4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
2AVWA 4RY2A 1PBHA 2XU3A 3P5UA 2NQGA 2ARYA 2P86A 4CDEA 1QMYA 1YALA 1CQDA 2FYEA 2DZZA 3U8EA 1AU3A 1FH0A 5CVMA 2PREA 3D6SA 1AECA 1HUCB 1AYWA 4CDDA 5CHTA 4N4ZA 1M6DA 3AI8A 3MHSA 4YYQA 2B1MA 3KWBX 1PXVA 4Q8HA 3TNXA 2DJGA 1GLOA 1X9YA 2FQ9A 1F2BA 2FUDA 1Y08A 4P6EA 2FRAA 4QRVA 1A6RA 3CBJA 4MZSA 4OEMA 3PW3A 4YYRA 3BCNA 3PNRA 1PE6A 4WA6A 2GHUA 4KLBA 2F1GA 2NQDB 4CDCB 4AXMA 3ZUAA 1K3BB 1Y4HA 3M99A 1AIMA 2E00A 4CZWA 3IUTA 3MORA 1U9QX 3PBHA 2VHFA 3H8CA 4OELA 2OULA 4CDCA 2DJFB 1K3BA 2AUZA 2R9NA 1CV8A 2NQAA 2DC6A 4PP1A 3IEJA 3HWNA 2AS8A 3V6CA 3QJ3A 1SP4B 3P5WA 2DCDA 2G8JA 4XUIA 2R9OA 2NQIA 2YJ9A 4CDFA 1U9VA 1MDWA 4PADA 2Y6EA 1YK7A 5F02A 1VSNA 1PIPA 1NB5A 4I04A 4PP2E 4BSQA 4X6HA 1BGOA 1QOLA 9PAPA 5EGWA 1KHQA 2BDZA 3HD3A 1ZIVA 2YJBA 3I06A 1U5IA 2YJCA 1DEUA 2R9CA 3WXFA 3E1ZB 3QSDA 3OISA 4QRXA 1S4VA 2PNSA 3BOWA 3MHHA 3DF0A 4QH6A 1PPDA 1POPA 4DMYA 4W4UA 1YT7A 5JA7A 2AU1A 2H7JA 2FO5A 4BQVA 4G54A 1AU4A 2FTDA 1TLOA 1JQPA 5JH3A 5CVOB 3N3GA 2G6DA 1ITOA 3S3QA 3O1GA 3CBKA 1QDQA 3K8UA 1QXPA 1NQCA 3IOQA 2PADA 1PPNA 2IPPB 2DC8A 2CIOA 1Q6KA 3IHPA 4Q8GA 8PCHA 2AUXA 2AIMA 2XU5A 1BQIA 3H7DA 3NHEA 1ME4A 2G8EA 2CB5A 4YVAA 1NLJA 4QBBA 3IV2A 1MHWA 3OVZA 4ZUXU 1EWOA 3LXSA 2OP3A 1CS8A 4BS6A 3C9EA 1CPJA 2DCAA 4QRGA 3KKUA 1CVZA 1EF7A 3BC3A 3WXEA 2DJFA 3RVVA 2HH5A 2AYNA 1NPZA 1F29A 4X6JA 1ATKA 5J94A 5CHVA 3OVXA 3H8BA 2E03A 3KWZA 3OF9A 4P6GA 3KX1A 4MSXA 4BPVA 3MTNA 2F7DA 1F2AA 1THEA 4K7CA 3N3KA 6PADA 1PPPA 3O0UA 2JQFR 1VJVA 2B1NA 2JQGR 4PI3A 5A24A 3K24A 3PDFA 3WXGA 1NB3A 2O6XA 1BP4A 1ICFA 1MEMA 1PPOA 2E01A 3V6EA 4CDEB 1CTEA 1TU6A 2R6NA 1YK8A 3HHIA 1YVBA 1SNKA 1MEGA 4CDDB 4I07A 4FIPA 1EWPA 4I05A 2FRQA 2VHSA 4FJCA 3F75A 2DJGB 2IBIA 4YV8A 3KFQA 5K16A 2FT2A 1NL6A 1GCBA 1GECE 3B79A 1CB5A 3GCBA 2PBHA 1U9WA 2R9FA 1EWLA 4YYUA 3USVA 3CH3X 4HWYA 4BS5A 5CVNB 1MIRA 1XKGA 1GMYA 3F5VA 4W5CA 2Y5BA 1IWDA 2C0YA 1PCIA 3S3RA 3RVXA 2AYOA 2HD5A 2ATOA 5PADA 4MZOA 1KHPA 2BDLA 4N8WA 3KW9A 2XU4A 1EWMA 2ACTA 4FK5A 2XU1A 1ME3A 5EF4A 2HXZA 3P5VA 4YYSA 3IMAA 4XR7A 2R9MA 2WBFX 1AU0A 1BY8A 1KFXL 2DZYA 1CJLA 3H89A 1F2CA 1AYVA 3BPMA 2P0RA 3KSEA 3BPFA 4CDFB 4X6IA 3BWKA 1STFE 1CSBB 3CH2X 3P5XA 4W5BA 2OZ2A 3ERVA 1KFUL 3RVWA 4YYWA 1PADA 4DMXA 1AYUA 3K9MA 1U9XA 3HHAA 1ZCMA 2G7YA 1MS6A 4N79A 2E02A 3OF8A 3QT4A 2DCBA 2YJ8A 2DCCA 1AU2A 1KXRA 1TL9A 4AXLA 3H6SA 2DC9A 2HHNA 3I3TA 2GFOA 5FPWA 2DC7A 2YJ2A 4YYVA 3N4CA 7PCKA 1O0EA 1DF0A 2P7UA 3LFYA
chains in the Genus database with same CATH superfamily
3OQCA 2RTCB 2HLVA 3TRKA 4AW8A 4ZHHA 3P5UA 2G7BA 1QY1A 4QGWA 5IO5A 5HZ5A 4NLJA 2BTWB 4NYQA 1DF8A 3OD9A 4MEEA 1EPBA 4NNSA 3U8EA 3CKGA 4XMCA 1FH0A 4RUNA 2PREA 5F2BA 1AYWA 2N93A 1EI5A 4N4ZA 1M6DA 4O3WA 4I95A 4M6SA 2B1MA 1VWCB 2HWKA 4O4UA 3KWBX 1MUPA 3TNXA 3PHWA 1GX8A 1WUBA 2POAA 5FENA 5AEOA 1VYFA 1VWFB 2JOZA 1Y08A 1EALA 4QRVA 1A6RA 1RBPA 3O65A 5FQ7E 4ZCBA 2QO4A 2GH7A 1CRBA 4YYRA 1PE6A 4WA6A 2GHUA 2IZCB 3F9DA 2F1GA 2NQDB 2Q39A 5D4AA 4UU2A 1CJ5A 4ZH9A 1A18A 1FENA 4NP1A 1LDQA 1HMSA 4NLIA 4DCBA 2W2AA 1SWCA 1GT3A 5B27A 1CV8A 1SLDB 3B2IA 1NC9A 4A8ZA 2FS7A 1HBPA 2FLJA 3P5WA 2DCDA 1FDQA 1X8UA 4QAEA 3U03A 3WJDA 2FTBA 3HK1A 1MM9A 4DQ4A 4OS8A 1DZPA 4QZTA 2RTDB 1B0OA 5KICA 1SWTA 1HMTA 1VWEB 4CV7A 3I17A 3ZNHA 1YK7A 4GE1A 1BJ7A 4GNYA 3NX1A 2FR2A 1EXSA 4R3DA 1KT3A 2RTNB 1OBPA 2IZBA 1BLRA 2AT0X 2AL0X 1D3SA 3NR3A 2PI3O 1AQBA 1GX9A 1SWHA 2JMBA 4ZHCA 3B2HA 1G74A 1ZIVA 2RN4A 3BY4A 1U5IA 2YJCA 3EYCA 3WXFA 3ZW0A 3E1ZB 3FIDA 1I9HA 2L9CA 1POPA 4DMYA 3APWA 3SLTA 4W4UA 4PSQA 4CPHB 2AU1A 1N0SA 1AU4A 2A2GA 1EPAA 1EW3A 1VWBB 1AVDA 2G5LA 2WUTA 3IFUA 5JH3A 3N3GA 1VWPB 1DKIA 2Q2MA 2G6DA 3BRNA 4CPHA 3O1GA 3ELXA 1QDQA 4WHIA 3K8UA 3F8AA 1NQCA 2RA6A 1ZNLA 2HMBA 4IAXA 2RTIB 2PADA 1X71A 2IPPB 2JU8A 2DC8A 2CIOA 5L3YA 4KC7A 1Q6KA 3NADA 8PCHA 2J7QA 1ZNHA 3FA7A 2JU7A 3FIQA 1BQIA 3NHEA 1LDOA 2OY8A 4ORRA 3RDQA 4NW4A 1SWQA 5LKEA 4KH8A 4ALBA 1RXHA 1CS8A 1QWDA 1JYJA 3P6FA 2OFRX 4O4XA 3D95A 4QRGA 2OVAA 5DG4A 3KFGA 2L5PA 1JJUA 2AH7X 3SLJA 2AYNA 5LJKA 1SWDA 1ATKA 3C77X 2J7QC 2ANSA 5J94A 1SY2A 1FE3A 3IA8A 3CWKA 1VWGB 3UEXA 2FHLA 3VG2A 1KGLA 1RSTB 1THEA 3SOTA 3N3KA 6PADA 4BX6A 2CAMA 2XSTA 1EQDA 2B1NA 2AT8X 3TGCA 2UZ2A 2WEXA 2RTBB 1VPRA 3PDFA 2FKGA 2C1QA 1QABE 1ZNKA 1PPOA 2E01A 1RSUB 4JO6A 2RTJA 4BOSA 2AT6X 1SRGA 1SWJA 4HPDA 1G7NA 4BX7B 2FGSA 5HBSA 1KT5A 2FRQA 2OL8O 3FEKA 4EFGA 4Z27A 4D8BA 3F75A 3UEUA 1SLFB 2IZAA 2OL7A 3O2YA 2FT2A 3F6ZB 1CB5A 1STRB 3GCBA 1LCWA 4IMOA 4BX7A 3W31A 2RTGB 3CH3X 4GGTA 4HWYA 5HTEA 3PSEA 1GMYA 2RTLA 1KL3A 1BRQA 5D48A 2HD5A 4U3QA 5PADA 3WJGA 1KHPA 2A5BA 5H8TA 3FA9A 3PHUA 4FK5A 5LJGA 2XU1A 4JNJA 4JGLA 5EF4A 3FELA 1KT7A 2R9MA 5CHKA 4ES7A 2DZYA 1IW2A 3V8UA 1IFBA 2IZHB 3KSEA 5F7GA 2M4LA 3BWKA 1STFE 1CSBB 3P5XA 1KXOA 2AVIA 4PT5A 3K9MA 