1KFXL 4QBBA 3N4CA 2YJBA 1EWPA 5CVNB 2IPPB 2YJ8A 5CVOB 4PADA 1U9XA 5F02A 5EGWA 3MTNA 4DMYA 2BDLA 4CDDB 4X6IA 1SP4B 3TNXA 3B79A 4P6GA 1DF0A 1Y08A 2PADA 3HD3A 3OISA 3KSEA 3F75A 3KX1A 2E01A 4YYWA 3KFQA 2ACTA 2AYNA 3N3GA 4OELA 2R9NA 1QOLA 3U8EA 1Q6KA 3MHHA 1VSNA 1VJVA 4CDCA 2AS8A 2AUZA 3D9WA 3LTWA 3I3TA 3CBKA 3KKUA 2B1NA 2DCCA 4FK5A 3V6CA 4B55A 2FRAA 3CH3X 1CVZA 1ITOA 1MDWA 3IOQA 8PCHA 2FUDA 2E03A 1AYUA 1QXPA 2DJFA 1M6DA 3BWKA 2FQ9A 5CHVA 1CPJA 2GFOA 4P6EA 1CS8A 4XR7A 3H89A 3S3QA 1XKGA 2DZZA 4CDCB 2VFCA 3BPMA 2XU1A 5FPWA 2CIOA 2FT2A 9PAPA 2HH5A 1MEGA 1THEA 3RVVA 3D6SA 3K24A 3LXSA 1NLJA 5JA7A 3IEJA 2VHSA 3P5WA 1FH0A 2OULA 1AU2A 1TU6A 1YALA 4HWYA 4Q8GA 4W4UA 4X6HA 1O0EA 3KWBX 3QSDA 4I04A 1TL9A 2XU4A 2P7UA 4QRXA 1GECE 3QJ3A 1PADA 4YYUA 3S3RA 2DC8A 4YYRA 3BPFA 1U9QX 4X6JA 3OVZA 4G54A 2JQGR 1AYVA 3BCNA 2PNSA 4DMXA 1BQIA 3PDFA 6PADA 4YYQA 4C5PA 2P0RA 1F2AA 1F2BA 3DF0A 4CZWA 1CB5A 3GCBA 3KWZA 1CJLA 4PP1A 2IBIA 2HD5A 4PP2E 4QRGA 7PCKA 2YJ2A 2G6DA 2NQIA 1GX3A 2WBFX 5CVMA 1YT7A 3M99A 2VHFA 4YYSA 1GLOA 4BS5A 1PCIA 4CDDA 1IWDA 2VFBA 2NQDB 4WA6A 1AYWA 4QH6A 1K3BA 3P5XA 4K7CA 3MHSA 3IHPA 5A24A 4I05A 1NPZA 1W6FA 3F5VA 1KHPA 1DEUA 2GHUA 1MEMA 3K9MA 4PI3A 4NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQP A;  4FJC A;  1QMY A;  1EWO A;  3E1Z B;  1AU4 A;  1PE6 A;  3IV2 A;  3H6S A;  1QDQ A;  4BPV A;  1MS6 A;  4N8W A;  1BGO A;  2E02 A;  4KLB A;  4ZUX U;  3OVX A;  3I06 A;  4CDE A;  4BS6 A;  1U9V A;  1PPP A;  4MSX A;  1U9W A;  3HWN A;  1STF E;  2PRE A;  3LFY A;  2F1G A;  2DZY A;  1CTE A;  4MZS A;  2JQF R;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  1X9Y A;  3KW9 A;  1NL6 A;  2Y5B A;  1KHQ A;  2DCB A;  4CDE B;  3RVW A;  2Y6E A;  3CH2 X;  1PPN A;  1SNK A;  4YYV A;  2ATO A;  1NB5 A;  2AU1 A;  2PBH A;  1Y4H A;  4YV8 A;  2AIM A;  3PNR A;  1PPD A;  4BSQ A;  1ZCM A;  3AI8 A;  2ARY A;  2BDZ A;  1PXV A;  3H7D A;  4BQV A;  3IMA A;  1AU0 A;  2CB5 A;  1ME3 A;  1ME4 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  2NQG A;  3QT4 A;  2NQA A;  2AYO A;  3NHE A;  3WXF A;  1AU3 A;  3PW3 A;  2R9O A;  4CDF A;  1NQC A;  2E00 A;  5EF4 A;  1HUC B;  3K8U A;  2YJC A;  4AXL A;  5J94 A;  1BY8 A;  2YJ9 A;  1ATK A;  3RVX A;  1YVB A;  1PBH A;  1ZIV A;  4I07 A;  2DC7 A;  3OF8 A;  2HXZ A;  2FO5 A;  2OZ2 A;  3BOW A;  3WXE A;  3USV A;  1CSB B;  5CHT A;  2DCD A;  1MIR A;  4N79 A;  3H8C A;  2FYE A;  3WXG A;  4N4Z A;  3V6E A;  4RY2 A;  3H8B A;  2DC6 A;  1EWM A;  3P5V A;  1POP A;  2DC9 A;  2FTD A;  3N3K A;  2R9C A;  2P86 A;  3PBH A;  1TLO A;  2R9M A;  2AUX A;  4OEM A;  1K3B B;  4XUI A;  5K16 A;  4AXM A;  1GMY A;  2FRQ A;  2HHN A;  3ERV A;  1CQD A;  1U5I A;  3O0U A;  2DJG B;  1EF7 A;  2G7Y A;  5JH3 A;  2O6X A;  4YVA A;  4CDF B;  2B1M A;  2H7J A;  1AIM A;  2G8J A;  2XU5 A;  2DCA A;  2XU3 A;  3IUT A;  2F7D A;  1MHW A;  1CV8 A;  1YK7 A;  1EWL A;  2AVW A;  3C9E A;  4Q8H A;  3HHI A;  2DJG A;  4MZO A;  3OF9 A;  1PIP A;  3O1G A;  2G8E A;  4QRV A;  3P5U A;  2R6N A;  1NB3 A;  