4OEMA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
367
structure length
280
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 280
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oemA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oemA02
1CJLA 3BWKA 2R9NA 2VHSA 1U9WA 4W4UA 4YYQA 3F75A 2Y6EA 1MS6A 1PPNA 3WXGA 6PADA 3TNXA 2HH5A 1CS8A 2XU1A 1AU3A 3BC3A 1NB3A 3D6SA 5FPWA 3RVXA 1GECE 2OP3A 5A24A 2AYNA 1PXVA 4MZSA 3M99A 2AS8A 3KW9A 1PPOA 3O1GA 4PADA 4N8WA 4K7CA 3S3QA 1AU2A 2GHUA 3OF8A 2DCCA 3WXFA 2AUXA 4PP1A 3KKUA 1AU4A 1EWLA 2CB5A 4DMXA 3IEJA 8PCHA 4DMYA 2XU5A 2DZZA 7PCKA 3MTNA 4FIPA 2FYEA 1QXPA 1KHPA 1VJVA 1JQPA 3QSDA 2AUZA 3KX1A 1AYWA 1CSBB 4RY2A 1CB5A 3IV2A 4QH6A 2IBIA 3PNRA 3OVZA 3U8EA 2YJ9A 3H8BA 4YVAA 3CBKA 3DF0A 1AIMA 1KHQA 4CDDB 4MZOA 5CVMA 3IOQA 4P6GA 2DCAA 3QJ3A 3NHEA 1TU6A 3MORA 3P5XA 2FRAA 1U9QX 1NL6A 3N4CA 1GLOA 1AYVA 2DCDA 3IMAA 3MHSA 3HD3A 3ERVA 3K8UA 5CHVA 4X6JA 1KFXL 3KWBX 3CH3X 2JQFR 2GFOA 5F02A 1X9YA 2C0YA 1DEUA 2Y5BA 2JQGR 4FK5A 2G7YA 1MIRA 4PP2E 1M6DA 2DJFB 1YALA 3HHIA 4OEMA 3AI8A 4YYSA 2VHFA 2YJCA 3O0UA 3CBJA 1SP4B 2YJ2A 2BDLA 1Y08A 2NQDB 3H6SA 4W5CA 4P6EA 3LFYA 3N3GA 2OZ2A 3BPMA 1CPJA 3IUTA 3F5VA 3IHPA 1TLOA 4BS6A 1PPDA 1CV8A 2G8JA 1F2CA 4ZUXU 1BY8A 3BPFA 3QT4A 1ICFA 4Q8GA 2E00A 1QOLA 2FO5A 5EF4A 2R9MA 2E01A 1POPA 2WBFX 1Y4HA 4CDEB 1PIPA 2R9CA 2FRQA 3V6EA 1ZCMA 3OVXA 2YJBA 4PI3A 3LXSA 1EWMA 3RVWA 1QDQA 3E1ZB 1YT7A 3PBHA 2F7DA 2YJ8A 1U9XA 4QRVA 5CVNB 1VSNA 1YVBA 4CDDA 2FUDA 2DC6A 1S4VA 1GMYA 1EWOA 2DZYA 2BDZA 3K9MA 3N3KA 1PBHA 1MHWA 2IPPB 1EWPA 2PBHA 4BPVA 4BSQA 2HD5A 4YYVA 1F2AA 3BCNA 3C9EA 1PCIA 2ARYA 2PREA 1GCBA 3GCBA 1AYUA 2G8EA 5K16A 3PW3A 4G54A 1PE6A 4MSXA 2OULA 2P86A 3RVVA 2E02A 4QBBA 4WA6A 5JA7A 2R9FA 4AXLA 1AECA 4BS5A 3I06A 3P5VA 2DC9A 2P7UA 2DJFA 2DJGA 4QRXA 3H8CA 3ZUAA 3HHAA 1IWDA 1DF0A 4CDFB 1NLJA 4CDCB 2AIMA 3KSEA 1K3BB 1CVZA 1BP4A 1TL9A 2AVWA 4I04A 4I05A 2PADA 5CHTA 1ITOA 2R9OA 3H7DA 1THEA 1MDWA 1MEGA 4X6IA 2HHNA 1NPZA 1CQDA 2DC7A 1MEMA 4AXMA 4YYUA 5EGWA 1U9VA 2NQIA 4CDEA 3KFQA 1NB5A 4Q8HA 4BQVA 2H7JA 3PDFA 3I3TA 2F1GA 1ZIVA 2NQAA 1STFE 2AU1A 1PADA 1O0EA 4W5BA 1FH0A 1SNKA 2HXZA 2E03A 2ATOA 9PAPA 3B79A 1ATKA 2XU3A 2FTDA 4KLBA 4YYRA 1BQIA 2PNSA 1NQCA 3V6CA 4CZWA 3OISA 1HUCB 3K24A 1QMYA 1ME4A 3KWZA 1U5IA 4XR7A 4FJCA 1BGOA 2B1MA 1F29A 4N4ZA 3WXEA 2B1NA 2R6NA 4YYWA 3P5UA 1A6RA 1PPPA 2NQGA 1XKGA 1YK7A 2DCBA 4I07A 4X6HA 2DC8A 2G6DA 1CTEA 4YV8A 5PADA 1AU0A 3CH2X 2P0RA 1YK8A 3OF9A 1ME3A 5J94A 3USVA 4HWYA 4OELA 4N79A 2AYOA 4CDFA 2CIOA 1EF7A 4CDCA 4QRGA 3S3RA 1K3BA 2FT2A 5CVOB 3P5WA 2XU4A 4XUIA 3HWNA 3MHHA 3H89A 1KXRA 1F2BA 1Q6KA 5JH3A 2FQ9A 1KFUL 2DJGB 2O6XA 2ACTA 3BOWA
chains in the Genus database with same CATH superfamily
3BWKA 2GTLO 1U9WA 4BX5B 1B0OA 5H9NA 4R0BA 4NNTA 3OJYC 3RY1A 1SWUA 1GX8A 4LZUA 1NB3A 5FPWA 2AGAA 2OP3A 1X8QA 2RTJA 1E06A 1ADLA 3T2WA 3WOVA 1LDOA 1EI5A 2G8CO 4N8WA 4PADA 5B2AO 1AU2A 2PI3O 3FEPA 1YUPA 4EXZA 4BOZA 2GHUA 1P6PA 1LUQA 3OF8A 4GGRA 4MIRA 4PP1A 3KKUA 8PCHA 3P6CA 1VWNB 1I9HA 2DZZA 4IBAA 3MTNA 4FIPA 1HXLA 2POAA 1CBRA 3KFHA 1A57A 2IZCB 2RTQB 1PM1X 4JO6A 2JU7A 4O4XA 1AYWA 5AJCA 1Y55X 4QGVA 5HZQA 4RY2A 4DNEA 1SLFB 2G79A 5F58A 3S26A 5EEDA 4HPCA 1DC9A 3H8BA 2WEXA 3IFUA 1AIMA 3B2KA 1KHQA 2QCBA 5F6ZA 1QY0A 2DCAA 2IZEB 3QJ3A 5LJCA 4KCAA 2MF6A 3MORA 2AT8X 3RDXA 3P5XA 1STPA 4RUNA 2FRAA 3RDQA 1VYOA 3N4CA 1I05A 1OBUA 2C1QA 4IMNA 3WJDA 3D96A 2DCDA 5HCDC 1DF8A 4A5UA 3HD3A 4UU3A 1HQPA 5CHVA 4X6JA 2OL8O 3CH3X 1QABE 4Z2VA 1KT5A 1U0XA 1JJJA 4BX5A 2RTGB 2JQGR 5LJDA 1UYNX 2FR2A 3WJBA 4YYSA 2IZBA 4A60A 2HYSA 1NP4A 3APWA 1SP4B 2YJ2A 2KT4B 4W5CA 4P6EA 4QZTA 2OZ2A 3EW2A 1CPJA 1KT4A 4AZQA 2AVIA 4BS6A 1PPDA 3P6GA 4I6SA 2HWKA 2G8JA 1NP1A 4ZGUA 4L1NA 3MBTA 1N43A 4M6SA 2Z4HA 1TXLA 4O3XB 3H3IA 4ZHHA 1YWDA 1DFVA 1RLBE 4AZPA 3VG4A 2E00A 1EW3A 5EPQA 3EW1A 2E01A 1POPA 4CDEB 3B2IA 4EQAC 2BLGA 2OY7A 1LIFA 2FRQA 1NQNA 2BS6A 4NYQA 2RTRB 3LXSA 4GD9A 4NNSA 1PMPA 4OS0A 3RVWA 1LELA 2I5ZO 5CVNB 2LFOA 4PJ2A 2FUDA 3I0AA 2ZAIA 3P6HA 1GMYA 3W31A 2FRSA 4I9SA 4HPDA 2F73A 3LV4A 4TJZA 3WJEA 2OY1O 2GC9A 1EWPA 2PBHA 2X45A 2HD5A 1F2AA 1SWJA 3C9EA 1HN2A 1PCIA 2PREA 1RXKA 3FLLA 2G8EA 1QG5A 