1N9YA 2OZQA 3D97A 4RUUA 2G7YA 3NQ9A 3PRMA 4IB9A 3QT4A 4O9SA 1YIVA 1P6PA 1SWRA 2DCCA 1D2UA 3VG7A 4FGIB 5B11O 4MVKA 4HFOA 3EMMA 1KZWA 3T6FA 2R56A 4EQAC 1JZUA 3P6EA 2CM9A 2WR6A 1PMPA 2QOSC 2YMSA 3LTWA 2DM5A 2XU3A 2UYWA 3APXA 2NQGA 4NV8A 4GKCA 4XMGA 4D6AA 3E9SA 2MHDA 3O22A 2Q9SA 1T0VA 3FENA 4YMYA 1YALA 1CQDA 2FYEA 1SWBA 4CPEA 1GT5A 3AUMO 4K19A 2IZFB 1HUCB 4CDDA 4Y0RA 5B5FA 2NNEA 4EDEA 2P8GA 3D96A 2R73A 1KQXA 1VYOA 1PBOA 5HAEA 1GKAB 1QY2A 5EDBA 3CBCA 1MDCA 3HTYA 1GLOA 1RAVA 5CYBA 4P6EA 4LKPA 2FRAA 1ZNDA 5IRUA 4ON1A 5F6ZA 3VG5A 4EKVA 3FMZA 4Z28A 3UEVA 5D8JA 4U46A 3BX8A 1LNMA 4AXMA 3HWGA 3KFIA 2CBSA 4TNNA 3FLLA 1OPAA 3KZAA 2E00A 3IUTA 3MORA 2ACOA 2VHFA 4Y5DA 1N9MA 2DJFB 2AUZA 2R9NA 3PK2A 2DC6A 5EDCA 5KO3A 5LJCA 3MM0A 1TW4A 3WJEA 2AS8A 2X34A 1SP4B 1VWRB 2NQIA 2MJIA 2X8SA 4CDFA 1G85A 2A3FX 1LIFA 4YBUA 1H91A 4OW0A 5EPQA 1PIPA 2LBVA 4MVEA 1SXYA 5BYPA 1DZJA 4PP2E 1CBIA 1BSYA 1BGOA 4QGVA 2Z84A 9PAPA 1ZRYA 1LCVA 1SWEA 4LZUA 3E3CA 2BDZA 3HPEA 4RF0A 1HQQA 1Y9TA 1LIEA 1JBHA 1KL5A 4TKJA 3T2XA 3BY0A 4I3CA 3VG3A 1SWSA 2PNSA 3U0DA 3BOWA 5LKFA 4O4SA 2IZKA 1X89A 2GTLN 2FRSA 1A57A 2OY1O 2BTWA 2FO5A 3Q6LA 1ML7A 2WEWA 1E00A 1W6FA 2FTDA 1TLOA 1HN2A 1JQPA 4GD9A 5LJBA 1LIDA 2JTCA 1BBPA 4QQ1A 3S3QA 4I9RA 2GC9A 3WJCA 3FA6A 4L3RA 2BSZA 3IHPA 4GJVA 1ZNEA 3PHXA 2XU5A 4OS3A 3VHIA 3BU9A 3EC5A 1LUQA 1JV4A 4YVAA 1SLGB 1VWIB 1SWKA 1LCZA 3O19A 3OVZA 1DFVA 1FJ1E 2BHVA 2Q2PA 1EWOA 3LXSA 4YDAA 2X8TA 4REZA 3FA8A 3OJYC 1QFTA 1YP7A 2FT9A 2G8CO 1CPJA 3ZW2A 4U8UO 3CKFA 1OEEA 2DCAA 1CVZA 5HA0A 5IO6A 1EF7A 1SWAA 1VWMB 1AELA 3WXEA 3AKMA 3RVVA 2HH5A 1MVGA 2KT4B 1SY3A 2OVSA 1NPZA 4OKAA 2W2BA 4IUMA 3B2JA 4IB8A 1U0XA 1F29A 4A60A 2QMIA 3RY1A 4ORXA 1Y9LA 1YWCA 5F6BA 1EIOA 3T2WA 3KWZA 3KX1A 4BPVA 3MTNA 1HBQA 1VWAB 5IXGA 4O3XB 4HXDB 4BCSA 3NQ3A 4O4OA 1YWDA 3ELZA 3O0UA 1VJVA 2WPUA 1Y55X 4ODDA 4TLJA 2FKJA 2RTPB 3CBSA 2O6XA 3MVFA 1SRIA 1YZBA 4I60A 5D45A 5JZEA 3X00A 4ZH6A 3V6EA 4CDEB 1CTEA 2Z4HA 3RDUA 2R6NA 1YK8A 2XKLA 1VWOB 5LJEA 1MEGA 1A3YA 2Q4NA 3FDCA 4ZFXA 3MX7A 4I05A 1QQSA 2ZAIA 4FJCA 2OL6O 4BGFA 1BEBA 2DJGB 4ZJ0A 2RD7C 4YKOA 4IBAA 1GCBA 1PVJA 3EW1A 4GH7A 1GT1A 1UZ2X 3C76X 4IB6A 3BBAA 1U9WA 3UEWA 1EWLA 1SY1A 3USVA 1B4MA 1ERBA 1XKGA 4GETA 4I6SA 3F5VA 2QO5A 2IZIA 1KL4A 1UREA 5BVSA 1PCIA 3JS1A 5EEDA 3ZI8A 2ATOA 1PBYA 2BDLA 2XU4A 1EWMA 3TGAA 3HWEA 1HY2A 2CZUA 1I05A 5EZSA 1QFVA 1JJJA 5IO7A 3P5VA 4XR7A 2WBFX 1LKEA 3APUA 2UZJA 2IZDB 3PH5A 5HWZA 3BPMA 3BPFA 2IZJA 3P02A 3S5VA 1MX7A 1SWFA 2A13A 1GX3A 5HCEC 3ERVA 1KFUL 3SZHA 1AYUA 1W5RA 1U9XA 3FW4A 1L6MA 4LQZA 1W4TA 1R0UA 2ASNX 4N79A 1T68X 2QO6A 3S60A 4ZHGA 4FQBB 4R0BA 4TKHA 1KT4A 3MG5A 3NQKA 1SWNA 4IABA 1AU2A 3H6SA 2QOMA 4B55A 1QG5A 3D9WA 2GFOA 3PT2A 3SZIA 1UKFA 5FPWA 4Z2PA 4YYVA 2OF8A 4GK9A 7PCKA 1ADLA 2P7UA 3LFYA 3WVMA 3N91A 3H3IA 3RDSA 4NV7A 1EUOA 5H9KA 1STSB 1SWGA 1NQMA 2VFBA 3NP1A 2RTHB 2GTFX 3NX2A 3FW5A 1SRJA 2OVDA 2DZZA 3SZJA 4ZTBA 1AU3A 3OE3A 3D6SA 1AECA 3MHSA 3MP2A 4YYQA 3MTVA 1PXVA 1IFCA 3C0RA 3CQRA 3CMPA 4GZVA 4BQUA 2FQ9A 1F2BA 4OVZB 3G7XA 5HCCC 4MZSA 4OEMA 2FS6A 1BWYA 1O1UA 3RKGA 1NP4A 3BCNA 3VHHA 2EU7X 3PQSA 2RTEB 4RNAA 5IRAA 4A1YA 1K3BB 4GGZA 2Z4IA 3EBKA 1Y4HA 1MEPA 2GTLM 5IRWA 1ALBA 3NBXX 5FAZA 2AGAA 4RKXA 3HWDA 3FR5A 5HA1A 1S44A 1MK5A 2YG2A 5HZ8A 4GUZA 1U9QX 3PBHA 1QY0A 1K3BA 3UAQA 2NQAA 1YWAA 3IEJA 3HWNA 3V6CA 3QJ3A 1MX8A 2G8JA 4XUIA 3KFFA 3ZUOA 3RSWA 4ALOA 2VFCA 1I4UA 2YJ9A 2CM4A 2FE8A 3B21A 4AZQA 4KC8A 1XKIA 3STMX 3LV4A 2BS5A 4ORUA 1OBUA 1O8VA 4PADA 3W30A 1VSNA 1WBIA 2HNXA 3NPOA 3PRPA 2LFOA 3TF6A 1I06A 3AKNA 2G79A 4M0WA 1JMZA 1PM1X 5EGWA 4BOQA 3TGBA 2KD2A 2OFMX 1LELA 2FHNX 5KHPA 2KW1A 1VYGA 3I06A 1JJXA 5L8IA 1DEUA 2R9CA 3EM0A 1VWHB 5B2AO 3RNVA 3OISA 1EIIA 1S2PA 4BOEA 3DTQA 4D8IA 3DF0A 4QH6A 1PPDA 3P6GA 3BDRA 1DZKA 2RTRB 5JA7A 3IFBA 5B3MO 2G78A 2OFBA 4BQVA 2OF9A 3VG6A 2X4MA 4G54A 2QCBA 2BU3A 4CSBA 3BX7A 4NNTA 1GM6A 3SAOA 2JW1A 1B56A 3RWXA 3PH6A 1TOUA 3CBKA 3HWFA 5B5GA 4AZPA 3P6DA 4GDAA 4D8EA 4YFQA 4QZUA 1GKAA 2DOSA 3RBYA 3IOQA 2JU3A 5AJCA 1SWLA 2I5VO 2IZLB 3RE5A 4MIRA 2JGSA 2AUXA 3HOLA 3BU1A 1SY0A 3FR2A 1VWLB 1A2DA 2G8EA 1UYNX 3B2KA 2CB5A 3BLGA 3OBLA 5FQ6E 3VE2A 1NLJA 4QBBA 4GDZA 4QYNA 2OY5O 1MHWA 4ZUXU 5F58A 3PQUA 5L8OA 3WYPA 4BS6A 2Y32A 1JYDA 5B29A 4Z6JA 3KKUA 2IZGB 4FBVA 4AZRA 1SXWA 3BC3A 4IRWA 2DJFA 3ZQ3A 4ZHDA 2MF6A 4X6JA 1NDJA 3ZZVA 4YGHA 3RDXA 3H8BA 1G5WA 2HZRA 3B2LA 2HYSA 3RDMA 2AMMX 2C1SA 1Z24A 2E4JA 1LICA 4K7CA 3T6LA 4RF1A 4WURA 1PPPA 4A1HA 1PTSA 4ID2A 3JSQA 2JQFR 1SMPI 3I0AA 5A24A 4GUAA 3HOEA 5K06A 3K24A 4KIIA 1NB3A 3WXGA 3RE6A 2KTDA 3EW2A 4N7CA 3ZWEA 3U9PC 4LKTA 4IAWA 4CPIA 3Q34A 4GJSA 1AVEA 4QNIA 4GNWA 1YVBA 1SNKA 4GRJA 3STKA 4I07A 2Y3FA 3FEPA 4FIPA 3EBWA 2X45A 4N7DA 4Y0PA 2MWHA 5HZQA 1HQPA 4TKBA 2IBIA 2AKQA 4YV8A 3FYFA 5K16A 1NL6A 5KIDA 4BOUA 3PP6A 