4W5B A;  3ZUA A;  1KXR A;  4FIP A;  1ICF A;  1BP4 A;  1GCB A;  4W5C A;  1PPO A;  2DJF B;  3HHA A;  1KFU L;  1YK8 A;  3CBJ A;  1F2C A;  1A6R A;  1KFX L;  4QBB A;  3N4C A;  2YJB A;  1EWP A;  5CVN B;  2IPP B;  2YJ8 A;  5CVO B;  4PAD A;  1U9X A;  5F02 A;  5EGW A;  3MTN A;  4DMY A;  2BDL A;  4CDD B;  4X6I A;  1SP4 B;  3TNX A;  3B79 A;  4P6G A;  1DF0 A;  1Y08 A;  2PAD A;  3HD3 A;  3OIS A;  3KSE A;  3F75 A;  3KX1 A;  2E01 A;  4YYW A;  3KFQ A;  2ACT A;  2AYN A;  3N3G A;  4OEL A;  2R9N A;  1QOL A;  3U8E A;  1Q6K A;  3MHH A;  1VSN A;  1VJV A;  4CDC A;  2AS8 A;  2AUZ A;  3I3T A;  3CBK A;  3KKU A;  2B1N A;  2DCC A;  4FK5 A;  3V6C A;  2FRA A;  3CH3 X;  1CVZ A;  1ITO A;  1MDW A;  3IOQ A;  8PCH A;  2FUD A;  2E03 A;  1AYU A;  1QXP A;  2DJF A;  1M6D A;  3BWK A;  2FQ9 A;  5CHV A;  1CPJ A;  2GFO A;  4P6E A;  1CS8 A;  4XR7 A;  3H89 A;  3S3Q A;  1XKG A;  2DZZ A;  4CDC B;  3BPM A;  2XU1 A;  5FPW A;  2CIO A;  2FT2 A;  9PAP A;  2HH5 A;  1MEG A;  1THE A;  3RVV A;  3D6S A;  3K24 A;  3LXS A;  1NLJ A;  5JA7 A;  3IEJ A;  2VHS A;  3P5W A;  1FH0 A;  2OUL A;  1AU2 A;  1TU6 A;  1YAL A;  4HWY A;  4Q8G A;  4W4U A;  4X6H A;  1O0E A;  3KWB X;  3QSD A;  4I04 A;  1TL9 A;  2XU4 A;  2P7U A;  4QRX A;  1GEC E;  3QJ3 A;  1PAD A;  4YYU A;  3S3R A;  2DC8 A;  4YYR A;  3BPF A;  1U9Q X;  4X6J A;  3OVZ A;  4G54 A;  2JQG R;  1AYV A;  3BCN A;  2PNS A;  4DMX A;  1BQI A;  3PDF A;  6PAD A;  4YYQ A;  2P0R A;  1F2A A;  1F2B A;  3DF0 A;  4CZW A;  1CB5 A;  3GCB A;  3KWZ A;  1CJL A;  4PP1 A;  2IBI A;  2HD5 A;  4PP2 E;  4QRG A;  7PCK A;  2YJ2 A;  2G6D A;  2NQI A;  2WBF X;  5CVM A;  1YT7 A;  3M99 A;  2VHF A;  4YYS A;  1GLO A;  4BS5 A;  1PCI A;  4CDD A;  1IWD A;  2NQD B;  4WA6 A;  1AYW A;  4QH6 A;  1K3B A;  3P5X A;  4K7C A;  3MHS A;  3IHP A;  5A24 A;  4I05 A;  1NPZ A;  3F5V A;  1KHP A;  1DEU A;  2GHU A;  1MEM A;  3K9M A;  4PI3 A; 
#chains in the Genus database with same CATH topology
 1JQP A;  3S5V A;  3VU1 A;  1SWE A;  5IRU A;  1EWO A;  1VWG B;  1N9M A;  3EW1 A;  1RXK A;  2HMB A;  1DF3 A;  1I06 A;  1D2U A;  3VG4 A;  3EC5 A;  3OVX A;  1S2P A;  3AEH A;  1SWD A;  2G8C O;  1PPP A;  4PSQ A;  3RKG A;  3LFY A;  1QFV A;  1ZNH A;  1OEJ A;  3CBS A;  5H9K A;  4GUA A;  1CTE A;  4TQ2 A;  3E9S A;  2OY5 O;  3IFU A;  3VHH A;  1ICN A;  2X56 A;  3LHN A;  1DZJ A;  1S7D A;  2DCB A;  4CDE B;  3RVW A;  2RTJ A;  5HCC C;  4YYV A;  2YG2 A;  4YGH A;  1QQS A;  1Y4H A;  3ZZV A;  5FQ6 E;  4GK9 A;  2OY1 O;  4BSQ A;  5F6Z A;  4TKH A;  5EDC A;  4YKM A;  4IAW A;  1PXV A;  1SWH A;  3RE6 A;  1LID A;  2CB5 A;  1GX8 A;  2QO5 A;  3QT4 A;  3NHE A;  4YVB A;  1YWD A;  4QRL A;  5BVT A;  1I4U A;  2R9O A;  1NGL A;  3KFG A;  3OQC A;  3PSE A;  1K24 A;  3RY1 A;  5EF4 A;  4YBP A;  1B0O A;  4AXL A;  5J94 A;  1HQQ A;  1YVB A;  4HPC A;  4GKC A;  3SLJ A;  4ARH A;  5LJG A;  1VWL B;  3USV A;  3D97 A;  4N79 A;  1W5R A;  3EMM A;  2C4I A;  1GXA A;  3RWX A;  1ICM A;  4O49 A;  3WJG A;  2RTQ B;  2DC6 A;  3FEP A;  3KFI A;  4QGX A;  1POP A;  5D47 