1CJ5A 3ELZA 4ODDA 2P86A 2E02A 4QBBA 3JQOA 4GJSA 4GK9A 3Q6LA 1IIUA 3FA7A 3I06A 3OBLA 3WYQA 4Y0QA 4QQ1A 3BRNA 5LJHA 3HK1A 1ZNHA 2G7BA 3RY2A 1N9MA 1JYDA 5FFHA 3P02A 2AF5A 1DF0A 1ACDA 2RTLA 1TVQA 3KSEA 1K3BB 1MDCA 2AVWA 4GGTA 5EZQA 4I04A 1ITOA 3VG3A 2R9OA 1QFTA 4ID2A 1THEA 2GTFX 2GJ5A 1SY2A 3O2YA 5EGWA 4CDEA 1NB5A 4U8UM 3ZW1B 2Q4NA 4BQVA 4XMGA 2F1GA 3Q34A 2NQAA 1XCAA 3MM0A 4IP3A 5B5GA 4EEJA 1RSUB 4W5BA 1SNKA 1GT5A 1ZNLA 1JMZA 3P24A 2RTCB 4CPEA 1R0UA 2YG2A 5D4AA 3KFIA 2XU3A 4GU8A 4ALBA 2PNSA 3V6CA 2LKKA 2OL6O 2L5PA 1JMXA 1HUCB 1H91A 2MM3A 4BQUA 4WBKA 1QMYA 1SWLA 2QOSC 2R6NA 1TOWA 4CV7A 4D6BA 4O4OA 2WUTA 3BB7A 1X8PA 4GKCA 2DCBA 3UAQA 2G6DA 4OMWA 5CHKA 3SZIA 1ALBA 2RN4A 1CTEA 3RZYA 2K23A 1SLDB 3CH2X 3MVFA 1OBPA 1AB0A 3OF9A 2A13A 2P8GA 2X55A 2AH7X 4QRLA 5H9KA 2CIOA 2WEWA 1EF7A 1S7DA 4QRGA 1K3BA 5CVOB 3SOTA 3KQ0A 1JZUA 2IZJA 1LDQA 3MP2A 1SWCA 4ZHFA 4TKJA 1SA8A 2ZSCA 1MOYA 4RUUA 1VWKB 1GT4A 2RTOB 4QYPA 2FQ9A 2X56A 3RE5A 1RAVA 4EDEA 1SRGA 2DJGB 3STNA 2OVDA 4HXDB 2BHVA 3ZW1A 2QO4A 1CJLA 1O8VA 5L8OA 2R9NA 1OEKA 1VYFA 3C78X 2F01A 4W4UA 4FQBB 3F75A 4BOPA 1LIBA 1FELA 4YCHA 6PADA 2HH5A 1CS8A 1AVDA 1X89A 2WQ9A 2IZAA 1AU3A 3BC3A 3D6SA 3P6DA 4GUAA 2O62A 4P16A 4UU2A 3FA8A 2AT6X 1BJ7A 3CQNA 5BVSA 3M99A 3KW9A 3O1GA 2JN3A 4K7CA 1LPJA 3CBCA 5F2BA 5B27A 2HZQA 3AKMA 2DCCA 3WXFA 4Z27A 1EWLA 4DMXA 2XU5A 2XKLA 3S5VA 1EIOA 2ALLX 1DV9A 4GH7A 1KHPA 2AL0X 3FW4A 3FYFA 3B2JA 1VJVA 4QYNA 4ZFXA 3QSDA 4YVBA 3NQKA 3NP1A 3GE2A 2J7QC 3IV2A 2LB6A 4ON1A 2C4IA 5EDBA 2YJ9A 1IJ8A 4YVAA 3DF0A 3OE3A 2JU3A 4CDDB 2C1SA 4NV7A 1SWAA 5CVMA 3B2LA 3IOQA 1RXJA 5HA1A 3WJGA 5JD2A 3V8UA 5BVTA 1SWSA 3VG5A 4Y59A 1U9QX 3E9SA 2OVEA 4ORSA 4XMEA 2DOSA 1CBSA 3BY4A 4FBVA 3JS1A 1AYVA 3MHSA 3ERVA 2A5CA 4CK4A 2W2FA 3CWKA 2JQFR 5F02A 4ZTBA 3FR4A 5HZ9A 1SMPI 2Y5BA 2L67A 1T0VA 2X32A 4BBOA 1JBHA 4IAWA 3EBKA 3FDCA 4CPIA 1MIRA 3EYCA 5D47A 3VE1A 1YALA 3HHIA 2PY1A 1QY1A 3AI8A 3RKGA 2VHFA 2OYBO 2ACPX 2AT3X 3O0UA 3ZQ3A 3LHNA 3HWDA 4ALOA 1SXWA 3H6SA 4MVLA 1AVGI 2ANSA 3N3GA 3CKGA 1ERXA 4QNIA 4U9CA 3IUTA 3F5VA 3IHPA 1TLOA 4U3QA 2JRIA 1CV8A 5FQ6E 2X8TA 2AMMX 4ZUXU 4O49A 3BPFA 3FR2A 4YFPA 3KFGA 2R9MA 2RQ0A 1NDJA 3PHXA 4ORXA 2R9CA 1MVGA 2CM9A 3OVXA 1DZMA 4PI3A 3ZW0B 4YGGA 1U17A 3APXA 4Y5DA 3APUA 1QDQA 1YWBA 3WZNA 3PBHA 1FE3A 4IABA 2UZJA 3GAQA 3STKA 1LIDA 2R74A 2BC3A 2RTIB 1QQSA 4CDDA 3LTWA 1LCZA 1LNMA 2OF8A 1BWYA 3S60A 1DKIA 3DSZA 1N7YA 3SLJA 1KL4A 3SZJA 2GTLN 2VDFA 2Y32A 4D8EA 1SWKA 2IZFB 2Z4IA 4XZXA 1DZPA 5FAZA 1Z24A 4MEEA 3EMMA 3O22A 1DZKA 1SLEB 1SWHA 1VWRB 1GCBA 2OVSA 1SY0A 5EDCA 4ZHGA 1VWFB 3PW3A 1PE6A 5EZ2A 3HTYA 3HPEA 4AXLA 1AECA 4BS5A 4GJVA 2Q9SA 2DC9A 2P7UA 3DTQA 1SXUA 2IZLB 4QRXA 2ACOA 2N93A 4BJ8A 1IWDA 3TRKA 4CDFB 1KQXA 1VWBB 1SXXA 1JJXA 2HZRA 4M7MA 2W2AA 4ZHDA 2KTSA 1TL9A 2LBVA 2BT9A 5CHTA 1SREA 3B2HA 4ZHCA 3ZUOA 1SWFA 4GETA 2JOZA 1NPZA 1KZWA 2DC7A 1MEMA 1SWTA 4JGLA 1SLGB 3T1DA 2NNQA 2OF9A 2H7JA 1ZIVA 2FGSA 3ZW0A 3WJFA 5KICA 4Y0PA 3BDRA 1OEEA 5IO7A 4YH0A 2OL7A 1PADA 1X8NA 1FH0A 2E03A 9PAPA 1N9YA 3B79A 2CZTA 3L4RA 3TGAA 4ZJ0A 3VHHA 4TQ2A 1ZNGA 4HWMA 1UKFA 1NQCA 4FBOA 3BY0A 5D45A 3K24A 1HXZA 5L8NA 3KWZA 3JSQA 3S5XA 2RTHB 1VWJB 1BGOA 1NQMA 4GE1A 2K62A 1GX9A 5DG4A 1A6RA 1PPPA 2IZDB 2LA7A 2FKGA 3HOLA 3PQSA 1YK7A 4COTA 2KTDA 4INNA 1VWOB 4IB9A 1YP7A 2IZHB 4IUMA 1D2UA 4BGFA 1D3SA 4KIIA 5HWZA 2AT0X 4AZMA 3E3CA 3O65A 1YK8A 3KVNA 5HTEA 2UYWA 1HQQA 2RD7C 2Q2MA 4N79A 3RNVA 3F9DA 4CDFA 1SWOA 1HBQA 4ZCBA 1MX8A 3S3RA 1VYGA 1VWPB 3P5WA 2XU4A 2QOMA 3VGWA 3RWXA 3MHHA 1YWCA 1B4MA 1LICA 2A8GA 4TNNA 3UEXA 2BU3A 5K68A 1B56A 1JV4A 1KFUL 2ACTA 2WBFX 3BOWA 5CSEA 1HMSA 1SXYA 2NNDA 4YYQA 1LIEA 3TMPA 5AQ6A 1GGLA 1MS6A 1ICMA 3PT2A 4GGZA 2A0AA 2WWPA 4GRJA 3RBYA 3RVXA 5A24A 3T6FA 2AYNA 1PXVA 2Y3EA 4QZUA 2AS8A 4A1YA 5BYPA 4RNAA 1PPOA 4YDAA 3IFBA 4LZVA 1KL5A 2AUXA 4ES7A 4Z28A 5H9LA 1AU4A 2CB5A 5EZSA 3C76X 2FS6A 3WYPA 4OVZB 2FYEA 1QXPA 2JGSA 5CE4A 1SRFA 1FJ1E 5LJBA 1E2TA 2RTPB 1MUPA 3SLTA 2OY5O 5IXGA 2AUZA 1HMTA 1ZNEA 2OFBA 3EM0A 1CSBB 3I17A 4I9RA 1CB5A 3PNRA 1JYJA 1MX7A 3OVZA 3U8EA 5HAEA 3F6ZB 2FLJA 1JIWI 3T2XA 4HFOA 4MZOA 1FDQA 1VWMB 4P6GA 4R3DA 4BOUA 1GKAB 5B5FA 1AVEA 1CBQA 3NHEA 5H8TA 1JJUA 4A8ZA 3WZQA 2X8SA 