5EEEA 3RZYA 5JR8A 4YYUA 1OBQA 4ZR2A 4UU3A 2LA7A 4KCAA 4L1NA 4W5CA 5K67A 3WBGA 1TOWA 4MISA 2Y5BA 1IWDA 2C0YA 4YDBA 4YCHA 2AYOA 2F73A 4MZOA 4LZVA 4N8WA 5L8NA 2A5CA 4XMHA 2F01A 2A0AA 4HPAA 1MOYA 2ALLX 2O62A 1ME3A 1SWUA 4YYSA 3VU1A 3IMAA 1CBSA 1KFXL 1CJLA 5H9AA 3H89A 2A8GA 4CK4A 3MBTA 2BC3A 3WJFA 1T8VA 4A5UA 4BX5B 3CH2X 4W5BA 2OZ2A 3WZOA 2AT5X 4YYWA 1PADA 3HHAA 3ZW1B 4ML7B 4ZGUA 2F09A 4BX5A 2X56A 1Y0GA 4AZNA 3OF8A 1X8OA 1BSOA 2OVEA 2A2UA 1N4JA 4AZOA 4QYPA 4BVMA 2YJ8A 1KXRA 1TL9A 2AT3X 1JIWI 1YUPA 3ZW1A 1RLBE 4XMFA 2RTFB 3WYQA 1FELA 3ZW0B 1LF7A 1DF0A 4WFUA 1OEKA 1X8PA 2AVWA 4RY2A 4YFRA 1LIBA 4P16A 1PBHA 1DF3A 2VDFA 2IZEB 2RTMA 2GJ5A 2ARYA 4FBRA 5EZQA 3ZUIA 1FEMA 4HPCA 2P86A 4CDEA 1YWBA 1QMYA 1TXLA 5HZ6A 2K23A 2OYBO 2LB6A 5FQ8E 5CVMA 1PEEA 3FR4A 5CHTA 1FTPA 3AI8A 2BS6A 1ZNGA 4Q8HA 1KT6A 3TZSA 1LFOA 1HMRA 4ZHFA 2FWVA 1I78A 4U8UM 4OMWA 2DJGA 5B10O 1X9YA 3BS2A 1SWPA 2X8FA 4OMXA 2I5ZO 3C78X 4ORYA 2RQ0A 3WZPA 2FUDA 1SREA 3GE2A 3CBJA 3PW3A 2NP1A 3PNRA 2ACPX 2X32A 3JQOA 5JD2A 5CE4A 1GGLA 4Y0SA 1N43A 2RTQB 2OFAA 4KLBA 2NNDA 4CDCB 3WZNA 3ZUAA 2FR3A 3MJ5A 4DQ3A 2WQ9A 5LJHA 1OPBA 1OSPO 1LPJA 3M99A 1AIMA 4QGXA 4CZWA 3VE1A 2JRIA 2C4IA 4GU8A 3PPTA 5CSEA 4DNEA 3H8CA 4OELA 4U9CA 2OULA 4CDCA 1VWQB 1X8NA 3APVA 1E2TA 1XCAA 4M7MA 4PP1A 3STNA 2BT9A 3KVNA 1N7YA 4QRLA 2R9OA 1I04A 4BBOA 2NNQA 2ZSCA 3WZQA 3PEDA 1BM5A 2WSJA 1U9VA 1E06A 1MDWA 1NGLA 2Y6EA 5F1EA 4BX6B 1VWNB 1ICNA 4O3ZA 5F02A 4YGZA 1KOIA 2GTLO 1NB5A 4I04A 2X46A 3D4RA 1OEJA 4BSQA 4X6HA 1QOLA 2PY1A 4ORSA 4HPBA 5HTDA 1KHQA 3DSZA 4CPFA 3HD3A 4MVIA 4MVLA 2YJBA 4WBKA 3QSDA 4QRXA 1S4VA 3CR6A 3PECA 3P24A 2QM9A 4INNA 1GXAA 3GAQA 3MHHA 2W2FA 1ACDA 1YT7A 1IJ8A 2H7JA 4Y0QA 5H9LA 3L4RA 5EZ2A 2OY7A 4BOPA 1BSQA 2MM3A 2Y3EA 3T1DA 3VHMA 1CBRA 2LBAA 3P6HA 2L67A 5CVOB 4KT5A 2KTSA 1DZMA 1ITOA 4IP3A 2CZTA 4Z2OA 3SLOA 1STPA 1QXPA 3VG4A 1PPNA 4IMNA 1X8QA 4YBPA 4OVZA 1BRPA 4Q8GA 5LJDA 1KFFA 1E02A 5HZ9A 1U17A 2AIMA 3P6CA 4EXZA 3H7DA 3RDOA 1ME4A 3CQNA 5K68A 1IKEA 4YVBA 4ORWA 3S26A 2RTAA 3IV2A 5E6JA 1DC9A 1AB0A 5AJBA 3TMPA 2OP3A 4FBOA 1UYOX 4YH0A 3C9EA 4O49A 4GGRA 1HXZA 3VGWA 4YKMA 1K24A 4IB7A 4TJZA 1HXLA 2BLGA 4Y59A 1KQWA 2RCTA 4XMDA 1Y53X 1SRFA 5AQ6A 1VWDB 3WJBA 1SXUA 5CHVA 3OVXA 2E03A 1RXJA 3OF9A 4P6GA 2L68A 4MSXA 4BOZA 1NQNA 2R74A 3KQ0A 1IIUA 2F7DA 1F2AA 1SA8A 1JMXA 1NP1A 4NYRA 1SLEB 4ARHA 1YP6A 4U8UN 2JQGR 4PI3A 2MO5A 4I3DA 2AF5A 4C5PA 1BP4A 4Z2VA 1ICFA 1MEMA 1TU6A 5C0NA 5D47A 1KZXA 3HHIA 3BSZE 4YGGA 5DPQA 1S7DA 4CDDB 5BVQA 4TQ2A 1E5PA 1EWPA 4ZGFA 3QQ2A 4D6BA 4COTA 2VHSA 1Y52X 3WXQA 4JHQA 1RXKA 3KFQA 1GECE 3B79A 4MI7A 1VWJB 1SWOA 2JN3A 1U18A 2X55A 2PBHA 2R9FA 1DV9A 4HWMA 3BB7A 3S5XA 5H9NA 4OS0A 1CBQA 3QKGA 1O1VA 5HCDC 1ERXA 4BS5A 5CVNB 1MIRA 4AZMA 4YFPA 1NBXA 3KFHA 3S3RA 3VPJE 4MM3B 3RVXA 2K62A 3KW9A 2ACTA 4EEJA 1B8EA 2HXZA 4PJ2A 1AU0A 1BY8A 4XMEA 4AYHA 4I9SA 1F2CA 4XZXA 1AYVA 1AVGI 5FFHA 2P0RA 3K3LA 2WQAE 4YCEA 4CDFB 2IFBA 4X6IA 1SRHA 2WWPA 5BVTA 4O3YA 1SXXA 1VWKB 1ICMA 3LHNA 1TVQA 2ZAGA 2RCQA 3RVWA 4DMXA 3AEHA 2HKDA 3WOVA 1ZCMA 4BJ8A 1MS6A 2HZQA 4I3BA 2E02A 1GT4A 2RTKA 1IKJA 2RTOB 2DCBA 2CBRA 2LKKA 4AXLA 2DC9A 2HHNA 3I3TA 2DC7A 2YJ2A 3RY2A 3N4CA 1O0EA 4WFVA
chains in the Genus database with same CATH topology
2AVWA 4RY2A 4NV7A 1PBHA 3LTWA 2XU3A 3P5UA 2NQGA 2ARYA 2VFBA 4NV8A 2P86A 4CDEA 1QMYA 1YALA 1CQDA 2FYEA 2DZZA 3U8EA 1AU3A 1FH0A 5CVMA 2PREA 3D6SA 1AECA 1HUCB 1AYWA 4CDDA 5CHTA 4N4ZA 1M6DA 3AI8A 3MHSA 4YYQA 2B1MA 3KWBX 1PXVA 4Q8HA 3TNXA 2DJGA 1GLOA 1X9YA 2FQ9A 1F2BA 2FUDA 1Y08A 4P6EA 2FRAA 4QRVA 1A6RA 3CBJA 4MZSA 4OEMA 3PW3A 4YYRA 3BCNA 3PNRA 1PE6A 4WA6A 2GHUA 4KLBA 2F1GA 2NQDB 4CDCB 4AXMA 3ZUAA 1K3BB 1Y4HA 3M99A 1AIMA 2E00A 4CZWA 3IUTA 3MORA 4GUZA 1U9QX 3PBHA 2VHFA 3H8CA 4OELA 2OULA 4CDCA 2DJFB 1K3BA 2AUZA 2R9NA 1E2TA 1CV8A 2NQAA 2DC6A 4PP1A 3IEJA 3HWNA 2AS8A 3V6CA 3QJ3A 1SP4B 3P5WA 2DCDA 2G8JA 4XUIA 2R9OA 2NQIA 2VFCA 2YJ9A 4CDFA 1U9VA 1MDWA 4PADA 2Y6EA 1YK7A 5F02A 1VSNA 1PIPA 1NB5A 4I04A 4PP2E 4BSQA 4X6HA 1BGOA 1QOLA 9PAPA 5EGWA 1KHQA 2BDZA 3HD3A 1ZIVA 2YJBA 3I06A 1U5IA 2YJCA 1DEUA 2R9CA 3WXFA 3E1ZB 3QSDA 3OISA 4QRXA 1S4VA 2PNSA 3BOWA 3MHHA 3DF0A 4QH6A 1PPDA 1POPA 4DMYA 4W4UA 1YT7A 5JA7A 2AU1A 2H7JA 2FO5A 4BQVA 4G54A 1AU4A 1W6FA 2FTDA 1TLOA 1JQPA 5JH3A 5CVOB 3N3GA 2G6DA 1ITOA 3S3QA 3O1GA 3CBKA 1QDQA 3K8UA 1QXPA 1NQCA 3IOQA 2PADA 1PPNA 2IPPB 2DC8A 2CIOA 2BSZA 1Q6KA 3IHPA 4Q8GA 8PCHA 2AUXA 2AIMA 2XU5A 1BQIA 3H7DA 3NHEA 1ME4A 2G8EA 2CB5A 4YVAA 1NLJA 4QBBA 3IV2A 1MHWA 3OVZA 4ZUXU 1EWOA 3LXSA 2OP3A 1CS8A 4BS6A 3C9EA 1CPJA 2DCAA 4QRGA 3KKUA 1CVZA 1EF7A 3BC3A 3WXEA 2DJFA 3RVVA 2HH5A 2AYNA 1NPZA 1F29A 4X6JA 1ATKA 5J94A 5CHVA 3OVXA 3H8BA 2E03A 3KWZA 3OF9A 4P6GA 3KX1A 4MSXA 4BPVA 3MTNA 2F7DA 1F2AA 1THEA 4K7CA 3N3KA 6PADA 1PPPA 3O0UA 2JQFR 1VJVA 2B1NA 