A;  3VE1 A;  5K06 A;  3N3K A;  2R9C A;  2P86 A;  4GDZ A;  2R9M A;  2AUX A;  1K3B B;  4XUI A;  5K16 A;  3FW5 A;  1SXW A;  5CE4 A;  2OFR X;  1Y55 X;  3ERV A;  2K62 A;  1SWL A;  4AYH A;  4GGZ A;  5F7G A;  2RTC B;  2DJG B;  5DG4 A;  1KQW A;  3F8A A;  4CPE A;  2O6X A;  1SY2 A;  5JZE A;  3WVM A;  2NNE A;  2BTW B;  2H7J A;  4KC7 A;  2W2B A;  1RSU B;  2XU3 A;  3FA9 A;  3TZS A;  1PM1 X;  1HXL A;  4XME A;  2XKL A;  4QYN A;  4Q8H A;  1ADL A;  1JV4 A;  3B2K A;  1A3Y A;  1CJ5 A;  5LJE A;  1X89 A;  5D4A A;  1OSP O;  3O1G A;  3NBX X;  4EQA C;  1SWT A;  2WPU A;  1ICF A;  1JYD A;  4PT5 A;  5FFH A;  4RF0 A;  1BP4 A;  1YP7 A;  2J7Q C;  1GCB A;  2G7B A;  4RKX A;  1FEN A;  1O1U A;  4MVL A;  5EEE A;  1LNM A;  2DJF B;  3ZW1 A;  1CBR A;  1F2C A;  1KFX L;  1P6P A;  4QBB A;  1KZW A;  4YFQ A;  4BCS A;  5AJB A;  2IPP B;  5HZQ A;  5CVO B;  3FA8 A;  4PAD A;  2GTL O;  3DTQ A;  5D48 A;  2JU8 A;  4DMY A;  3B2J A;  4ORW A;  3FEK A;  1SP4 B;  4KCA A;  1VWF B;  4P6G A;  1U0X A;  1SWJ A;  4M7M A;  4Y0Q A;  2BTW A;  4CV7 A;  4XMD A;  3KX1 A;  4GGR A;  3KFQ A;  4AZO A;  4YH0 A;  1RLB E;  1EW3 A;  4I60 A;  2IZE B;  4BOE A;  1QOL A;  3PK2 A;  1Q6K A;  3U8E A;  5LJH A;  2FKJ A;  3UEW A;  2JOZ A;  3DSZ A;  2L68 A;  4PJ2 A;  4IB9 A;  3LTW A;  3P6F A;  2NND A;  5HA0 A;  1N0S A;  2HZR A;  4BBO A;  3KKU A;  2B1N A;  2WEW A;  3CH3 X;  1GX9 A;  3IOQ A;  1SXU A;  5HCD C;  3PH6 A;  5HWZ A;  1QXP A;  2BU3 A;  1AYU A;  2DJF A;  3BWK A;  2KW1 A;  4KC8 A;  1U18 A;  5CHV A;  4O4S A;  1TOU A;  5H9N A;  5KO3 A;  3KZA A;  3MTV A;  4WHI A;  1X8O A;  1XKG A;  5F1E A;  2OL7 A;  2OZQ A;  4YMY A;  1JBH A;  2XU1 A;  5FPW A;  2CIO A;  9PAP A;  4NYQ A;  4GRJ A;  4YFP A;  1MEG A;  1THE A;  3C0R A;  2IZL B;  1E00 A;  2P8G A;  3RDM A;  1VWD B;  3WZO A;  5JA7 A;  2KTD A;  2JU3 A;  1FH0 A;  2MHD A;  2OFA A;  2GJ5 A;  1YAL A;  1SWS A;  4AZQ A;  3KWB X;  3QSD A;  1TL9 A;  2XU4 A;  2RTB B;  3RDU A;  4QRX A;  3EM0 A;  3RZY A;  2GTL N;  1PAD A;  4YYU A;  3VE2 A;  2DC8 A;  3BPF A;  1Y53 X;  3AKM A;  5H8T A;  4ORR A;  4G54 A;  4O4U A;  1G74 A;  2JQG R;  4Z2P A;  2RQ0 A;  3BCN A;  5B3M O;  1BQI A;  1T0V A;  4NP1 A;  6PAD A;  1LIB A;  5AEO A;  1QY1 A;  1YWB A;  3KWZ A;  4L3R A;  4COT A;  1ERX A;  4TLJ A;  2CZU A;  2RTM A;  1SRF A;  3TF6 A;  1SLF B;  3O22 A;  1OBU A;  1HQP A;  4Y0S A;  1LIE A;  1DZK A;  4JGL A;  1ACD A;  1FDQ A;  3L4R A;  4IBA A;  3RDO A;  5L8O A;  1OBP A;  1JMZ A;  4CDD A;  4M6S A;  1FE3 A;  2NNQ A;  4QNI A;  4NLI A;  1Y9L A;  5L8N A;  3T1D A;  4ID2 A;  5EZ2 A;  4ML7 B;  1N4J A;  3BBA A;  2RTD B;  2J7Q A;  2ACP X;  1DEU A;  1MK5 A;  1LCV A;  5EZS A;  3K9M A;  4PI3 A;  1O8V A;  2BS5 A;  3RBY A;  4GU8 A;  1GT4 A;  3NR3 A;  1KQX A;  4OS8 A;  4D8E A;  1B4M A;  3PQU A;  3S5X A;  3I17 A;  2OFB A;  1LDO A;  1AU4 A;  3IV2 A;  1HMT A;  2IZG B;  5EPQ A;  1MS6 A;  1BGO A;  1HY2 A;  5HBS A;  4NV8 A;  3I06 A;  1JZU A;  1SRH A;  1ZND A;  1SWO A;  3T2X A;  1U9W A;  3MJ5 A;  1SWB A;  2PRE A;  2AF5 A;  