1GT1A 4DQ4A 1RSTB 5KIDA 1NL6A 1I4UA 2E4JA 1CRBA 3NX2A 1EUOA 4GUZA 4GDZA 1PTSA 4NP1A 3IMAA 4AYHA 3SAOA 1PEEA 1OEJA 2Q2PA 2Z84A 3KWBX 2OFAA 1SY3A 2CAMA 4A1HA 2GFOA 1SWRA 2C0YA 4BX7B 2QMIA 4BOQA 3WZOA 1O1VA 1QY2A 4OEMA 3BBAA 1EQDA 2G78A 4O3YA 3APVA 2FHNX 1G7NA 1K24A 4U8UO 5EEEA 1E00A 4ORRA 1X8UA 5L8IA 2RTKA 2BDLA 2IZGB 3CMPA 2VFCA 3WVMA 3LFYA 1A2DA 5JZEA 4Y0SA 4FGIB 3VG7A 1SWDA 4JNJA 2NP1A 2A2GA 2IZKA 1VWAB 5HCEC 1BY8A 3QT4A 3C0RA 1TOUA 4NW4A 3TGCA 2FTBA 4KT5A 1KT6A 3NQ9A 2HKDA 3HOEA 1QOLA 2FO5A 4OVZA 1IFCA 4HPBA 5EF4A 1Y4HA 2QO5A 1I04A 1ZCMA 1Y9TA 2X34A 3PECA 2FT9A 4TKBA 2DM5A 5FENA 4OS8A 4CPHB 1U9XA 4QRVA 2OFMX 4PSQA 4YFQA 3UEWA 1NC9A 1YVBA 1NBXA 4GDAA 5HA0A 1S4VA 2FWVA 5LKEA 4XMHA 1EWOA 5C0NA 2DZYA 2EU7X 3BX8A 1NGLA 3N3KA 1PBHA 1GKAA 4U8UN 1T8VA 2IPPB 1ZRYA 4YFRA 3F8AA 2CBSA 4BSQA 3BCNA 1OPBA 4WHIA 1MK5A 2ARYA 2CM4A 2FHLA 4NLJA 4O4UA 4YBUA 1KXOA 4G54A 4Z2OA 4C5PA 1KT3A 3PP6A 2MHDA 4YMYA 3FMZA 1EXSA 1MEPA 3P6EA 1Y9LA 3AUMO 4EKVA 4Z2PA 3WJCA 2DJGA 4KC7A 1DF3A 3ZUAA 4BX6B 5LJGA 3PRMA 3CR6A 4NYRA 2MJIA 2QO6A 3NPOA 1PBYA 1NLJA 4GZVA 1N4JA 4ORUA 4ZGFA 1BSYA 1EALA 3H7DA 4MVIA 3D97A 1MEGA 3PSEA 3QQ2A 4Z6JA 2AT5X 2KW1A 4I3CA 1CQDA 4AXMA 4BOSA 3VE2A 1W4TA 1IKEA 4L3RA 4QGWA 3KFQA 4MM3B 3AKNA 1LKEA 2Y3FA 3PDFA 3TZSA 3I3TA 4XMCA 1EPBA 5IO6A 1STFE 1BEBA 2AU1A 2BTWB 5HBSA 4ARHA 4CPHA 2J7QA 1HBPA 2HXZA 3MTVA 1YWAA 4AZOA 5AEOA 2ATOA 4KH8A 4YKOA 4RF0A 2FTDA 4KLBA 4YYRA 4YGHA 1BQIA 4CZWA 3OISA 3RDSA 4IAXA 1WUBA 1UYOX 1B8EA 5KHPA 3MJ5A 4CSBA 1ME4A 1BRPA 4XR7A 4FJCA 2X8FA 5B29A 3OQCA 2B1MA 4IMOA 4N4ZA 3WXEA 3PEDA 4BVMA 4IB6A 4FBRA 4YYWA 2NQGA 4ORWA 3VHMA 1XKGA 3X00A 2RTAA 3U03A 4I07A 4OW0A 4X6HA 3G7XA 4CPFA 5DPQA 2JU8A 1BM5A 3SZHA 3U9PC 1I78A 2G5LA 2P0RA 1EPAA 3BU9A 4BX6A 3PPTA 4OKAA 3ELXA 3RDMA 2W2BA 1QWDA 2AYOA 5AJBA 2FKJA 1SRHA 3FA9A 5LJKA 4N7DA 2QM9A 1T68X 4YKMA 1YZBA 1F2BA 3D9WA 3RDOA 1Q6KA 5JH3A 4OS3A 1Y0GA 1VWHB 3NQ3A 4MVKA 4I3DA 1OBQA 1KOIA 2A2UA 2O6XA 3ZI8A 1KQWA 2WPUA 4GNYA 2VHSA 2R73A 3NX1A 4ZH6A 3KFFA 1OSPO 1ZNKA 1STSB 4BCSA 2RCTA 2Y6EA 2BTWA 2CBRA 1PPNA 3WXGA 5KO3A 1KFFA 3TNXA 1S2PA 2F09A 2XU1A 4MVEA 4JHQA 1GECE 3HWFA 2BSZA 3ZWEA 4LKTA 2HLVA 3VU1A 4MZSA 5F6BA 3S3QA 4GNWA 1I06A 4O3WA 2GH7A 4M0WA 3VPJE 4K19A 5F1EA 5D48A 1VPRA 4O9SA 3IEJA 1SY1A 4DMYA 5CYBA 2UZ2A 2OFRX 7PCKA 1PVJA 4YCEA 1YIVA 2WR6A 1KGLA 1SWEA 5LJEA 4TLJA 4KC8A 1JQPA 2L9CA 2X46A 4I3BA 3EBWA 2BS5A 1SWNA 1UREA 3KX1A 4QAEA 4YGZA 1VWGB 1Y53X 1YP6A 2WQAE 5BVQA 4QH6A 2FR3A 2IBIA 4DCBA 5K67A 3MG5A 2CZUA 2XSTA 3CBKA 2NNEA 5B3MO 1SWQA 3HWGA 1DZJA 3VG2A 5JR8A 4N7CA 3STMX 1KL3A 3D4RA 4D8IA 3ZW2A 1TU6A 1VWLB 4TKHA 3FIDA 1GLOA 5L3YA 3QKGA 1U18A 3K8UA 3SLOA 1KFXL 1GXAA 1X9YA 2R56A 1DEUA 3PRPA 1E5PA 4FK5A 2G7YA 2KD2A 1LCVA 3FEKA 1FENA 4PP2E 1M6DA 2DJFB 3VG6A 1L6MA 2HNXA 2WSJA 2YJCA 5E6JA 1SWGA 3CBJA 1LFOA 1Y08A 4I60A 4Y0RA 4AZNA 4AW8A 2NQDB 4HPAA 2RTEB 2L68A 2VFBA 3BPMA 3FA6A 1BBPA 4LKPA 1SRIA 2JTCA 5HZ6A 1ICNA 1A3YA 1F2CA 3RDUA 1ICFA 2RTDB 3HWEA 4AZRA 2A3FX 2OZQA 4Q8GA 3RE6A 3BS2A 2A5BA 1WBIA 3K3LA 1PIPA 1IW2A 3MX7A 2I5VO 3V6EA 5HZ8A 1TW4A 2YJBA 1VWQB 1GM6A 4LQZA 1EWMA 3E1ZB 1YT7A 1MM9A 2F7DA 2YJ8A 4MI7A 1RXHA 1BRQA 5LKFA 4WFUA 1VSNA 4IRWA 4B55A 5K06A 3CQRA 4PT5A 2ASNX 2DC6A 1W5RA 2BDZA 5IO5A 3K9MA 3PH6A 1MHWA 2X4MA 3KZAA 4BPVA 4MISA 4YYVA 2MO5A 5FQ7E 3PQUA 1LCWA 1X71A 3RSWA 3GCBA 1AYUA 4ML7B 1S44A 4REZA 5K16A 4O4SA 3TF6A 4MSXA 2OULA 3RVVA 2YMSA 4WA6A 5JA7A 2R9FA 3PH5A 3U0DA 5IRUA 1HMRA 2RTBB 3B21A 1KT7A 3P5VA 1ZNDA 4XMDA 2DJFA 3H8CA 3UEVA 2JMBA 3VHIA 2LBAA 3HHAA 1VWDB 2AKQA 2HMBA 4YBPA 3FW5A 2RTNB 4IB7A 3EC5A 1G85A 3BX7A 1XKIA 4CDCB 2AIMA 5B11O 1CVZA 4NLIA 1BP4A 1FEMA 4BOEA 1O1UA 4I05A 2PADA 5HCCC 1CBIA 3UEUA 1QFVA 3TGBA 1BSQA 1MDWA 1OPAA 4X6IA 2HHNA 3ZNHA 5IRAA 5HTDA 3PK2A 5B10O 3OD9A 5H9AA 4NV8A 4YYUA 4U46A 1STRB 5D8JA 1EIIA 4O3ZA 1U9VA 2OY8A 2NQIA 3IA8A 3NBXX 3N91A 2GTLM 3BLGA 4Q8HA 1RBPA 1VWIB 1X8OA 3FIQA 3P6FA 4QGXA 1G5WA 2FE8A 5FQ8E 1O0EA 3WZPA 1GT3A 4IB8A 4I95A 1KZXA 4OMXA 1ATKA 3ZUIA 2ZAGA 4EFGA 3WXQA 3NADA 2IZIA 1AELA 1VWCB 3WBGA 1PBOA 5F7GA 4DQ3A 1E02A 2MWHA 1G74A 1U5IA 4XMFA 4YDBA 3CKFA 1SRJA 3FR5A 1F29A 2B1NA 3AEHA 3BU1A 3FENA 3P5UA 2RA6A 1W6FA 2M4LA 1FTPA 3ZZVA 5IRWA 1Y52X 1BSOA 2JW1A 2FS7A 1SWPA 1GX3A 2DC8A 3T6LA 3FELA 1BLRA 4YV8A 5PADA 3D95A 4BX7A 1AU0A 3PHUA 1ERBA 4ZR2A 1ME3A 5J94A 3USVA 4HWYA 4WFVA 1A18A 3NR3A 1N0SA 4OELA 4ZH9A 4D8BA 4CDCA 1UZ2X 2FT2A 2IFBA 1VWEB 1SWBA 2RTMA 1IFBA 4XUIA 2RCQA 3HWNA 1IKJA 4ORYA 3H89A 1AQBA 4D6AA 1KXRA 5HZ5A 2Q39A 1LF7A 1ML7A 4WURA 4RKXA 3CBSA 3W30A 3O19A 2OVAA 2RTFB 3BSZE 3C77X 1HY2A 3PHWA 4RF1A