2JQGR 4PI3A 5A24A 3K24A 3PDFA 3WXGA 1NB3A 2O6XA 4C5PA 1BP4A 1ICFA 1MEMA 1PPOA 2E01A 3V6EA 4CDEB 1CTEA 1TU6A 2R6NA 1YK8A 3HHIA 1YVBA 1SNKA 1MEGA 4CDDB 4I07A 4FIPA 1EWPA 4I05A 2FRQA 2VHSA 4FJCA 3F75A 4BGFA 2DJGB 2IBIA 4YV8A 3KFQA 5K16A 2FT2A 1NL6A 1GCBA 1GECE 3B79A 1CB5A 3GCBA 2PBHA 1U9WA 2R9FA 1EWLA 4YYUA 3USVA 3CH3X 4HWYA 4BS5A 5CVNB 1MIRA 1XKGA 1GMYA 3F5VA 4W5CA 2Y5BA 1IWDA 2C0YA 1PCIA 3S3RA 3RVXA 2AYOA 2HD5A 2ATOA 5PADA 4MZOA 1KHPA 2BDLA 4N8WA 3KW9A 2XU4A 1EWMA 2ACTA 4FK5A 2XU1A 1ME3A 5EF4A 2HXZA 3P5VA 4YYSA 3IMAA 4XR7A 2R9MA 2WBFX 1AU0A 1BY8A 1KFXL 2DZYA 1CJLA 3H89A 1F2CA 1AYVA 3BPMA 2P0RA 3KSEA 3BPFA 4CDFB 4X6IA 3BWKA 1STFE 1CSBB 3CH2X 3P5XA 4W5BA 2OZ2A 1GX3A 3ERVA 1KFUL 3RVWA 4YYWA 1PADA 4DMXA 1AYUA 3K9MA 1U9XA 1W5RA 3HHAA 1ZCMA 2G7YA 1W4TA 1MS6A 4N79A 2E02A 3OF8A 3QT4A 2DCBA 2YJ8A 2DCCA 1AU2A 1KXRA 1TL9A 4AXLA 3H6SA 2DC9A 2HHNA 4B55A 3I3TA 3D9WA 2GFOA 5FPWA 2DC7A 2YJ2A 4YYVA 3N4CA 7PCKA 1O0EA 1DF0A 2P7UA 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVW A;  4RY2 A;  1PBH A;  2XU3 A;  3P5U A;  2NQG A;  2ARY A;  2P86 A;  4CDE A;  1QMY A;  1YAL A;  1CQD A;  2FYE A;  2DZZ A;  3U8E A;  1AU3 A;  1FH0 A;  5CVM A;  2PRE A;  3D6S A;  1AEC A;  1HUC B;  1AYW A;  4CDD A;  5CHT A;  4N4Z A;  1M6D A;  3AI8 A;  3MHS A;  4YYQ A;  2B1M A;  3KWB X;  1PXV A;  4Q8H A;  3TNX A;  2DJG A;  1GLO A;  1X9Y A;  2FQ9 A;  1F2B A;  2FUD A;  1Y08 A;  4P6E A;  2FRA A;  4QRV A;  1A6R A;  3CBJ A;  4MZS A;  4OEM A;  3PW3 A;  4YYR A;  3BCN A;  3PNR A;  1PE6 A;  4WA6 A;  2GHU A;  4KLB A;  2F1G A;  2NQD B;  4CDC B;  4AXM A;  3ZUA A;  1K3B B;  1Y4H A;  3M99 A;  1AIM A;  2E00 A;  4CZW A;  3IUT A;  3MOR A;  1U9Q X;  3PBH A;  2VHF A;  3H8C A;  4OEL A;  2OUL A;  4CDC A;  2DJF B;  1K3B A;  2AUZ A;  2R9N A;  1CV8 A;  2NQA A;  2DC6 A;  4PP1 A;  3IEJ A;  3HWN A;  2AS8 A;  3V6C A;  3QJ3 A;  1SP4 B;  3P5W A;  2DCD A;  2G8J A;  4XUI A;  2R9O A;  2NQI A;  2YJ9 A;  4CDF A;  1U9V A;  1MDW A;  4PAD A;  2Y6E A;  1YK7 A;  5F02 A;  1VSN A;  1PIP A;  1NB5 A;  4I04 A;  4PP2 E;  4BSQ A;  4X6H A;  1BGO A;  1QOL A;  9PAP A;  5EGW A;  1KHQ A;  2BDZ A;  3HD3 A;  1ZIV A;  2YJB A;  3I06 A;  1U5I A;  2YJC A;  1DEU A;  2R9C A;  3WXF A;  3E1Z B;  3QSD A;  3OIS A;  4QRX A;  1S4V A;  2PNS A;  3BOW A;  3MHH A;  3DF0 A;  4QH6 A;  1PPD A;  1POP A;  4DMY A;  4W4U A;  1YT7 A;  5JA7 A;  2AU1 A;  2H7J A;  2FO5 A;  4BQV A;  4G54 A;  1AU4 A;  2FTD A;  1TLO A;  1JQP A;  5JH3 A;  5CVO B;  3N3G A;  2G6D A;  1ITO A;  3S3Q A;  3O1G A;  3CBK A;  1QDQ A;  3K8U A;  1QXP A;  1NQC A;  3IOQ A;  2PAD A;  1PPN A;  2IPP B;  2DC8 A;  2CIO A;  1Q6K A;  3IHP A;  4Q8G A;  8PCH A;  2AUX A;  2AIM A;  2XU5 A;  1BQI A;  3H7D A;  3NHE A;  1ME4 A;  2G8E A;  2CB5 A;  4YVA A;  1NLJ A;  4QBB A;  3IV2 A;  1MHW A;  3OVZ A;  4ZUX U;  1EWO A;  3LXS A;  2OP3 A;  1CS8 A;  4BS6 A;  3C9E A;  1CPJ A;  2DCA A;  4QRG A;  3KKU A;  1CVZ A;  1EF7 A;  3BC3 A;  3WXE A;  2DJF A;  3RVV A;  2HH5 A;  2AYN A;  1NPZ A;  1F29 A;  4X6J A;  1ATK A;  5J94 A;  5CHV A;  3OVX A;  3H8B A;  2E03 A;  3KWZ A;  3OF9 A;  4P6G A;  3KX1 A;  4MSX A;  4BPV A;  3MTN A;  2F7D A;  1F2A A;  1THE A;  4K7C A;  3N3K A;  6PAD A;  1PPP A;  3O0U A;  2JQF R;  1VJV A;  2B1N A;  2JQG R;  4PI3 A;  5A24 A;  3K24 A;  3PDF A;  3WXG A;  1NB3 A;  2O6X A;  1BP4 A;  1ICF A;  1MEM A;  1PPO A;  2E01 A;  3V6E A;  4CDE B;  1CTE A;  1TU6 A;  2R6N A;  1YK8 A;  3HHI A;  1YVB A;  1SNK A;  1MEG A;  4CDD B;  4I07 A;  4FIP A;  1EWP A;  4I05 A;  2FRQ A;  2VHS A;  4FJC A;  3F75 A;  2DJG B;  2IBI A;  4YV8 A;  3KFQ A;  5K16 A;  2FT2 A;  1NL6 A;  1GCB A;  1GEC E;  3B79 A;  1CB5 A;  3GCB A;  2PBH A;  1U9W A;  2R9F A;  1EWL A;  4YYU A;  3USV A;  3CH3 X;  4HWY A;  4BS5 A;  5CVN B;  1MIR A;  1XKG A;  1GMY A;  3F5V A;  4W5C A;  2Y5B A;  1IWD A;  2C0Y A;  1PCI A;  3S3R A;  3RVX A;  2AYO A;  2HD5 A;  2ATO A;  5PAD A;  4MZO A;  1KHP A;  2BDL A;  4N8W A;  3KW9 A;  2XU4 A;  1EWM A;  2ACT A;  4FK5 A;  2XU1 A;  1ME3 A;  5EF4 A;  2HXZ A;  3P5V A;  4YYS A;  3IMA A;  4XR7 A;  2R9M A;  2WBF X;  1AU0 A;  1BY8 A;  1KFX L;  2DZY A;  1CJL A;  3H89 A;  1F2C A;  1AYV A;  3BPM A;  2P0R A;  3KSE A;  3BPF A;  4CDF B;  4X6I A;  3BWK A;  1STF E;  1CSB B;  3CH2 X;  3P5X A;  4W5B A;  2OZ2 A;  3ERV A;  1KFU L;  3RVW A;  4YYW A;  1PAD A;  4DMX A;  1AYU A;  3K9M A;  1U9X A;  3HHA A;  1ZCM A;  2G7Y A;  1MS6 A;  4N79 A;  2E02 A;  3OF8 A;  3QT4 A;  2DCB A;  2YJ8 A;  2DCC A;  1AU2 A;  1KXR A;  1TL9 A;  4AXL A;  3H6S A;  2DC9 A;  2HHN A;  3I3T A;  2GFO A;  5FPW A;  2DC7 A;  2YJ2 A;  4YYV A;  3N4C A;  7PCK A;  1O0E A;  1DF0 A;  2P7U A;  3LFY A; 
#chains in the Genus database with same CATH topology