1E5P A;  1TW4 A;  3BS2 A;  1Y52 X;  2LA7 A;  4GUZ A;  3PRP A;  5CHK A;  1LKE A;  1ML7 A;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  2MJI A;  1JJU A;  3G7X A;  1MEP A;  1HN2 A;  2F09 A;  1BRP A;  4I3C A;  1X8U A;  2RCQ A;  3BU9 A;  4WBK A;  1AB0 A;  3RY2 A;  2Y6E A;  3CH2 X;  2A5C A;  1PPN A;  1SNK A;  5IRW A;  4NNS A;  2PBH A;  2IFB A;  3PNR A;  1PPD A;  3AI8 A;  2ARY A;  2BDZ A;  4BJ8 A;  3MM0 A;  1I05 A;  1LDQ A;  2GH7 A;  3IMA A;  2BSZ A;  3ZW0 B;  3WJC A;  1VWM B;  4ZR2 A;  1SY0 A;  1MOY A;  1XCA A;  5HA1 A;  4YGZ A;  3HOL A;  4AZN A;  2AMM X;  5KID A;  1QG5 A;  4YGG A;  3P6E A;  2E00 A;  1QFT A;  4ZJ0 A;  3K8U A;  3W30 A;  3RE5 A;  4EEJ A;  2RTO B;  4MM3 B;  1Y0G A;  4FBV A;  5H9A A;  4QZT A;  2DC7 A;  2AT6 X;  2G79 A;  2JMB A;  2FO5 A;  1TXL A;  1ZNK A;  4HPA A;  2M4L A;  3APW A;  2DCD A;  3HK1 A;  4I6S A;  4RY2 A;  1AVE A;  3H8B A;  3SOT A;  3WJF A;  2Q39 A;  2DC9 A;  2FTD A;  3BY4 A;  4FBR A;  5HZ8 A;  1SRE A;  1TLO A;  3TGA A;  3NP1 A;  4TKB A;  2FRQ A;  2KTS A;  1FEM A;  2HHN A;  3BLG A;  1U5I A;  4YDB A;  3O0U A;  4IAB A;  4NW4 A;  1IKJ A;  1EF7 A;  1VWC B;  2G7Y A;  4GH7 A;  3SAO A;  3EBK A;  5JH3 A;  5B5G A;  2I5Z O;  3STK A;  3SZI A;  1SWQ A;  1GT5 A;  2G8J A;  2XU5 A;  4D6B A;  4O4X A;  2JU7 A;  5B11 O;  1YK7 A;  2ZSC A;  4Y0P A;  1I78 A;  1E2T A;  4MZO A;  3NAD A;  3S60 A;  3FEN A;  1QAB E;  2A0A A;  3FLL A;  2R6N A;  2GTF X;  1SXX A;  2IZK A;  3ZUA A;  3TRK A;  2OFM X;  1VWN B;  4FIP A;  1S44 A;  2FGS A;  2CM9 A;  2QM9 A;  1VPR A;  3SZJ A;  2MM3 A;  3WOV A;  2BHV A;  1YK8 A;  1SY3 A;  4TJZ A;  4OMX A;  3N4C A;  1OPB A;  2G5L A;  4CSB A;  1HBP A;  2HLV A;  1BJ7 A;  5LJK A;  4BOU A;  5F02 A;  5EGW A;  2BDL A;  1DFV A;  2A2U A;  3ZW1 B;  1KT7 A;  2Q2M A;  3KSE A;  3F75 A;  4REZ A;  1T8V A;  2FHL A;  5E6J A;  3UAQ A;  2OVA A;  4BX7 A;  3SZH A;  1LEL A;  1VWQ B;  3WZN A;  2AYN A;  3N3G A;  4OEL A;  5IO6 A;  4N7C A;  3MVF A;  4CDC A;  2ZAG A;  3HWE A;  1KGL A;  3D9W A;  3MG5 A;  4HWM A;  2IZB A;  4QGV A;  3I3T A;  1SLG B;  5B29 A;  4FK5 A;  4B55 A;  3ZWE A;  3S26 A;  1MDW A;  3ZW0 A;  2FUD A;  3KQ0 A;  3VG6 A;  1U17 A;  3RNV A;  1I9H A;  1PVJ A;  1AVD A;  2GFO A;  4ALO A;  3APX A;  4P6E A;  3TMP A;  3BY0 A;  5IRA A;  4INN A;  3BPM A;  4AZM A;  1URE A;  1KT5 A;  4ORY A;  3VG5 A;  3ZI8 A;  2FT2 A;  3OJY C;  1SY1 A;  2X8S A;  4UU3 A;  4A8Z A;  2RTH B;  5F6B A;  4O4O A;  2WQ9 A;  3FEL A;  2L5P A;  5H9L A;  4GE1 A;  2ZAI A;  2OUL A;  1TU6 A;  1R0U A;  4Q8G A;  1QWD A;  5JR8 A;  2OY7 A;  2CBS A;  4I04 A;  3SLT A;  3U03 A;  1BSQ A;  1YUP A;  4Z6J A;  4BX5 A;  4Z2V A;  3S3R A;  1HXZ A;  1VWB B;  1BWY A;  4HXD B;  3D96 A;  2X8F A;  3MP2 A;  3FDC A;  4K19 A;  4ZTB A;  4X6J A;  1SWG A;  1G85 A;  2AT3 X;  1E06 A;  2A5B A;  2GTL M;  3FID A;  4C5P A;  3VHM A;  3WJB A;  1F2A A;  2OL8 O;  1G5W A;  3NQK A;  2K23 A;  3PED A;  4QRG A;  3P02 A;  5HTD A;  1MX8 A;  2E4J A;  4GNW A;  2NQI A;  1GX3 A;  4LQZ A;  4Y59 A;  1YT7 A;  