chains in the Genus database with same CATH topology
1CJLA 3BWKA 2R9NA 2VHSA 1U9WA 4W4UA 4YYQA 3F75A 2Y6EA 1MS6A 1PPNA 3WXGA 6PADA 3TNXA 2HH5A 1CS8A 2XU1A 1AU3A 3BC3A 1NB3A 3D6SA 5FPWA 3RVXA 1GECE 2BSZA 2OP3A 5A24A 2AYNA 1PXVA 4MZSA 3M99A 2AS8A 3KW9A 1PPOA 3O1GA 4PADA 4N8WA 4K7CA 3S3QA 1AU2A 2GHUA 3OF8A 2DCCA 3WXFA 2AUXA 4PP1A 3KKUA 1AU4A 1EWLA 2CB5A 4DMXA 3IEJA 8PCHA 4DMYA 2XU5A 2DZZA 7PCKA 3MTNA 4FIPA 2FYEA 1QXPA 1KHPA 1VJVA 1JQPA 3QSDA 1E2TA 2AUZA 3KX1A 1AYWA 1CSBB 4RY2A 1CB5A 3IV2A 4QH6A 2IBIA 3PNRA 3OVZA 3U8EA 2YJ9A 3H8BA 4YVAA 3CBKA 3DF0A 1AIMA 1KHQA 4CDDB 4MZOA 4NV7A 5CVMA 3IOQA 4P6GA 2DCAA 3QJ3A 3NHEA 1TU6A 3MORA 3P5XA 2FRAA 1U9QX 1NL6A 3N4CA 1GLOA 4GUZA 1AYVA 2DCDA 3IMAA 3MHSA 3HD3A 3ERVA 3K8UA 5CHVA 4X6JA 1KFXL 3KWBX 3CH3X 2JQFR 2GFOA 5F02A 1X9YA 2C0YA 1DEUA 2Y5BA 2JQGR 4FK5A 2G7YA 1MIRA 4PP2E 1M6DA 2DJFB 1YALA 3HHIA 4OEMA 3AI8A 4YYSA 2VHFA 2YJCA 3O0UA 3CBJA 1SP4B 2YJ2A 2BDLA 1Y08A 2VFCA 2NQDB 3H6SA 4W5CA 4P6EA 3LFYA 3N3GA 2OZ2A 2VFBA 3BPMA 1CPJA 3IUTA 3F5VA 3IHPA 1TLOA 4BS6A 1PPDA 1CV8A 2G8JA 1F2CA 4ZUXU 1BY8A 3BPFA 3QT4A 1ICFA 4Q8GA 2E00A 1QOLA 2FO5A 5EF4A 2R9MA 2E01A 1POPA 2WBFX 1Y4HA 4CDEB 1PIPA 2R9CA 2FRQA 3V6EA 1ZCMA 3OVXA 2YJBA 4PI3A 3LXSA 1EWMA 3RVWA 1QDQA 3E1ZB 1YT7A 3PBHA 2F7DA 2YJ8A 1U9XA 4QRVA 5CVNB 1VSNA 4B55A 1YVBA 4CDDA 2FUDA 2DC6A 3LTWA 1W5RA 1S4VA 1GMYA 1EWOA 2DZYA 2BDZA 3K9MA 3N3KA 1PBHA 1MHWA 2IPPB 1EWPA 2PBHA 4BPVA 4BSQA 2HD5A 4YYVA 1F2AA 3BCNA 3C9EA 1PCIA 2ARYA 2PREA 1GCBA 3GCBA 1AYUA 2G8EA 5K16A 3PW3A 4G54A 1PE6A 4MSXA 2OULA 2P86A 3RVVA 2E02A 4C5PA 4QBBA 4WA6A 5JA7A 2R9FA 4AXLA 1AECA 4BS5A 3I06A 3P5VA 2DC9A 2P7UA 2DJFA 2DJGA 4QRXA 3H8CA 3ZUAA 3HHAA 1IWDA 1DF0A 4CDFB 1NLJA 4CDCB 2AIMA 3KSEA 1K3BB 1CVZA 1BP4A 1TL9A 2AVWA 4I04A 4I05A 2PADA 5CHTA 1ITOA 2R9OA 3H7DA 1THEA 1MDWA 1MEGA 4X6IA 2HHNA 1NPZA 1CQDA 2DC7A 4NV8A 1MEMA 4AXMA 4YYUA 5EGWA 1W4TA 1U9VA 2NQIA 4CDEA 3KFQA 1NB5A 4Q8HA 4BQVA 2H7JA 3PDFA 3I3TA 2F1GA 1ZIVA 2NQAA 1STFE 2AU1A 1PADA 1O0EA 4W5BA 1FH0A 1SNKA 2HXZA 2E03A 2ATOA 9PAPA 3B79A 1ATKA 2XU3A 2FTDA 4KLBA 4YYRA 1BQIA 2PNSA 1NQCA 3V6CA 4CZWA 3OISA 1HUCB 3K24A 1QMYA 1ME4A 3KWZA 1U5IA 4XR7A 4FJCA 1BGOA 2B1MA 1F29A 4N4ZA 3WXEA 2B1NA 2R6NA 4YYWA 3P5UA 1A6RA 1PPPA 1W6FA 2NQGA 1XKGA 1YK7A 2DCBA 4I07A 4X6HA 1GX3A 2DC8A 2G6DA 4BGFA 1CTEA 4YV8A 5PADA 1AU0A 3CH2X 2P0RA 1YK8A 3OF9A 1ME3A 5J94A 3USVA 4HWYA 4OELA 4N79A 2AYOA 4CDFA 2CIOA 1EF7A 4CDCA 4QRGA 3S3RA 1K3BA 2FT2A 5CVOB 3P5WA 2XU4A 4XUIA 3HWNA 3MHHA 3H89A 1KXRA 1F2BA 3D9WA 1Q6KA 5JH3A 2FQ9A 1KFUL 2DJGB 2O6XA 2ACTA 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJL A;  3BWK A;  2R9N A;  2VHS A;  1U9W A;  4W4U A;  4YYQ A;  3F75 A;  2Y6E A;  1MS6 A;  1PPN A;  3WXG A;  6PAD A;  3TNX A;  2HH5 A;  1CS8 A;  2XU1 A;  1AU3 A;  3BC3 A;  1NB3 A;  3D6S A;  5FPW A;  3RVX A;  1GEC E;  2OP3 A;  5A24 A;  2AYN A;  1PXV A;  4MZS A;  3M99 A;  2AS8 A;  3KW9 A;  1PPO A;  3O1G A;  4PAD A;  4N8W A;  4K7C A;  3S3Q A;  1AU2 A;  2GHU A;  3OF8 A;  2DCC A;  3WXF A;  2AUX A;  4PP1 A;  3KKU A;  1AU4 A;  1EWL A;  2CB5 A;  4DMX A;  3IEJ A;  8PCH A;  4DMY A;  2XU5 A;  2DZZ A;  7PCK A;  3MTN A;  4FIP A;  2FYE A;  1QXP A;  1KHP A;  1VJV A;  1JQP A;  3QSD A;  2AUZ A;  3KX1 A;  1AYW A;  1CSB B;  4RY2 A;  1CB5 A;  3IV2 A;  4QH6 A;  2IBI A;  3PNR A;  3OVZ A;  3U8E A;  2YJ9 A;  3H8B A;  4YVA A;  3CBK A;  3DF0 A;  1AIM A;  1KHQ A;  4CDD B;  4MZO A;  5CVM A;  3IOQ A;  4P6G A;  2DCA A;  3QJ3 A;  3NHE A;  1TU6 A;  3MOR A;  3P5X A;  2FRA A;  1U9Q X;  1NL6 A;  3N4C A;  1GLO A;  1AYV A;  2DCD A;  3IMA A;  3MHS A;  3HD3 A;  3ERV A;  3K8U A;  5CHV A;  4X6J A;  1KFX L;  3KWB X;  3CH3 X;  2JQF R;  2GFO A;  5F02 A;  1X9Y A;  2C0Y A;  1DEU A;  2Y5B A;  2JQG R;  4FK5 A;  2G7Y A;  1MIR A;  