 3OQC A;  2RTC B;  2HLV A;  3TRK A;  4AW8 A;  4ZHH A;  3P5U A;  2G7B A;  1QY1 A;  4QGW A;  5IO5 A;  5HZ5 A;  4NLJ A;  2BTW B;  4NYQ A;  1DF8 A;  3OD9 A;  4MEE A;  1EPB A;  4NNS A;  3U8E A;  3CKG A;  4XMC A;  1FH0 A;  4RUN A;  2PRE A;  5F2B A;  1AYW A;  2N93 A;  1EI5 A;  4N4Z A;  1M6D A;  4O3W A;  4I95 A;  4M6S A;  2B1M A;  1VWC B;  2HWK A;  4O4U A;  3KWB X;  1MUP A;  3TNX A;  3PHW A;  1GX8 A;  1WUB A;  2POA A;  5FEN A;  5AEO A;  1VYF A;  1VWF B;  2JOZ A;  1Y08 A;  1EAL A;  4QRV A;  1A6R A;  1RBP A;  3O65 A;  5FQ7 E;  4ZCB A;  2QO4 A;  2GH7 A;  1CRB A;  4YYR A;  1PE6 A;  4WA6 A;  2GHU A;  2IZC B;  3F9D A;  2F1G A;  2NQD B;  2Q39 A;  5D4A A;  4UU2 A;  1CJ5 A;  4ZH9 A;  1A18 A;  1FEN A;  4NP1 A;  1LDQ A;  1HMS A;  4NLI A;  4DCB A;  2W2A A;  1SWC A;  1GT3 A;  5B27 A;  1CV8 A;  1SLD B;  3B2I A;  1NC9 A;  4A8Z A;  2FS7 A;  1HBP A;  2FLJ A;  3P5W A;  2DCD A;  1FDQ A;  1X8U A;  4QAE A;  3U03 A;  3WJD A;  2FTB A;  3HK1 A;  1MM9 A;  4DQ4 A;  4OS8 A;  1DZP A;  4QZT A;  2RTD B;  1B0O A;  5KIC A;  1SWT A;  1HMT A;  1VWE B;  4CV7 A;  3I17 A;  3ZNH A;  1YK7 A;  4GE1 A;  1BJ7 A;  4GNY A;  3NX1 A;  2FR2 A;  1EXS A;  4R3D A;  1KT3 A;  2RTN B;  1OBP A;  2IZB A;  1BLR A;  2AT0 X;  2AL0 X;  1D3S A;  3NR3 A;  2PI3 O;  1AQB A;  1GX9 A;  1SWH A;  2JMB A;  4ZHC A;  3B2H A;  1G74 A;  1ZIV A;  2RN4 A;  3BY4 A;  1U5I A;  2YJC A;  3EYC A;  3WXF A;  3ZW0 A;  3E1Z B;  3FID A;  1I9H A;  2L9C A;  1POP A;  4DMY A;  3APW A;  3SLT A;  4W4U A;  4PSQ A;  4CPH B;  2AU1 A;  1N0S A;  1AU4 A;  2A2G A;  1EPA A;  1EW3 A;  1VWB B;  1AVD A;  2G5L A;  2WUT A;  3IFU A;  5JH3 A;  3N3G A;  1VWP B;  1DKI A;  2Q2M A;  2G6D A;  3BRN A;  4CPH A;  3O1G A;  3ELX A;  1QDQ A;  4WHI A;  3K8U A;  3F8A A;  1NQC A;  2RA6 A;  1ZNL A;  2HMB A;  4IAX A;  2RTI B;  2PAD A;  1X71 A;  2IPP B;  2JU8 A;  2DC8 A;  2CIO A;  5L3Y A;  4KC7 A;  1Q6K A;  3NAD A;  8PCH A;  2J7Q A;  1ZNH A;  3FA7 A;  2JU7 A;  3FIQ A;  1BQI A;  3NHE A;  1LDO A;  2OY8 A;  4ORR A;  3RDQ A;  4NW4 A;  1SWQ A;  5LKE A;  4KH8 A;  4ALB A;  1RXH A;  1CS8 A;  1QWD A;  1JYJ A;  3P6F A;  2OFR X;  4O4X A;  3D95 A;  4QRG A;  2OVA A;  5DG4 A;  3KFG A;  2L5P A;  1JJU A;  2AH7 X;  3SLJ A;  2AYN A;  5LJK A;  1SWD A;  1ATK A;  3C77 X;  2J7Q C;  2ANS A;  5J94 A;  1SY2 A;  1FE3 A;  3IA8 A;  3CWK A;  1VWG B;  3UEX A;  2FHL A;  3VG2 A;  1KGL A;  1RST B;  1THE A;  3SOT A;  3N3K A;  6PAD A;  4BX6 A;  2CAM A;  2XST A;  1EQD A;  2B1N A;  2AT8 X;  3TGC A;  2UZ2 A;  2WEX A;  2RTB B;  1VPR A;  3PDF A;  2FKG A;  2C1Q A;  1QAB E;  1ZNK A;  1PPO A;  2E01 A;  1RSU B;  4JO6 A;  2RTJ A;  4BOS A;  2AT6 X;  1SRG A;  1SWJ A;  4HPD A;  1G7N A;  4BX7 B;  2FGS A;  5HBS A;  1KT5 A;  2FRQ A;  2OL8 O;  3FEK A;  4EFG A;  4Z27 A;  4D8B A;  3F75 A;  3UEU A;  1SLF B;  2IZA A;  2OL7 A;  3O2Y A;  2FT2 A;  3F6Z B;  1CB5 A;  1STR B;  3GCB A;  1LCW A;  4IMO A;  4BX7 A;  3W31 A;  2RTG B;  3CH3 X;  4GGT A;  4HWY A;  5HTE A;  3PSE A;  1GMY A;  2RTL A;  1KL3 A;  1BRQ A;  5D48 A;  2HD5 A;  4U3Q A;  5PAD A;  3WJG A;  1KHP A;  2A5B A;  5H8T A;  3FA9 A;  3PHU A;  4FK5 A;  5LJG A;  2XU1 A;  4JNJ A;  4JGL A;  5EF4 A;  3FEL A;  1KT7 A;  2R9M A;  5CHK A;  4ES7 A;  2DZY A;  1IW2 A;  3V8U A;  1IFB A;  2IZH B;  3KSE A;  5F7G A;  2M4L A;  3BWK A;  1STF E;  1CSB B;  3P5X A;  1KXO A;  2AVI A;  4PT5 A;  3K9M A;  1N9Y A;  2OZQ A;  3D97 A;  4RUU A;  2G7Y A;  3NQ9 A;  3PRM A;  4IB9 A;  3QT4 A;  4O9S A;  1YIV A;  1P6P A;  1SWR A;  2DCC A;  1D2U A;  3VG7 A;  4FGI B;  5B11 O;  4MVK A;  4HFO A;  3EMM A;  1KZW A;  3T6F A;  2R56 A;  4EQA C;  1JZU A;  3P6E A;  2CM9 A;  2WR6 A;  1PMP A;  2QOS C;  2YMS A;  3LTW A;  2DM5 A;  2XU3 A;  2UYW A;  3APX A;  2NQG A;  4NV8 A;  4GKC A;  4XMG A;  4D6A A;  3E9S A;  2MHD A;  3O22 A;  2Q9S A;  1T0V A;  3FEN A;  4YMY A;  1YAL A;  1CQD A;  2FYE A;  1SWB A;  4CPE A;  1GT5 A;  3AUM O;  4K19 A;  2IZF B;  1HUC B;  4CDD A;  4Y0R A;  5B5F A;  2NNE A;  4EDE A;  2P8G A;  3D96 A;  2R73 A;  1KQX A;  1VYO A;  1PBO A;  5HAE A;  1GKA B;  1QY2 A;  5EDB A;  3CBC A;  1MDC A;  3HTY A;  1GLO A;  1RAV A;  5CYB A;  4P6E A;  4LKP A;  2FRA A;  1ZND A;  5IRU A;  4ON1 A;  5F6Z A;  3VG5 A;  4EKV A;  3FMZ A;  4Z28 A;  3UEV A;  5D8J A;  4U46 A;  3BX8 A;  1LNM A;  4AXM A;  3HWG A;  3KFI A;  2CBS A;  4TNN A;  3FLL A;  1OPA A;  3KZA A;  2E00 A;  3IUT A;  3MOR A;  2ACO A;  2VHF A;  4Y5D A;  1N9M A;  2DJF B;  2AUZ A;  2R9N A;  3PK2 A;  2DC6 A;  5EDC A;  5KO3 A;  5LJC A;  3MM0 A;  1TW4 A;  3WJE A;  2AS8 A;  2X34 A;  1SP4 B;  1VWR B;  2NQI A;  2MJI A;  2X8S A;  4CDF A;  1G85 A;  2A3F X;  1LIF A;  4YBU A;  1H91 A;  4OW0 A;  5EPQ A;  1PIP A;  2LBV A;  4MVE A;  1SXY A;  5BYP A;  1DZJ A;  4PP2 E;  1CBI A;  1BSY A;  1BGO A;  4QGV A;  2Z84 A;  9PAP A;  1ZRY A;  1LCV A;  1SWE A;  4LZU A;  3E3C A;  2BDZ A;  3HPE A;  