3M99 A;  4MIR A;  2VHF A;  3WZP A;  1VWO B;  3JQO A;  4YYS A;  5BVQ A;  1GLO A;  1OPA A;  1YZB A;  2A8G A;  4ON1 A;  3CR6 A;  4NNT A;  4NLJ A;  1VWA B;  3NX1 A;  3FA6 A;  4QH6 A;  3PH5 A;  1KT3 A;  3H3I A;  4D8I A;  3OD9 A;  4K7C A;  3NQ3 A;  4I05 A;  1KXO A;  3F5V A;  2RTE B;  2WR6 A;  1MEM A;  3GE2 A;  3KFF A;  3WXQ A;  4TKJ A;  3IA8 A;  5F2B A;  1GKA B;  3WJD A;  1VYO A;  2ACO A;  1DC9 A;  2OYB O;  4FJC A;  4YCE A;  1NQM A;  1QMY A;  1O1V A;  1IFB A;  1BEB A;  3FA7 A;  3E1Z B;  1PE6 A;  1B8E A;  3LV4 A;  1QDQ A;  4CPH B;  4N8W A;  3I0A A;  2E02 A;  1VWK B;  1KT6 A;  3PRM A;  1U9V A;  1RBP A;  2RTP B;  4MSX A;  4ODD A;  1STF E;  5BYP A;  4XMF A;  3VPJ E;  2DZY A;  2RTI B;  4AW8 A;  4RF1 A;  3AUM O;  4MZS A;  4WFV A;  4Y0R A;  2JQF R;  1X9Y A;  2Y5B A;  2Y3E A;  4GET A;  4LKP A;  3FYF A;  3VGW A;  1RXJ A;  2ATO A;  2FKG A;  3UEU A;  2AIM A;  4D6A A;  2Y3F A;  1XKI A;  1ZCM A;  1STR B;  4BQV A;  1AU0 A;  2W2F A;  1VYF A;  1KL4 A;  3CWK A;  1ME4 A;  1LCZ A;  2NQG A;  4Y5D A;  2AYO A;  1UYN X;  1AU3 A;  3EYC A;  4BGF A;  1EPB A;  1TVQ A;  2X46 A;  5DPQ A;  1HUC B;  3UEX A;  2YJ9 A;  1ATK A;  1SXY A;  4RUU A;  1VWH B;  1ZIV A;  4I07 A;  2LB6 A;  4MVI A;  2KD2 A;  3OF8 A;  2HXZ A;  4A1H A;  1H91 A;  3WXE A;  4HPD A;  3ELX A;  4JO6 A;  3F6Z B;  3H8C A;  1PEE A;  2BLG A;  4N4Z A;  1E02 A;  2WQA E;  3P5V A;  5L3Y A;  5JD2 A;  1X71 A;  3P6G A;  3NQ9 A;  3SLO A;  2KT4 B;  1UKF A;  3PBH A;  4OEM A;  2RTF B;  4QYP A;  4ZHD A;  1GMY A;  2G78 A;  1CQD A;  2RTL A;  3ELZ A;  2RD7 C;  3WZQ A;  3D4R A;  5FEN A;  4YVA A;  3BRN A;  4OS3 A;  5EDB A;  1UYO X;  1AIM A;  1T68 X;  3BU1 A;  2IZC B;  2DCA A;  1L6M A;  1VWP B;  2F7D A;  1MHW A;  1CV8 A;  2AVW A;  3APV A;  3C9E A;  2GC9 A;  1KL5 A;  1SLD B;  4Z28 A;  1LUQ A;  1SLE B;  1PIP A;  2AH7 X;  4BOQ A;  4ZH9 A;  3P5U A;  5FQ7 E;  2FR2 A;  4WFU A;  5B10 O;  1BM5 A;  1MVG A;  4W5B A;  4DQ3 A;  1SRJ A;  1CBQ A;  1GKA A;  2MWH A;  4U8U M;  2AL0 X;  1RAV A;  1NBX A;  2BC3 A;  4W5C A;  4AZP A;  1EIO A;  3CBJ A;  2UYW A;  3P24 A;  5LJC A;  2ASN X;  3C78 X;  4BX7 B;  1DZM A;  3QKG A;  1EPA A;  3EBW A;  3MTN A;  1IIU A;  2OVD A;  3STN A;  3TNX A;  1EI5 A;  3B79 A;  5IO7 A;  4P16 A;  3ZW2 A;  3MBT A;  3T6F A;  4YCH A;  3HD3 A;  3OIS A;  3Q6L A;  5HZ9 A;  4YYW A;  2HYS A;  3B2I A;  2YMS A;  1SWU A;  4U8U N;  1MDC A;  3KVN A;  5C0N A;  4CPF A;  3U0D A;  2R9N A;  2QCB A;  2FWV A;  5BVS A;  3MHH A;  1VSN A;  3UEV A;  1VJV A;  1QY0 A;  2AS8 A;  2AUZ A;  2RA6 A;  2IZF B;  2AVI A;  5CSE A;  3FMZ A;  3P6C A;  1SA8 A;  1AVG I;  1NP4 A;  2CBR A;  4DNE A;  4BOP A;  2RTA A;  2X8T A;  3O19 A;  5HZ6 A;  4O3W A;  3FR4 A;  4ES7 A;  1CS8 A;  4XR7 A;  1CBS A;  4CDC B;  2VFC A;  3TGC A;  2O62 A;  4YBU A;  2PY1 A;  3EW2 A;  4ORX A;  2FHN X;  1EQD A;  4BX5 B;  2HH5 A;  5AJC A;  3RVV A;  2A13 A;  1PTS A;  3K24 A;  4O3Y A;  4OKA A;  5LKF A;  2DM5 A;  3P5W A;  1LIC A;  3CMP A;  4HWY A;  4W4U A;  2N93 A;  1O0E A;  2OVS A;  1DZP