4PP2 E;  1M6D A;  2DJF B;  1YAL A;  3HHI A;  4OEM A;  3AI8 A;  4YYS A;  2VHF A;  2YJC A;  3O0U A;  3CBJ A;  1SP4 B;  2YJ2 A;  2BDL A;  1Y08 A;  2NQD B;  3H6S A;  4W5C A;  4P6E A;  3LFY A;  3N3G A;  2OZ2 A;  3BPM A;  1CPJ A;  3IUT A;  3F5V A;  3IHP A;  1TLO A;  4BS6 A;  1PPD A;  1CV8 A;  2G8J A;  1F2C A;  4ZUX U;  1BY8 A;  3BPF A;  3QT4 A;  1ICF A;  4Q8G A;  2E00 A;  1QOL A;  2FO5 A;  5EF4 A;  2R9M A;  2E01 A;  1POP A;  2WBF X;  1Y4H A;  4CDE B;  1PIP A;  2R9C A;  2FRQ A;  3V6E A;  1ZCM A;  3OVX A;  2YJB A;  4PI3 A;  3LXS A;  1EWM A;  3RVW A;  1QDQ A;  3E1Z B;  1YT7 A;  3PBH A;  2F7D A;  2YJ8 A;  1U9X A;  4QRV A;  5CVN B;  1VSN A;  1YVB A;  4CDD A;  2FUD A;  2DC6 A;  1S4V A;  1GMY A;  1EWO A;  2DZY A;  2BDZ A;  3K9M A;  3N3K A;  1PBH A;  1MHW A;  2IPP B;  1EWP A;  2PBH A;  4BPV A;  4BSQ A;  2HD5 A;  4YYV A;  1F2A A;  3BCN A;  3C9E A;  1PCI A;  2ARY A;  2PRE A;  1GCB A;  3GCB A;  1AYU A;  2G8E A;  5K16 A;  3PW3 A;  4G54 A;  1PE6 A;  4MSX A;  2OUL A;  2P86 A;  3RVV A;  2E02 A;  4QBB A;  4WA6 A;  5JA7 A;  2R9F A;  4AXL A;  1AEC A;  4BS5 A;  3I06 A;  3P5V A;  2DC9 A;  2P7U A;  2DJF A;  2DJG A;  4QRX A;  3H8C A;  3ZUA A;  3HHA A;  1IWD A;  1DF0 A;  4CDF B;  1NLJ A;  4CDC B;  2AIM A;  3KSE A;  1K3B B;  1CVZ A;  1BP4 A;  1TL9 A;  2AVW A;  4I04 A;  4I05 A;  2PAD A;  5CHT A;  1ITO A;  2R9O A;  3H7D A;  1THE A;  1MDW A;  1MEG A;  4X6I A;  2HHN A;  1NPZ A;  1CQD A;  2DC7 A;  1MEM A;  4AXM A;  4YYU A;  5EGW A;  1U9V A;  2NQI A;  4CDE A;  3KFQ A;  1NB5 A;  4Q8H A;  4BQV A;  2H7J A;  3PDF A;  3I3T A;  2F1G A;  1ZIV A;  2NQA A;  1STF E;  2AU1 A;  1PAD A;  1O0E A;  4W5B A;  1FH0 A;  1SNK A;  2HXZ A;  2E03 A;  2ATO A;  9PAP A;  3B79 A;  1ATK A;  2XU3 A;  2FTD A;  4KLB A;  4YYR A;  1BQI A;  2PNS A;  1NQC A;  3V6C A;  4CZW A;  3OIS A;  1HUC B;  3K24 A;  1QMY A;  1ME4 A;  3KWZ A;  1U5I A;  4XR7 A;  4FJC A;  1BGO A;  2B1M A;  1F29 A;  4N4Z A;  3WXE A;  2B1N A;  2R6N A;  4YYW A;  3P5U A;  1A6R A;  1PPP A;  2NQG A;  1XKG A;  1YK7 A;  2DCB A;  4I07 A;  4X6H A;  2DC8 A;  2G6D A;  1CTE A;  4YV8 A;  5PAD A;  1AU0 A;  3CH2 X;  2P0R A;  1YK8 A;  3OF9 A;  1ME3 A;  5J94 A;  3USV A;  4HWY A;  4OEL A;  4N79 A;  2AYO A;  4CDF A;  2CIO A;  1EF7 A;  4CDC A;  4QRG A;  3S3R A;  1K3B A;  2FT2 A;  5CVO B;  3P5W A;  2XU4 A;  4XUI A;  3HWN A;  3MHH A;  3H89 A;  1KXR A;  1F2B A;  1Q6K A;  5JH3 A;  2FQ9 A;  1KFU L;  2DJG B;  2O6X A;  2ACT A;  3BOW A; 
#chains in the Genus database with same CATH topology
 3BWK A;  2GTL O;  1U9W A;  4BX5 B;  1B0O A;  5H9N A;  4R0B A;  4NNT A;  3OJY C;  3RY1 A;  1SWU A;  1GX8 A;  4LZU A;  1NB3 A;  5FPW A;  2AGA A;  2OP3 A;  1X8Q A;  2RTJ A;  1E06 A;  1ADL A;  3T2W A;  3WOV A;  1LDO A;  1EI5 A;  2G8C O;  4N8W A;  4PAD A;  5B2A O;  1AU2 A;  2PI3 O;  3FEP A;  1YUP A;  4EXZ A;  4BOZ A;  2GHU A;  1P6P A;  1LUQ A;  3OF8 A;  4GGR A;  4MIR A;  4PP1 A;  3KKU A;  8PCH A;  3P6C A;  1VWN B;  1I9H A;  2DZZ A;  4IBA A;  3MTN A;  4FIP A;  1HXL A;  2POA A;  1CBR A;  3KFH A;  1A57 A;  2IZC B;  2RTQ B;  1PM1 X;  4JO6 A;  2JU7 A;  4O4X A;  1AYW A;  5AJC A;  1Y55 X;  4QGV A;  5HZQ A;  4RY2 A;  4DNE A;  1SLF B;  2G79 A;  5F58 A;  3S26 A;  5EED A;  4HPC A;  1DC9 A;  3H8B A;  2WEX A;  3IFU A;  1AIM A;  3B2K A;  1KHQ A;  2QCB A;  5F6Z A;  1QY0 A;  2DCA A;  2IZE B;  3QJ3 A;  5LJC A;  4KCA A;  2MF6 A;  3MOR A;  2AT8 X;  3RDX A;  3P5X A;  1STP A;  4RUN A;  2FRA A;  3RDQ A;  1VYO A;  3N4C A;  1I05 A;  1OBU A;  2C1Q A;  4IMN A;  3WJD A;  3D96 A;  2DCD A;  5HCD C;  1DF8 A;  4A5U A;  3HD3 A;  4UU3 A;  1HQP A;  5CHV A;  4X6J A;  2OL8 O;  3CH3 X;  1QAB E;  4Z2V A;  1KT5 A;  1U0X A;  1JJJ A;  4BX5 A;  2RTG B;  2JQG R;  5LJD A;  1UYN X;  2FR2 A;  3WJB A;  4YYS A;  2IZB A;  4A60 A;  2HYS A;  1NP4 A;  3APW A;  1SP4 B;  2YJ2 A;  2KT4 B;  4W5C A;  4P6E A;  4QZT A;  2OZ2 A;  3EW2 A;  1CPJ A;  1KT4 A;  4AZQ A;  2AVI A;  4BS6 A;  1PPD A;  3P6G A;  4I6S A;  2HWK A;  2G8J A;  1NP1 A;  4ZGU A;  4L1N A;  3MBT A;  1N43 A;  4M6S A;  2Z4H A;  1TXL A;  4O3X B;  3H3I A;  4ZHH A;  1YWD A;  1DFV A;  1RLB E;  4AZP A;  3VG4 A;  2E00 A;  1EW3 A;  5EPQ A;  3EW1 A;  2E01 