4RF0 A;  1HQQ A;  1Y9T A;  1LIE A;  1JBH A;  1KL5 A;  4TKJ A;  3T2X A;  3BY0 A;  4I3C A;  3VG3 A;  1SWS A;  2PNS A;  3U0D A;  3BOW A;  5LKF A;  4O4S A;  2IZK A;  1X89 A;  2GTL N;  2FRS A;  1A57 A;  2OY1 O;  2BTW A;  2FO5 A;  3Q6L A;  1ML7 A;  2WEW A;  1E00 A;  1W6F A;  2FTD A;  1TLO A;  1HN2 A;  1JQP A;  4GD9 A;  5LJB A;  1LID A;  2JTC A;  1BBP A;  4QQ1 A;  3S3Q A;  4I9R A;  2GC9 A;  3WJC A;  3FA6 A;  4L3R A;  2BSZ A;  3IHP A;  4GJV A;  1ZNE A;  3PHX A;  2XU5 A;  4OS3 A;  3VHI A;  3BU9 A;  3EC5 A;  1LUQ A;  1JV4 A;  4YVA A;  1SLG B;  1VWI B;  1SWK A;  1LCZ A;  3O19 A;  3OVZ A;  1DFV A;  1FJ1 E;  2BHV A;  2Q2P A;  1EWO A;  3LXS A;  4YDA A;  2X8T A;  4REZ A;  3FA8 A;  3OJY C;  1QFT A;  1YP7 A;  2FT9 A;  2G8C O;  1CPJ A;  3ZW2 A;  4U8U O;  3CKF A;  1OEE A;  2DCA A;  1CVZ A;  5HA0 A;  5IO6 A;  1EF7 A;  1SWA A;  1VWM B;  1AEL A;  3WXE A;  3AKM A;  3RVV A;  2HH5 A;  1MVG A;  2KT4 B;  1SY3 A;  2OVS A;  1NPZ A;  4OKA A;  2W2B A;  4IUM A;  3B2J A;  4IB8 A;  1U0X A;  1F29 A;  4A60 A;  2QMI A;  3RY1 A;  4ORX A;  1Y9L A;  1YWC A;  5F6B A;  1EIO A;  3T2W A;  3KWZ A;  3KX1 A;  4BPV A;  3MTN A;  1HBQ A;  1VWA B;  5IXG A;  4O3X B;  4HXD B;  4BCS A;  3NQ3 A;  4O4O A;  1YWD A;  3ELZ A;  3O0U A;  1VJV A;  2WPU A;  1Y55 X;  4ODD A;  4TLJ A;  2FKJ A;  2RTP B;  3CBS A;  2O6X A;  3MVF A;  1SRI A;  1YZB A;  4I60 A;  5D45 A;  5JZE A;  3X00 A;  4ZH6 A;  3V6E A;  4CDE B;  1CTE A;  2Z4H A;  3RDU A;  2R6N A;  1YK8 A;  2XKL A;  1VWO B;  5LJE A;  1MEG A;  1A3Y A;  2Q4N A;  3FDC A;  4ZFX A;  3MX7 A;  4I05 A;  1QQS A;  2ZAI A;  4FJC A;  2OL6 O;  4BGF A;  1BEB A;  2DJG B;  4ZJ0 A;  2RD7 C;  4YKO A;  4IBA A;  1GCB A;  1PVJ A;  3EW1 A;  4GH7 A;  1GT1 A;  1UZ2 X;  3C76 X;  4IB6 A;  3BBA A;  1U9W A;  3UEW A;  1EWL A;  1SY1 A;  3USV A;  1B4M A;  1ERB A;  1XKG A;  4GET A;  4I6S A;  3F5V A;  2QO5 A;  2IZI A;  1KL4 A;  1URE A;  5BVS A;  1PCI A;  3JS1 A;  5EED A;  3ZI8 A;  2ATO A;  1PBY A;  2BDL A;  2XU4 A;  1EWM A;  3TGA A;  3HWE A;  1HY2 A;  2CZU A;  1I05 A;  5EZS A;  1QFV A;  1JJJ A;  5IO7 A;  3P5V A;  4XR7 A;  2WBF X;  1LKE A;  3APU A;  2UZJ A;  2IZD B;  3PH5 A;  5HWZ A;  3BPM A;  3BPF A;  2IZJ A;  3P02 A;  3S5V A;  1MX7 A;  1SWF A;  2A13 A;  1GX3 A;  5HCE C;  3ERV A;  1KFU L;  3SZH A;  1AYU A;  1W5R A;  1U9X A;  3FW4 A;  1L6M A;  4LQZ A;  1W4T A;  1R0U A;  2ASN X;  4N79 A;  1T68 X;  2QO6 A;  3S60 A;  4ZHG A;  4FQB B;  4R0B A;  4TKH A;  1KT4 A;  3MG5 A;  3NQK A;  1SWN A;  4IAB A;  1AU2 A;  3H6S A;  2QOM A;  4B55 A;  1QG5 A;  3D9W A;  2GFO A;  3PT2 A;  3SZI A;  1UKF A;  5FPW A;  4Z2P A;  4YYV A;  2OF8 A;  4GK9 A;  7PCK A;  1ADL A;  2P7U A;  3LFY A;  3WVM A;  3N91 A;  3H3I A;  3RDS A;  4NV7 A;  1EUO A;  5H9K A;  1STS B;  1SWG A;  1NQM A;  2VFB A;  3NP1 A;  2RTH B;  2GTF X;  3NX2 A;  3FW5 A;  1SRJ A;  2OVD A;  2DZZ A;  3SZJ A;  4ZTB A;  1AU3 A;  3OE3 A;  3D6S A;  1AEC A;  3MHS A;  3MP2 A;  4YYQ A;  3MTV A;  1PXV A;  1IFC A;  3C0R A;  3CQR A;  3CMP A;  4GZV A;  4BQU A;  2FQ9 A;  1F2B A;  4OVZ B;  3G7X A;  5HCC C;  4MZS A;  4OEM A;  2FS6 A;  1BWY A;  1O1U A;  3RKG A;  1NP4 A;  3BCN A;  3VHH A;  2EU7 X;  3PQS A;  2RTE B;  4RNA A;  5IRA A;  4A1Y A;  1K3B B;  4GGZ A;  2Z4I A;  3EBK A;  1Y4H A;  1MEP A;  2GTL M;  5IRW A;  1ALB A;  3NBX X;  5FAZ A;  2AGA A;  4RKX A;  3HWD A;  3FR5 A;  5HA1 A;  1S44 A;  1MK5 A;  2YG2 A;  5HZ8 A;  4GUZ A;  1U9Q X;  3PBH A;  1QY0 A;  1K3B A;  3UAQ A;  2NQA A;  1YWA A;  3IEJ A;  3HWN A;  3V6C A;  3QJ3 A;  1MX8 A;  2G8J A;  4XUI A;  3KFF A;  3ZUO A;  3RSW A;  4ALO A;  2VFC A;  1I4U A;  2YJ9 A;  2CM4 A;  2FE8 A;  3B21 A;  4AZQ A;  4KC8 A;  1XKI A;  3STM X;  3LV4 A;  2BS5 A;  4ORU A;  1OBU A;  1O8V A;  4PAD A;  3W30 A;  1VSN A;  1WBI A;  2HNX A;  3NPO A;  3PRP A;  2LFO A;  3TF6 A;  1I06 A;  3AKN A;  2G79 A;  4M0W A;  1JMZ A;  1PM1 X;  5EGW A;  4BOQ A;  3TGB A;  2KD2 A;  2OFM X;  1LEL A;  2FHN X;  5KHP A;  2KW1 A;  1VYG A;  3I06 A;  1JJX A;  5L8I A;  1DEU A;  2R9C A;  3EM0 A;  1VWH B;  5B2A O;  3RNV A;  3OIS A;  1EII A;  1S2P A;  4BOE A;  3DTQ A;  4D8I A;  3DF0 A;  4QH6 A;  1PPD A;  3P6G A;  3BDR A;  1DZK A;  2RTR B;  5JA7 A;  3IFB A;  5B3M O;  2G78 A;  2OFB A;  4BQV A;  2OF9 A;  3VG6 A;  2X4M A;  4G54 A;  2QCB A;  2BU3 A;  4CSB A;  3BX7 A;  4NNT A;  1GM6 A;  3SAO A;  2JW1 A;  1B56 A;  3RWX A;  3PH6 A;  1TOU A;  3CBK A;  3HWF A;  5B5G A;  4AZP A;  3P6D A;  4GDA A;  4D8E A;  4YFQ A;  4QZU A;  1GKA A;  2DOS A;  3RBY A;  3IOQ A;  2JU3 A;  5AJC A;  1SWL A;  2I5V O;  2IZL B;  3RE5 A;  4MIR A;  2JGS A;  2AUX A;  3HOL A;  3BU1 A;  1SY0 A;  3FR2 A;  1VWL B;  1A2D A;  2G8E A;  1UYN X;  3B2K A;  2CB5 A;  3BLG A;  3OBL A;  5FQ6 E;  3VE2 A;  1NLJ A;  4QBB A;  4GDZ A;  4QYN A;  2OY5 O;  1MHW A;  