A;  1ZNE A;  2P7U A;  2FLJ A;  1DF8 A;  3BX7 A;  2AT0 X;  4RUN A;  1LIF A;  1Z24 A;  1DV9 A;  3JSQ A;  4YYR A;  4HFO A;  2IZD B;  3HPE A;  2AKQ A;  1U9Q X;  2R56 A;  3OVZ A;  3BB7 A;  2LBV A;  4IAX A;  1EAL A;  2A2G A;  4DMX A;  1YWA A;  1STS B;  2FS6 A;  2P0R A;  1F2B A;  1LFO A;  4EDE A;  2X4M A;  5EZQ A;  1CB5 A;  1N9Y A;  1HBQ A;  3FW4 A;  4PP1 A;  1SRI A;  2X34 A;  1SWF A;  4PP2 E;  3PHW A;  3T6L A;  7PCK A;  4BX6 B;  2AT8 X;  5F58 A;  5KIC A;  4ZGU A;  1KL3 A;  2LBA A;  5CVM A;  4QGW A;  4GJS A;  3HWF A;  3Q34 A;  2FRS A;  4BS5 A;  1PCI A;  5B5F A;  5FAZ A;  1RST B;  2RCT A;  5LKE A;  1EXS A;  3F9D A;  2XST A;  2VFB A;  1NP1 A;  2NQD B;  3QQ2 A;  4I9R A;  4ZHH A;  2WEX A;  1LPJ A;  1FTP A;  1K3B A;  5CYB A;  1OEK A;  1GT1 A;  2WUT A;  2IZA A;  4A5U A;  4CPH A;  4MIS A;  4IP3 A;  1BSY A;  2Q4N A;  2GHU A;  4YFR A;  4JHQ A;  4GDA A;  1A18 A;  4KII A;  3KFH A;  2MF6 A;  4XMG A;  3ZUI A;  1LF7 A;  2L67 A;  3FR5 A;  2FR3 A;  2R73 A;  1BRQ A;  5K67 A;  1ZNL A;  3IFB A;  1EII A;  2OF8 A;  4KT5 A;  3H6S A;  4LZV A;  4U9C A;  5HTE A;  3BSZ E;  4BPV A;  2QO4 A;  1GGL A;  4IB6 A;  2JTC A;  3NX2 A;  1GM6 A;  4KLB A;  4ZUX U;  1VWR B;  4ZFX A;  4NYR A;  4OS0 A;  1X8N A;  4CDE A;  5KHP A;  4BS6 A;  3X00 A;  2QO6 A;  4MI7 A;  1Y9T A;  3HWN A;  1NQN A;  1SWP A;  3VG7 A;  4MVE A;  1MM9 A;  3PHX A;  4A60 A;  2F1G A;  2IZH B;  1CRB A;  4QAE A;  4BQU A;  4O3Z A;  2X55 A;  1D3S A;  3KW9 A;  1NL6 A;  2LKK A;  2FTB A;  2JN3 A;  3RDS A;  1KHQ A;  3PP6 A;  3CBC A;  1A2D A;  5LJD A;  2Z4H A;  2RN4 A;  3WBG A;  1NB5 A;  2AU1 A;  4YV8 A;  2QMI A;  4ZHG A;  4YKO A;  1NC9 A;  3E3C A;  5LJB A;  3H7D A;  3P6D A;  2VDF A;  1ME3 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  3FR2 A;  2NQA A;  3WXF A;  1X8Q A;  3OBL A;  3PW3 A;  3HOE A;  3APU A;  4IB7 A;  1MUP A;  1KT4 A;  4CDF A;  1NQC A;  1NDJ A;  4U46 A;  3RDX A;  2YJC A;  3O2Y A;  2C1Q A;  4IRW A;  2FE8 A;  2CAM A;  3B2L A;  1BY8 A;  5IO5 A;  3CKF A;  4ZHF A;  2X32 A;  4IB8 A;  3RVX A;  1WUB A;  1PBH A;  1IKE A;  2LFO A;  4Z27 A;  3VG3 A;  1AQB A;  1G7N A;  2OZ2 A;  3BOW A;  2OL6 O;  1CSB B;  1WBI A;  5CHT A;  3VHI A;  5HAE A;  1MIR A;  4OVZ A;  1AEL A;  3GAQ A;  2FYE A;  3WXG A;  4EFG A;  3V6E A;  1SRG A;  2AT5 X;  1EWM A;  2HZQ A;  3HWD A;  1KFF A;  2AGA A;  5B27 A;  2UZ2 A;  4XZX A;  3B2H A;  3PEC A;  3CQR A;  4MEE A;  3RDQ A;  4AXM A;  4BOZ A;  1FJ1 E;  4EXZ A;  1W4T A;  4A1Y A;  3W31 A;  2JRI A;  4ALB A;  1BSO A;  1RXH A;  2RTK A;  3U9P C;  1PMP A;  3RSW A;  3PHU A;  4ZH6 A;  4RNA A;  2WWP A;  4AZR A;  4GGT A;  4CDF B;  4CK4 A;  4ORU A;  2A3F X;  3JS1 A;  1ZNG A;  2FS7 A;  2B1M A;  2POA A;  2EU7 X;  4CPI A;  1LCW A;  3IUT A;  1MX7 A;  3B21 A;  1EWL A;  4IMN A;  2F73 A;  3HHI A;  3D95 A;  3MX7 A;  2DJG A;  4MVK A;  3OF9 A;  2G8E A;  4QRV A;  4O3X B;  4UU2 A;  3VG2 A;  1YIV A;  2IZI A;  3K3L A;  1NB3 A;  3PT2 A;  2OVE A;  1KXR A;  1BLR A;  3STM X;  4GD9 A;  1BBP A;  1PPO A;  1B56 A;  3V8U