A;  1POP A;  4CDE B;  3B2I A;  4EQA C;  2BLG A;  2OY7 A;  1LIF A;  2FRQ A;  1NQN A;  2BS6 A;  4NYQ A;  2RTR B;  3LXS A;  4GD9 A;  4NNS A;  1PMP A;  4OS0 A;  3RVW A;  1LEL A;  2I5Z O;  5CVN B;  2LFO A;  4PJ2 A;  2FUD A;  3I0A A;  2ZAI A;  3P6H A;  1GMY A;  3W31 A;  2FRS A;  4I9S A;  4HPD A;  2F73 A;  3LV4 A;  4TJZ A;  3WJE A;  2OY1 O;  2GC9 A;  1EWP A;  2PBH A;  2X45 A;  2HD5 A;  1F2A A;  1SWJ A;  3C9E A;  1HN2 A;  1PCI A;  2PRE A;  1RXK A;  3FLL A;  2G8E A;  1QG5 A;  1CJ5 A;  3ELZ A;  4ODD A;  2P86 A;  2E02 A;  4QBB A;  3JQO A;  4GJS A;  4GK9 A;  3Q6L A;  1IIU A;  3FA7 A;  3I06 A;  3OBL A;  3WYQ A;  4Y0Q A;  4QQ1 A;  3BRN A;  5LJH A;  3HK1 A;  1ZNH A;  2G7B A;  3RY2 A;  1N9M A;  1JYD A;  5FFH A;  3P02 A;  2AF5 A;  1DF0 A;  1ACD A;  2RTL A;  1TVQ A;  3KSE A;  1K3B B;  1MDC A;  2AVW A;  4GGT A;  5EZQ A;  4I04 A;  1ITO A;  3VG3 A;  2R9O A;  1QFT A;  4ID2 A;  1THE A;  2GTF X;  2GJ5 A;  1SY2 A;  3O2Y A;  5EGW A;  4CDE A;  1NB5 A;  4U8U M;  3ZW1 B;  2Q4N A;  4BQV A;  4XMG A;  2F1G A;  3Q34 A;  2NQA A;  1XCA A;  3MM0 A;  4IP3 A;  5B5G A;  4EEJ A;  1RSU B;  4W5B A;  1SNK A;  1GT5 A;  1ZNL A;  1JMZ A;  3P24 A;  2RTC B;  4CPE A;  1R0U A;  2YG2 A;  5D4A A;  3KFI A;  2XU3 A;  4GU8 A;  4ALB A;  2PNS A;  3V6C A;  2LKK A;  2OL6 O;  2L5P A;  1JMX A;  1HUC B;  1H91 A;  2MM3 A;  4BQU A;  4WBK A;  1QMY A;  1SWL A;  2QOS C;  2R6N A;  1TOW A;  4CV7 A;  4D6B A;  4O4O A;  2WUT A;  3BB7 A;  1X8P A;  4GKC A;  2DCB A;  3UAQ A;  2G6D A;  4OMW A;  5CHK A;  3SZI A;  1ALB A;  2RN4 A;  1CTE A;  3RZY A;  2K23 A;  1SLD B;  3CH2 X;  3MVF A;  1OBP A;  1AB0 A;  3OF9 A;  2A13 A;  2P8G A;  2X55 A;  2AH7 X;  4QRL A;  5H9K A;  2CIO A;  2WEW A;  1EF7 A;  1S7D A;  4QRG A;  1K3B A;  5CVO B;  3SOT A;  3KQ0 A;  1JZU A;  2IZJ A;  1LDQ A;  3MP2 A;  1SWC A;  4ZHF A;  4TKJ A;  1SA8 A;  2ZSC A;  1MOY A;  4RUU A;  1VWK B;  1GT4 A;  2RTO B;  4QYP A;  2FQ9 A;  2X56 A;  3RE5 A;  1RAV A;  4EDE A;  1SRG A;  2DJG B;  3STN A;  2OVD A;  4HXD B;  2BHV A;  3ZW1 A;  2QO4 A;  1CJL A;  1O8V A;  5L8O A;  2R9N A;  1OEK A;  1VYF A;  3C78 X;  2F01 A;  4W4U A;  4FQB B;  3F75 A;  4BOP A;  1LIB A;  1FEL A;  4YCH A;  6PAD A;  2HH5 A;  1CS8 A;  1AVD A;  1X89 A;  2WQ9 A;  2IZA A;  1AU3 A;  3BC3 A;  3D6S A;  3P6D A;  4GUA A;  2O62 A;  4P16 A;  4UU2 A;  3FA8 A;  2AT6 X;  1BJ7 A;  3CQN A;  5BVS A;  3M99 A;  3KW9 A;  3O1G A;  2JN3 A;  4K7C A;  1LPJ A;  3CBC A;  5F2B A;  5B27 A;  2HZQ A;  3AKM A;  2DCC A;  3WXF A;  4Z27 A;  1EWL A;  4DMX A;  2XU5 A;  2XKL A;  3S5V A;  1EIO A;  2ALL X;  1DV9 A;  4GH7 A;  1KHP A;  2AL0 X;  3FW4 A;  3FYF A;  3B2J A;  1VJV A;  4QYN A;  4ZFX A;  3QSD A;  4YVB A;  3NQK A;  3NP1 A;  3GE2 A;  2J7Q C;  3IV2 A;  2LB6 A;  4ON1 A;  2C4I A;  5EDB A;  2YJ9 A;  1IJ8 A;  4YVA A;  3DF0 A;  3OE3 A;  2JU3 A;  4CDD B;  2C1S A;  4NV7 A;  1SWA A;  5CVM A;  3B2L A;  3IOQ A;  1RXJ A;  5HA1 A;  3WJG A;  5JD2 A;  3V8U A;  5BVT A;  1SWS A;  3VG5 A;  4Y59 A;  1U9Q X;  3E9S A;  2OVE A;  4ORS A;  4XME A;  2DOS A;  1CBS A;  3BY4 A;  4FBV A;  3JS1 A;  1AYV A;  3MHS A;  3ERV A;  2A5C A;  4CK4 A;  2W2F A;  3CWK A;  2JQF R;  5F02 A;  4ZTB A;  3FR4 A;  5HZ9 A;  1SMP I;  2Y5B A;  2L67 A;  1T0V A;  2X32 A;  4BBO A;  1JBH A;  4IAW A;  3EBK A;  3FDC A;  4CPI A;  1MIR A;  3EYC A;  5D47 A;  3VE1 A;  1YAL A;  3HHI A;  2PY1 A;  1QY1 A;  3AI8 A;  3RKG A;  2VHF A;  2OYB O;  2ACP X;  2AT3 X;  3O0U A;  3ZQ3 A;  3LHN A;  3HWD A;  4ALO A;  1SXW A;  3H6S A;  4MVL A;  1AVG I;  2ANS A;  3N3G A;  3CKG A;  1ERX A;  4QNI A;  4U9C A;  3IUT A;  3F5V A;  3IHP A;  1TLO A;  4U3Q A;  2JRI A;  1CV8 A;  5FQ6 E;  2X8T A;  2AMM X;  4ZUX U;  4O49 A;  3BPF A;  3FR2 A;  4YFP A;  3KFG A;  2R9M A;  2RQ0 A;  1NDJ A;  3PHX A;  4ORX A;  2R9C A;  1MVG A;  2CM9 A;  3OVX A;  1DZM A;  4PI3 A;  3ZW0 B;  4YGG A;  1U17 A;  3APX A;  4Y5D A;  3APU A;  1QDQ A;  1YWB A;  3WZN A;  3PBH A;  1FE3 A;  4IAB A;  2UZJ A;  3GAQ A;  3STK A;  1LID A;  2R74 A;  2BC3 A;  2RTI B;  1QQS A;  4CDD A;  3LTW A;  1LCZ A;  1LNM A;  2OF8 A;  1BWY A;  3S60 A;  1DKI A;  3DSZ A;  1N7Y A;  3SLJ A;  1KL4 A;  3SZJ A;  2GTL N;  2VDF A;  2Y32 A;  4D8E A;  1SWK