4ZUX U;  5F58 A;  3PQU A;  5L8O A;  3WYP A;  4BS6 A;  2Y32 A;  1JYD A;  5B29 A;  4Z6J A;  3KKU A;  2IZG B;  4FBV A;  4AZR A;  1SXW A;  3BC3 A;  4IRW A;  2DJF A;  3ZQ3 A;  4ZHD A;  2MF6 A;  4X6J A;  1NDJ A;  3ZZV A;  4YGH A;  3RDX A;  3H8B A;  1G5W A;  2HZR A;  3B2L A;  2HYS A;  3RDM A;  2AMM X;  2C1S A;  1Z24 A;  2E4J A;  1LIC A;  4K7C A;  3T6L A;  4RF1 A;  4WUR A;  1PPP A;  4A1H A;  1PTS A;  4ID2 A;  3JSQ A;  2JQF R;  1SMP I;  3I0A A;  5A24 A;  4GUA A;  3HOE A;  5K06 A;  3K24 A;  4KII A;  1NB3 A;  3WXG A;  3RE6 A;  2KTD A;  3EW2 A;  4N7C A;  3ZWE A;  3U9P C;  4LKT A;  4IAW A;  4CPI A;  3Q34 A;  4GJS A;  1AVE A;  4QNI A;  4GNW A;  1YVB A;  1SNK A;  4GRJ A;  3STK A;  4I07 A;  2Y3F A;  3FEP A;  4FIP A;  3EBW A;  2X45 A;  4N7D A;  4Y0P A;  2MWH A;  5HZQ A;  1HQP A;  4TKB A;  2IBI A;  2AKQ A;  4YV8 A;  3FYF A;  5K16 A;  1NL6 A;  5KID A;  4BOU A;  3PP6 A;  5EEE A;  3RZY A;  5JR8 A;  4YYU A;  1OBQ A;  4ZR2 A;  4UU3 A;  2LA7 A;  4KCA A;  4L1N A;  4W5C A;  5K67 A;  3WBG A;  1TOW A;  4MIS A;  2Y5B A;  1IWD A;  2C0Y A;  4YDB A;  4YCH A;  2AYO A;  2F73 A;  4MZO A;  4LZV A;  4N8W A;  5L8N A;  2A5C A;  4XMH A;  2F01 A;  2A0A A;  4HPA A;  1MOY A;  2ALL X;  2O62 A;  1ME3 A;  1SWU A;  4YYS A;  3VU1 A;  3IMA A;  1CBS A;  1KFX L;  1CJL A;  5H9A A;  3H89 A;  2A8G A;  4CK4 A;  3MBT A;  2BC3 A;  3WJF A;  1T8V A;  4A5U A;  4BX5 B;  3CH2 X;  4W5B A;  2OZ2 A;  3WZO A;  2AT5 X;  4YYW A;  1PAD A;  3HHA A;  3ZW1 B;  4ML7 B;  4ZGU A;  2F09 A;  4BX5 A;  2X56 A;  1Y0G A;  4AZN A;  3OF8 A;  1X8O A;  1BSO A;  2OVE A;  2A2U A;  1N4J A;  4AZO A;  4QYP A;  4BVM A;  2YJ8 A;  1KXR A;  1TL9 A;  2AT3 X;  1JIW I;  1YUP A;  3ZW1 A;  1RLB E;  4XMF A;  2RTF B;  3WYQ A;  1FEL A;  3ZW0 B;  1LF7 A;  1DF0 A;  4WFU A;  1OEK A;  1X8P A;  2AVW A;  4RY2 A;  4YFR A;  1LIB A;  4P16 A;  1PBH A;  1DF3 A;  2VDF A;  2IZE B;  2RTM A;  2GJ5 A;  2ARY A;  4FBR A;  5EZQ A;  3ZUI A;  1FEM A;  4HPC A;  2P86 A;  4CDE A;  1YWB A;  1QMY A;  1TXL A;  5HZ6 A;  2K23 A;  2OYB O;  2LB6 A;  5FQ8 E;  5CVM A;  1PEE A;  3FR4 A;  5CHT A;  1FTP A;  3AI8 A;  2BS6 A;  1ZNG A;  4Q8H A;  1KT6 A;  3TZS A;  1LFO A;  1HMR A;  4ZHF A;  2FWV A;  1I78 A;  4U8U M;  4OMW A;  2DJG A;  5B10 O;  1X9Y A;  3BS2 A;  1SWP A;  2X8F A;  4OMX A;  2I5Z O;  3C78 X;  4ORY A;  2RQ0 A;  3WZP A;  2FUD A;  1SRE A;  3GE2 A;  3CBJ A;  3PW3 A;  2NP1 A;  3PNR A;  2ACP X;  2X32 A;  3JQO A;  5JD2 A;  5CE4 A;  1GGL A;  4Y0S A;  1N43 A;  2RTQ B;  2OFA A;  4KLB A;  2NND A;  4CDC B;  3WZN A;  3ZUA A;  2FR3 A;  3MJ5 A;  4DQ3 A;  2WQ9 A;  5LJH A;  1OPB A;  1OSP O;  1LPJ A;  3M99 A;  1AIM A;  4QGX A;  4CZW A;  3VE1 A;  2JRI A;  2C4I A;  4GU8 A;  3PPT A;  5CSE A;  4DNE A;  3H8C A;  4OEL A;  4U9C A;  2OUL A;  4CDC A;  1VWQ B;  1X8N A;  3APV A;  1E2T A;  1XCA A;  4M7M A;  4PP1 A;  3STN A;  2BT9 A;  3KVN A;  1N7Y A;  4QRL A;  2R9O A;  1I04 A;  4BBO A;  2NNQ A;  2ZSC A;  3WZQ A;  3PED A;  1BM5 A;  2WSJ A;  1U9V A;  1E06 A;  1MDW A;  1NGL A;  2Y6E A;  5F1E A;  4BX6 B;  1VWN B;  1ICN A;  4O3Z A;  5F02 A;  4YGZ A;  1KOI A;  2GTL O;  1NB5 A;  4I04 A;  2X46 A;  3D4R A;  1OEJ A;  4BSQ A;  4X6H A;  1QOL A;  2PY1 A;  4ORS A;  4HPB A;  5HTD A;  1KHQ A;  3DSZ A;  4CPF A;  3HD3 A;  4MVI A;  4MVL A;  2YJB A;  4WBK A;  3QSD A;  4QRX A;  1S4V A;  3CR6 A;  3PEC A;  3P24 A;  2QM9 A;  4INN A;  1GXA A;  3GAQ A;  3MHH A;  2W2F A;  1ACD A;  1YT7 A;  1IJ8 A;  2H7J A;  4Y0Q A;  5H9L A;  3L4R A;  5EZ2 A;  2OY7 A;  4BOP A;  1BSQ A;  2MM3 A;  2Y3E A;  3T1D A;  3VHM A;  1CBR A;  2LBA A;  3P6H A;  2L67 A;  5CVO B;  4KT5 A;  2KTS A;  1DZM A;  1ITO A;  4IP3 A;  2CZT A;  4Z2O A;  3SLO A;  1STP A;  1QXP A;  3VG4 A;  1PPN A;  4IMN A;  1X8Q A;  4YBP A;  4OVZ A;  1BRP A;  4Q8G A;  5LJD A;  1KFF A;  1E02 A;  5HZ9 A;  1U17 A;  2AIM A;  3P6C A;  4EXZ A;  3H7D A;  3RDO A;  1ME4 A;  3CQN A;  5K68 A;  1IKE A;  4YVB A;  4ORW A;  3S26 A;  2RTA A;  3IV2 A;  5E6J A;  1DC9 A;  1AB0 A;  5AJB A;  3TMP A;  2OP3 A;  4FBO A;  1UYO X;  4YH0 A;  3C9E A;  4O49 A;  4GGR A;  1HXZ A;  3VGW A;  4YKM A;  1K24 A;  4IB7 A;  4TJZ A;  1HXL A;  2BLG A;  4Y59 A;  1KQW A;  2RCT A;  4XMD A;  1Y53 X;  1SRF A;  5AQ6 A;  1VWD B;  3WJB A;  1SXU A;  5CHV A;  3OVX A;  2E03 A;  1RXJ A;  3OF9 A;  4P6G A;  2L68 A;  4MSX A;  4BOZ A;  1NQN A;  2R74 A;  3KQ0 A;  1IIU A;  2F7D A;  1F2A A;  1SA8 A;  1JMX A;  1NP1 A;  4NYR A;  1SLE B;  4ARH A;  1YP6 A;  4U8U N;  2JQG R;  4PI3 A;  2MO5 A;  4I3D A;  2AF5 A;  4C5P A;  1BP4 A;  4Z2V A;  1ICF A;  1MEM A;  1TU6 A;  5C0N A;  5D47 A;  1KZX A;  3HHI A;  3BSZ E;  4YGG A;  5DPQ A;  1S7D A;  4CDD B;  5BVQ A;  4TQ2 A;  1E5P A;  1EWP A;  4ZGF A;  3QQ2 A;  4D6B A;  4COT A;  2VHS A;  1Y52 X;  3WXQ A;  4JHQ A;  1RXK A;  3KFQ A;  