A;  3HHA A;  4I95 A;  5HCE C;  1KFU L;  3O65 A;  1A6R A;  4XMH A;  1KOI A;  4DCB A;  2OF9 A;  2YJB A;  4WUR A;  1SWK A;  1EWP A;  5CVN B;  2JW1 A;  4ORS A;  1JJX A;  2YJ8 A;  1U9X A;  3P6H A;  2Y32 A;  2ALL X;  3NPO A;  2DOS A;  4CDD B;  4X6I A;  2Z84 A;  1SMP I;  3AKN A;  4KH8 A;  1KZX A;  1DF0 A;  2PI3 O;  1Y08 A;  2FT9 A;  1I04 A;  2Q9S A;  2BS6 A;  2PAD A;  3OE3 A;  2QOS C;  4U3Q A;  1ERB A;  2E01 A;  5L8I A;  4M0W A;  2ACT A;  2BT9 A;  4EKV A;  2C1S A;  5D8J A;  3ZUO A;  4FQB B;  3BDR A;  5EED A;  2RTG B;  4ZHC A;  1VYG A;  3WYP A;  2ANS A;  3CBK A;  3ZQ3 A;  2CZT A;  2DCC A;  3V6C A;  2FRA A;  1CVZ A;  1TOW A;  1ITO A;  2JGS A;  8PCH A;  1OEE A;  2I5V O;  4LKT A;  1JJJ A;  2E03 A;  1FEL A;  3HTY A;  4HPB A;  4D8B A;  1QY2 A;  2RTR B;  1M6D A;  2MO5 A;  2FQ9 A;  1VWE B;  5IXG A;  2UZJ A;  1CPJ A;  1JYJ A;  2WSJ A;  3H89 A;  3S3Q A;  3C77 X;  4R3D A;  3HWG A;  4QQ1 A;  5FQ8 E;  2DZZ A;  2HKD A;  1YWC A;  1CBI A;  2RTN B;  1HMR A;  3FIQ A;  3CKG A;  4GZV A;  1HMS A;  1ZRY A;  1GT3 A;  3BX8 A;  1IJ8 A;  1IW2 A;  4XMC A;  3D6S A;  4IUM A;  3LXS A;  4GJV A;  4I3D A;  3PPT A;  1NLJ A;  3TGB A;  3IEJ A;  2VHS A;  4OW0 A;  1DKI A;  2Q2P A;  4OVZ B;  1AU2 A;  4Z2O A;  4ZGF A;  2OY8 A;  4QZU A;  1SWA A;  4IMO A;  4X6H A;  5K68 A;  1EUO A;  4U8U O;  2HWK A;  3T2W A;  1JMX A;  3PQS A;  1GEC E;  3QJ3 A;  4BOS A;  4LZU A;  1YP6 A;  4BX6 A;  4BVM A;  4FBO A;  1AYV A;  2PNS A;  3PDF A;  4L1N A;  2QOM A;  1SWR A;  4I3B A;  4YYQ A;  1X8P A;  3DF0 A;  4CZW A;  3GCB A;  1N43 A;  1A57 A;  1ALB A;  1CJL A;  2IBI A;  4GNY A;  3WJE A;  2HD5 A;  1JIW I;  4OMW A;  1N7Y A;  2YJ2 A;  1SWN A;  2G6D A;  1UZ2 X;  2WBF X;  1VWI B;  4O9S A;  1VWJ B;  3WYQ A;  3ZNH A;  3N91 A;  4TNN A;  1SWC A;  2L9C A;  5HZ5 A;  1IWD A;  2F01 A;  2NP1 A;  2R74 A;  3C76 X;  1IFC A;  4YDA A;  3CQN A;  4WA6 A;  2W2A A;  1AYW A;  1STP A;  5B2A O;  1OBQ A;  3P5X A;  4JNJ A;  4ZCB A;  3MHS A;  4R0B A;  3IHP A;  2HNX A;  5A24 A;  1NPZ A;  1W6F A;  5AQ6 A;  1KHP A;  4N7D A;  4DQ4 A;  1PBY A;  2CM4 A;  2X45 A;  1PBO A;  4NV7 A;  2Z4I A;  4I9S A;  2IZJ A;  5D45 A;  4FGI B; 
#chains in the Genus database with same CATH homology
 1JQP A;  4FJC A;  1QMY A;  1EWO A;  3E1Z B;  1AU4 A;  1PE6 A;  3IV2 A;  3H6S A;  1QDQ A;  4BPV A;  1MS6 A;  4N8W A;  1BGO A;  2E02 A;  4KLB A;  4ZUX U;  4NV8 A;  3OVX A;  3I06 A;  4CDE A;  4BS6 A;  1U9V A;  1PPP A;  4MSX A;  1U9W A;  3HWN A;  1STF E;  2PRE A;  3LFY A;  2F1G A;  2DZY A;  4GUZ A;  1CTE A;  4MZS A;  2JQF R;  2OP3 A;  1S4V A;  2C0Y A;  3BC3 A;  3MOR A;  1X9Y A;  3KW9 A;  1NL6 A;  2Y5B A;  1KHQ A;  2DCB A;  4CDE B;  3RVW A;  2Y6E A;  3CH2 X;  1PPN A;  1SNK A;  4YYV A;  2ATO A;  1NB5 A;  2AU1 A;  2PBH A;  1Y4H A;  4YV8 A;  2AIM A;  3PNR A;  1PPD A;  4BSQ A;  1ZCM A;  3AI8 A;  2ARY A;  2BDZ A;  1PXV A;  3H7D A;  4BQV A;  3IMA A;  1AU0 A;  2CB5 A;  2BSZ A;  1ME3 A;  1ME4 A;  1AEC A;  1F29 A;  5PAD A;  2R9F A;  2NQG A;  3QT4 A;  2NQA A;  2AYO A;  