A;  2IZF B;  2Z4I A;  4XZX A;  1DZP A;  5FAZ A;  1Z24 A;  4MEE A;  3EMM A;  3O22 A;  1DZK A;  1SLE B;  1SWH A;  1VWR B;  1GCB A;  2OVS A;  1SY0 A;  5EDC A;  4ZHG A;  1VWF B;  3PW3 A;  1PE6 A;  5EZ2 A;  3HTY A;  3HPE A;  4AXL A;  1AEC A;  4BS5 A;  4GJV A;  2Q9S A;  2DC9 A;  2P7U A;  3DTQ A;  1SXU A;  2IZL B;  4QRX A;  2ACO A;  2N93 A;  4BJ8 A;  1IWD A;  3TRK A;  4CDF B;  1KQX A;  1VWB B;  1SXX A;  1JJX A;  2HZR A;  4M7M A;  2W2A A;  4ZHD A;  2KTS A;  1TL9 A;  2LBV A;  2BT9 A;  5CHT A;  1SRE A;  3B2H A;  4ZHC A;  3ZUO A;  1SWF A;  4GET A;  2JOZ A;  1NPZ A;  1KZW A;  2DC7 A;  1MEM A;  1SWT A;  4JGL A;  1SLG B;  3T1D A;  2NNQ A;  2OF9 A;  2H7J A;  1ZIV A;  2FGS A;  3ZW0 A;  3WJF A;  5KIC A;  4Y0P A;  3BDR A;  1OEE A;  5IO7 A;  4YH0 A;  2OL7 A;  1PAD A;  1X8N A;  1FH0 A;  2E03 A;  9PAP A;  1N9Y A;  3B79 A;  2CZT A;  3L4R A;  3TGA A;  4ZJ0 A;  3VHH A;  4TQ2 A;  1ZNG A;  4HWM A;  1UKF A;  1NQC A;  4FBO A;  3BY0 A;  5D45 A;  3K24 A;  1HXZ A;  5L8N A;  3KWZ A;  3JSQ A;  3S5X A;  2RTH B;  1VWJ B;  1BGO A;  1NQM A;  4GE1 A;  2K62 A;  1GX9 A;  5DG4 A;  1A6R A;  1PPP A;  2IZD B;  2LA7 A;  2FKG A;  3HOL A;  3PQS A;  1YK7 A;  4COT A;  2KTD A;  4INN A;  1VWO B;  4IB9 A;  1YP7 A;  2IZH B;  4IUM A;  1D2U A;  4BGF A;  1D3S A;  4KII A;  5HWZ A;  2AT0 X;  4AZM A;  3E3C A;  3O65 A;  1YK8 A;  3KVN A;  5HTE A;  2UYW A;  1HQQ A;  2RD7 C;  2Q2M A;  4N79 A;  3RNV A;  3F9D A;  4CDF A;  1SWO A;  1HBQ A;  4ZCB A;  1MX8 A;  3S3R A;  1VYG A;  1VWP B;  3P5W A;  2XU4 A;  2QOM A;  3VGW A;  3RWX A;  3MHH A;  1YWC A;  1B4M A;  1LIC A;  2A8G A;  4TNN A;  3UEX A;  2BU3 A;  5K68 A;  1B56 A;  1JV4 A;  1KFU L;  2ACT A;  2WBF X;  3BOW A;  5CSE A;  1HMS A;  1SXY A;  2NND A;  4YYQ A;  1LIE A;  3TMP A;  5AQ6 A;  1GGL A;  1MS6 A;  1ICM A;  3PT2 A;  4GGZ A;  2A0A A;  2WWP A;  4GRJ A;  3RBY A;  3RVX A;  5A24 A;  3T6F A;  2AYN A;  1PXV A;  2Y3E A;  4QZU A;  2AS8 A;  4A1Y A;  5BYP A;  4RNA A;  1PPO A;  4YDA A;  3IFB A;  4LZV A;  1KL5 A;  2AUX A;  4ES7 A;  4Z28 A;  5H9L A;  1AU4 A;  2CB5 A;  5EZS A;  3C76 X;  2FS6 A;  3WYP A;  4OVZ B;  2FYE A;  1QXP A;  2JGS A;  5CE4 A;  1SRF A;  1FJ1 E;  5LJB A;  1E2T A;  2RTP B;  1MUP A;  3SLT A;  2OY5 O;  5IXG A;  2AUZ A;  1HMT A;  1ZNE A;  2OFB A;  3EM0 A;  1CSB B;  3I17 A;  4I9R A;  1CB5 A;  3PNR A;  1JYJ A;  1MX7 A;  3OVZ A;  3U8E A;  5HAE A;  3F6Z B;  2FLJ A;  1JIW I;  3T2X A;  4HFO A;  4MZO A;  1FDQ A;  1VWM B;  4P6G A;  4R3D A;  4BOU A;  1GKA B;  5B5F A;  1AVE A;  1CBQ A;  3NHE A;  5H8T A;  1JJU A;  4A8Z A;  3WZQ A;  2X8S A;  1GT1 A;  4DQ4 A;  1RST B;  5KID A;  1NL6 A;  1I4U A;  2E4J A;  1CRB A;  3NX2 A;  1EUO A;  4GUZ A;  4GDZ A;  1PTS A;  4NP1 A;  3IMA A;  4AYH A;  3SAO A;  1PEE A;  1OEJ A;  2Q2P A;  2Z84 A;  3KWB X;  2OFA A;  1SY3 A;  2CAM A;  4A1H A;  2GFO A;  1SWR A;  2C0Y A;  4BX7 B;  2QMI A;  4BOQ A;  3WZO A;  1O1V A;  1QY2 A;  4OEM A;  3BBA A;  1EQD A;  2G78 A;  4O3Y A;  3APV A;  2FHN X;  1G7N A;  1K24 A;  4U8U O;  5EEE A;  1E00 A;  4ORR A;  1X8U A;  5L8I A;  2RTK A;  2BDL A;  2IZG B;  3CMP A;  2VFC A;  3WVM A;  3LFY A;  1A2D A;  5JZE A;  4Y0S A;  4FGI B;  3VG7 A;  1SWD A;  4JNJ A;  2NP1 A;  2A2G A;  2IZK A;  1VWA B;  5HCE C;  1BY8 A;  3QT4 A;  3C0R A;  1TOU A;  4NW4 A;  3TGC A;  2FTB A;  4KT5 A;  1KT6 A;  3NQ9 A;  2HKD A;  3HOE A;  1QOL A;  2FO5 A;  4OVZ A;  1IFC A;  4HPB A;  5EF4 A;  1Y4H A;  2QO5 A;  1I04 A;  1ZCM A;  1Y9T A;  2X34 A;  3PEC A;  2FT9 A;  4TKB A;  2DM5 A;  5FEN A;  4OS8 A;  4CPH B;  1U9X A;  4QRV A;  2OFM X;  4PSQ A;  4YFQ A;  3UEW A;  1NC9 A;  1YVB A;  1NBX A;  4GDA A;  5HA0 A;  1S4V A;  2FWV A;  5LKE A;  4XMH A;  1EWO A;  5C0N A;  2DZY A;  2EU7 X;  3BX8 A;  1NGL A;  3N3K A;  1PBH A;  1GKA A;  4U8U N;  1T8V A;  2IPP B;  1ZRY A;  4YFR A;  3F8A A;  2CBS A;  4BSQ A;  3BCN A;  1OPB A;  4WHI A;  1MK5 A;  2ARY A;  2CM4 A;  2FHL A;  4NLJ A;  4O4U A;  4YBU A;  1KXO A;  4G54 A;  4Z2O A;  4C5P A;  1KT3 A;  3PP6 A;  2MHD A;  4YMY A;  3FMZ A;  1EXS A;  1MEP A;  3P6E A;  1Y9L A;  3AUM O;  4EKV A;  4Z2P A;  3WJC A;  2DJG A;  4KC7 A;  1DF3 A;  3ZUA A;  4BX6 B;  5LJG A;  3PRM A;  3CR6 A;  4NYR A;  2MJI