1GEC E;  3B79 A;  4MI7 A;  1VWJ B;  1SWO A;  2JN3 A;  1U18 A;  2X55 A;  2PBH A;  2R9F A;  1DV9 A;  4HWM A;  3BB7 A;  3S5X A;  5H9N A;  4OS0 A;  1CBQ A;  3QKG A;  1O1V A;  5HCD C;  1ERX A;  4BS5 A;  5CVN B;  1MIR A;  4AZM A;  4YFP A;  1NBX A;  3KFH A;  3S3R A;  3VPJ E;  4MM3 B;  3RVX A;  2K62 A;  3KW9 A;  2ACT A;  4EEJ A;  1B8E A;  2HXZ A;  4PJ2 A;  1AU0 A;  1BY8 A;  4XME A;  4AYH A;  4I9S A;  1F2C A;  4XZX A;  1AYV A;  1AVG I;  5FFH A;  2P0R A;  3K3L A;  2WQA E;  4YCE A;  4CDF B;  2IFB A;  4X6I A;  1SRH A;  2WWP A;  5BVT A;  4O3Y A;  1SXX A;  1VWK B;  1ICM A;  3LHN A;  1TVQ A;  2ZAG A;  2RCQ A;  3RVW A;  4DMX A;  3AEH A;  2HKD A;  3WOV A;  1ZCM A;  4BJ8 A;  1MS6 A;  2HZQ A;  4I3B A;  2E02 A;  1GT4 A;  2RTK A;  1IKJ A;  2RTO B;  2DCB A;  2CBR A;  2LKK A;  4AXL A;  2DC9 A;  2HHN A;  3I3T A;  2DC7 A;  2YJ2 A;  3RY2 A;  3N4C A;  1O0E A;  4WFV A; 
#chains in the Genus database with same CATH homology
 2AVW A;  4RY2 A;  4NV7 A;  1PBH A;  3LTW A;  2XU3 A;  3P5U A;  2NQG A;  2ARY A;  2VFB A;  4NV8 A;  2P86 A;  4CDE A;  1QMY A;  1YAL A;  1CQD A;  2FYE A;  2DZZ A;  3U8E A;  1AU3 A;  1FH0 A;  5CVM A;  2PRE A;  3D6S A;  1AEC A;  1HUC B;  1AYW A;  4CDD A;  5CHT A;  4N4Z A;  1M6D A;  3AI8 A;  3MHS A;  4YYQ A;  2B1M A;  3KWB X;  1PXV A;  4Q8H A;  3TNX A;  2DJG A;  1GLO A;  1X9Y A;  2FQ9 A;  1F2B A;  2FUD A;  1Y08 A;  4P6E A;  2FRA A;  4QRV A;  1A6R A;  3CBJ A;  4MZS A;  4OEM A;  3PW3 A;  4YYR A;  3BCN A;  3PNR A;  1PE6 A;  4WA6 A;  2GHU A;  4KLB A;  2F1G A;  2NQD B;  4CDC B;  4AXM A;  3ZUA A;  1K3B B;  1Y4H A;  3M99 A;  1AIM A;  2E00 A;  4CZW A;  3IUT A;  3MOR A;  4GUZ A;  1U9Q X;  3PBH A;  2VHF A;  3H8C A;  4OEL A;  2OUL A;  4CDC A;  2DJF B;  1K3B A;  2AUZ A;  2R9N A;  1E2T A;  1CV8 A;  2NQA A;  2DC6 A;  4PP1 A;  3IEJ A;  3HWN A;  2AS8 A;  3V6C A;  3QJ3 A;  1SP4 B;  3P5W A;  2DCD A;  2G8J A;  4XUI A;  2R9O A;  2NQI A;  2VFC A;  2YJ9 A;  4CDF A;  1U9V A;  1MDW A;  4PAD A;  2Y6E A;  1YK7 A;  5F02 A;  1VSN A;  1PIP A;  1NB5 A;  4I04 A;  4PP2 E;  4BSQ A;  4X6H A;  1BGO A;  1QOL A;  9PAP A;  5EGW A;  1KHQ A;  2BDZ A;  3HD3 A;  1ZIV A;  2YJB A;  3I06 A;  1U5I A;  2YJC A;  1DEU A;  2R9C A;  3WXF A;  3E1Z B;  3QSD A;  3OIS A;  4QRX A;  1S4V A;  2PNS A;  3BOW A;  3MHH A;  3DF0 A;  4QH6 A;  1PPD A;  1POP A;  4DMY A;  4W4U A;  1YT7 A;  5JA7 A;  2AU1 A;  2H7J A;  2FO5 A;  4BQV A;  4G54 A;  1AU4 A;  1W6F A;  2FTD A;  1TLO A;  1JQP A;  5JH3 A;  5CVO B;  3N3G A;  2G6D A;  1ITO A;  3S3Q A;  3O1G A;  3CBK A;  1QDQ A;  3K8U A;  1QXP A;  1NQC A;  3IOQ A;  2PAD A;  1PPN A;  2IPP B;  2DC8 A;  2CIO A;  2BSZ A;  1Q6K A;  3IHP A;  4Q8G A;  8PCH A;  2AUX A;  2AIM A;  2XU5 A;  1BQI A;  3H7D A;  3NHE A;  1ME4 A;  2G8E A;  2CB5 A;  4YVA A;  1NLJ A;  4QBB A;  3IV2 A;  1MHW A;  3OVZ A;  4ZUX U;  1EWO A;  3LXS A;  2OP3 A;  1CS8 A;  4BS6 A;  3C9E A;  1CPJ A;  2DCA A;  4QRG A;  3KKU A;  1CVZ A;  1EF7 A;  3BC3 A;  3WXE A;  2DJF A;  3RVV A;  2HH5 A;  2AYN A;  1NPZ A;  1F29 A;  4X6J A;  1ATK A;  5J94 A;  5CHV A;  3OVX A;  3H8B A;  2E03 A;  3KWZ A;  3OF9 A;  4P6G A;  3KX1 A;  4MSX A;  4BPV A;  3MTN A;  2F7D A;  1F2A A;  1THE A;  4K7C A;  3N3K A;  6PAD A;  1PPP A;  3O0U A;  2JQF R;  1VJV A;  2B1N A;  2JQG R;  4PI3 A;  5A24 A;  3K24 A;  3PDF A;  3WXG A;  1NB3 A;  2O6X A;  4C5P A;  1BP4 A;  1ICF A;  1MEM A;  1PPO A;  2E01 A;  3V6E A;  4CDE B;  1CTE A;  1TU6 A;  2R6N A;  1YK8 A;  3HHI A;  1YVB A;  1SNK A;  1MEG A;  4CDD B;  4I07 A;  4FIP A;  1EWP A;  4I05 A;  2FRQ A;  2VHS A;  4FJC A;  3F75 A;  4BGF A;  2DJG B;  2IBI A;  4YV8 A;  3KFQ A;  5K16 A;  2FT2 A;  1NL6 A;  1GCB A;  1GEC E;  3B79 A;  1CB5 A;  3GCB A;  2PBH A;  1U9W A;  2R9F A;  1EWL A;  4YYU A;  3USV A;  3CH3 X;  4HWY A;  4BS5 A;  5CVN B;  1MIR A;  1XKG A;  1GMY A;  3F5V A;  4W5C A;  2Y5B A;  1IWD A;  2C0Y A;  1PCI A;  3S3R A;  3RVX A;  2AYO A;  2HD5 A;  2ATO A;  5PAD A;  4MZO A;  1KHP A;  2BDL A;  4N8W A;  3KW9 A;  2XU4 A;  1EWM A;  2ACT A;  4FK5 A;  2XU1 A;  1ME3 A;  5EF4 A;  2HXZ A;  3P5V A;  4YYS A;  3IMA A;  4XR7 A;  2R9M A;  2WBF X;  1AU0 A;  1BY8 A;  1KFX L;  2DZY A;  1CJL A;  3H89 A;  1F2C A;  1AYV A;  3BPM A;  2P0R A;  3KSE A;  3BPF A;  4CDF B;  4X6I A;  3BWK A;  1STF E;  1CSB B;  3CH2 X;  3P5X A;  4W5B A;  2OZ2 A;  1GX3 A;  3ERV A;  1KFU L;  3RVW A;  4YYW A;  1PAD A;  4DMX A;  1AYU A;  3K9M A;  1U9X A;  1W5R A;  3HHA A;  1ZCM A;  2G7Y A;  1W4T A;  1MS6 A;  4N79 A;  2E02 A;  3OF8 A;  3QT4 A;  2DCB A;  2YJ8 A;  2DCC A;  1AU2 A;  1KXR A;  1TL9 A;  4AXL A;  3H6S A;  2DC9 A;  2HHN A;  4B55 A;  3I3T A;  3D9W A;  2GFO A;  5FPW A;  2DC7 A;  2YJ2 A;  4YYV A;  3N4C A;  7PCK A;  1O0E A;  1DF0 A;  2P7U A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...