3NHE A;  3WXF A;  1AU3 A;  4BGF A;  3PW3 A;  2R9O A;  4CDF A;  1NQC A;  2E00 A;  5EF4 A;  1HUC B;  3K8U A;  2YJC A;  4AXL A;  5J94 A;  1BY8 A;  2YJ9 A;  1ATK A;  3RVX A;  1YVB A;  1PBH A;  1ZIV A;  4I07 A;  2DC7 A;  3OF8 A;  2HXZ A;  2FO5 A;  2OZ2 A;  3BOW A;  3WXE A;  3USV A;  1CSB B;  5CHT A;  2DCD A;  1MIR A;  4N79 A;  1W5R A;  3H8C A;  2FYE A;  3WXG A;  4N4Z A;  3V6E A;  4RY2 A;  3H8B A;  2DC6 A;  1EWM A;  3P5V A;  1POP A;  2DC9 A;  2FTD A;  3N3K A;  2R9C A;  2P86 A;  3PBH A;  1TLO A;  2R9M A;  2AUX A;  4OEM A;  1K3B B;  4XUI A;  5K16 A;  4AXM A;  1GMY A;  2FRQ A;  2HHN A;  1W4T A;  3ERV A;  1CQD A;  1U5I A;  3O0U A;  2DJG B;  1EF7 A;  2G7Y A;  5JH3 A;  2O6X A;  4YVA A;  4CDF B;  2B1M A;  2H7J A;  1AIM A;  2G8J A;  2XU5 A;  2DCA A;  2XU3 A;  3IUT A;  2F7D A;  1MHW A;  1CV8 A;  1YK7 A;  1EWL A;  2AVW A;  3C9E A;  4Q8H A;  3HHI A;  1E2T A;  2DJG A;  4MZO A;  3OF9 A;  1PIP A;  3O1G A;  2G8E A;  4QRV A;  3P5U A;  2R6N A;  1NB3 A;  4W5B A;  3ZUA A;  1KXR A;  4FIP A;  1ICF A;  1BP4 A;  1GCB A;  4W5C A;  1PPO A;  2DJF B;  3HHA A;  1KFU L;  1YK8 A;  3CBJ A;  1F2C A;  1A6R A;  1KFX L;  4QBB A;  3N4C A;  2YJB A;  1EWP A;  5CVN B;  2IPP B;  2YJ8 A;  5CVO B;  4PAD A;  1U9X A;  5F02 A;  5EGW A;  3MTN A;  4DMY A;  2BDL A;  4CDD B;  4X6I A;  1SP4 B;  3TNX A;  3B79 A;  4P6G A;  1DF0 A;  1Y08 A;  2PAD A;  3HD3 A;  3OIS A;  3KSE A;  3F75 A;  3KX1 A;  2E01 A;  4YYW A;  3KFQ A;  2ACT A;  2AYN A;  3N3G A;  4OEL A;  2R9N A;  1QOL A;  3U8E A;  1Q6K A;  3MHH A;  1VSN A;  1VJV A;  4CDC A;  2AS8 A;  2AUZ A;  3D9W A;  3LTW A;  3I3T A;  3CBK A;  3KKU A;  2B1N A;  2DCC A;  4FK5 A;  3V6C A;  4B55 A;  2FRA A;  3CH3 X;  1CVZ A;  1ITO A;  1MDW A;  3IOQ A;  8PCH A;  2FUD A;  2E03 A;  1AYU A;  1QXP A;  2DJF A;  1M6D A;  3BWK A;  2FQ9 A;  5CHV A;  1CPJ A;  2GFO A;  4P6E A;  1CS8 A;  4XR7 A;  3H89 A;  3S3Q A;  1XKG A;  2DZZ A;  4CDC B;  2VFC A;  3BPM A;  2XU1 A;  5FPW A;  2CIO A;  2FT2 A;  9PAP A;  2HH5 A;  1MEG A;  1THE A;  3RVV A;  3D6S A;  3K24 A;  3LXS A;  1NLJ A;  5JA7 A;  3IEJ A;  2VHS A;  3P5W A;  1FH0 A;  2OUL A;  1AU2 A;  1TU6 A;  1YAL A;  4HWY A;  4Q8G A;  4W4U A;  4X6H A;  1O0E A;  3KWB X;  3QSD A;  4I04 A;  1TL9 A;  2XU4 A;  2P7U A;  4QRX A;  1GEC E;  3QJ3 A;  1PAD A;  4YYU A;  3S3R A;  2DC8 A;  4YYR A;  3BPF A;  1U9Q X;  4X6J A;  3OVZ A;  4G54 A;  2JQG R;  1AYV A;  3BCN A;  2PNS A;  4DMX A;  1BQI A;  3PDF A;  6PAD A;  4YYQ A;  4C5P A;  2P0R A;  1F2A A;  1F2B A;  3DF0 A;  4CZW A;  1CB5 A;  3GCB A;  3KWZ A;  1CJL A;  4PP1 A;  2IBI A;  2HD5 A;  4PP2 E;  4QRG A;  7PCK A;  2YJ2 A;  2G6D A;  2NQI A;  1GX3 A;  2WBF X;  5CVM A;  1YT7 A;  3M99 A;  2VHF A;  4YYS A;  1GLO A;  4BS5 A;  1PCI A;  4CDD A;  1IWD A;  2VFB A;  2NQD B;  4WA6 A;  1AYW A;  4QH6 A;  1K3B A;  3P5X A;  4K7C A;  3MHS A;  3IHP A;  5A24 A;  4I05 A;  1NPZ A;  1W6F A;  3F5V A;  1KHP A;  1DEU A;  2GHU A;  1MEM A;  3K9M A;  4PI3 A;  4NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...