A;  2QO6 A;  3NPO A;  1PBY A;  1NLJ A;  4GZV A;  1N4J A;  4ORU A;  4ZGF A;  1BSY A;  1EAL A;  3H7D A;  4MVI A;  3D97 A;  1MEG A;  3PSE A;  3QQ2 A;  4Z6J A;  2AT5 X;  2KW1 A;  4I3C A;  1CQD A;  4AXM A;  4BOS A;  3VE2 A;  1W4T A;  1IKE A;  4L3R A;  4QGW A;  3KFQ A;  4MM3 B;  3AKN A;  1LKE A;  2Y3F A;  3PDF A;  3TZS A;  3I3T A;  4XMC A;  1EPB A;  5IO6 A;  1STF E;  1BEB A;  2AU1 A;  2BTW B;  5HBS A;  4ARH A;  4CPH A;  2J7Q A;  1HBP A;  2HXZ A;  3MTV A;  1YWA A;  4AZO A;  5AEO A;  2ATO A;  4KH8 A;  4YKO A;  4RF0 A;  2FTD A;  4KLB A;  4YYR A;  4YGH A;  1BQI A;  4CZW A;  3OIS A;  3RDS A;  4IAX A;  1WUB A;  1UYO X;  1B8E A;  5KHP A;  3MJ5 A;  4CSB A;  1ME4 A;  1BRP A;  4XR7 A;  4FJC A;  2X8F A;  5B29 A;  3OQC A;  2B1M A;  4IMO A;  4N4Z A;  3WXE A;  3PED A;  4BVM A;  4IB6 A;  4FBR A;  4YYW A;  2NQG A;  4ORW A;  3VHM A;  1XKG A;  3X00 A;  2RTA A;  3U03 A;  4I07 A;  4OW0 A;  4X6H A;  3G7X A;  4CPF A;  5DPQ A;  2JU8 A;  1BM5 A;  3SZH A;  3U9P C;  1I78 A;  2G5L A;  2P0R A;  1EPA A;  3BU9 A;  4BX6 A;  3PPT A;  4OKA A;  3ELX A;  3RDM A;  2W2B A;  1QWD A;  2AYO A;  5AJB A;  2FKJ A;  1SRH A;  3FA9 A;  5LJK A;  4N7D A;  2QM9 A;  1T68 X;  4YKM A;  1YZB A;  1F2B A;  3D9W A;  3RDO A;  1Q6K A;  5JH3 A;  4OS3 A;  1Y0G A;  1VWH B;  3NQ3 A;  4MVK A;  4I3D A;  1OBQ A;  1KOI A;  2A2U A;  2O6X A;  3ZI8 A;  1KQW A;  2WPU A;  4GNY A;  2VHS A;  2R73 A;  3NX1 A;  4ZH6 A;  3KFF A;  1OSP O;  1ZNK A;  1STS B;  4BCS A;  2RCT A;  2Y6E A;  2BTW A;  2CBR A;  1PPN A;  3WXG A;  5KO3 A;  1KFF A;  3TNX A;  1S2P A;  2F09 A;  2XU1 A;  4MVE A;  4JHQ A;  1GEC E;  3HWF A;  2BSZ A;  3ZWE A;  4LKT A;  2HLV A;  3VU1 A;  4MZS A;  5F6B A;  3S3Q A;  4GNW A;  1I06 A;  4O3W A;  2GH7 A;  4M0W A;  3VPJ E;  4K19 A;  5F1E A;  5D48 A;  1VPR A;  4O9S A;  3IEJ A;  1SY1 A;  4DMY A;  5CYB A;  2UZ2 A;  2OFR X;  7PCK A;  1PVJ A;  4YCE A;  1YIV A;  2WR6 A;  1KGL A;  1SWE A;  5LJE A;  4TLJ A;  4KC8 A;  1JQP A;  2L9C A;  2X46 A;  4I3B A;  3EBW A;  2BS5 A;  1SWN A;  1URE A;  3KX1 A;  4QAE A;  4YGZ A;  1VWG B;  1Y53 X;  1YP6 A;  2WQA E;  5BVQ A;  4QH6 A;  2FR3 A;  2IBI A;  4DCB A;  5K67 A;  3MG5 A;  2CZU A;  2XST A;  3CBK A;  2NNE A;  5B3M O;  1SWQ A;  3HWG A;  1DZJ A;  3VG2 A;  5JR8 A;  4N7C A;  3STM X;  1KL3 A;  3D4R A;  4D8I A;  3ZW2 A;  1TU6 A;  1VWL B;  4TKH A;  3FID A;  1GLO A;  5L3Y A;  3QKG A;  1U18 A;  3K8U A;  3SLO A;  1KFX L;  1GXA A;  1X9Y A;  2R56 A;  1DEU A;  3PRP A;  1E5P A;  4FK5 A;  2G7Y A;  2KD2 A;  1LCV A;  3FEK A;  1FEN A;  4PP2 E;  1M6D A;  2DJF B;  3VG6 A;  1L6M A;  2HNX A;  2WSJ A;  2YJC A;  5E6J A;  1SWG A;  3CBJ A;  1LFO A;  1Y08 A;  4I60 A;  4Y0R A;  4AZN A;  4AW8 A;  2NQD B;  4HPA A;  2RTE B;  2L68 A;  2VFB A;  3BPM A;  3FA6 A;  1BBP A;  4LKP A;  1SRI A;  2JTC A;  5HZ6 A;  1ICN A;  1A3Y A;  1F2C A;  3RDU A;  1ICF A;  2RTD B;  3HWE A;  4AZR A;  2A3F X;  2OZQ A;  4Q8G A;  3RE6 A;  3BS2 A;  2A5B A;  1WBI A;  3K3L A;  1PIP A;  1IW2 A;  3MX7 A;  2I5V O;  3V6E A;  5HZ8 A;  1TW4 A;  2YJB A;  1VWQ B;  1GM6 A;  4LQZ A;  1EWM A;  3E1Z B;  1YT7 A;  1MM9 A;  2F7D A;  2YJ8 A;  4MI7 A;  1RXH A;  1BRQ A;  5LKF A;  4WFU A;  1VSN A;  4IRW A;  4B55 A;  5K06 A;  3CQR A;  4PT5 A;  2ASN X;  2DC6 A;  1W5R A;  2BDZ A;  5IO5 A;  3K9M A;  3PH6 A;  1MHW A;  2X4M A;  3KZA A;  4BPV A;  4MIS A;  4YYV A;  2MO5 A;  5FQ7 E;  3PQU A;  1LCW A;  1X71 A;  3RSW A;  3GCB A;  1AYU A;  4ML7 B;  1S44 A;  4REZ A;  5K16 A;  4O4S A;  3TF6 A;  4MSX A;  2OUL A;  3RVV A;  2YMS A;  4WA6 A;  5JA7 A;  2R9F A;  3PH5 A;  3U0D A;  5IRU A;  1HMR A;  2RTB B;  3B21 A;  1KT7 A;  3P5V A;  1ZND A;  4XMD A;  2DJF A;  3H8C A;  3UEV A;  2JMB A;  3VHI A;  2LBA A;  3HHA A;  1VWD B;  2AKQ A;  2HMB A;  4YBP A;  3FW5 A;  2RTN B;  4IB7 A;  3EC5 A;  1G85 A;  3BX7 A;  1XKI A;  4CDC B;  2AIM A;  5B11 O;  1CVZ A;  4NLI A;  1BP4 A;  1FEM A;  4BOE A;  1O1U A;  4I05 A;  2PAD A;  5HCC C;  1CBI A;  3UEU A;  1QFV A;  3TGB A;  1BSQ A;  1MDW A;  1OPA A;  4X6I A;  2HHN A;  3ZNH A;  5IRA A;  5HTD A;  3PK2 A;  5B10 O;  3OD9 A;  5H9A A;  4NV8 A;  4YYU A;  4U46 A;  1STR B;  5D8J A;  1EII A;  4O3Z A;  1U9V A;  2OY8 A;  2NQI A;  3IA8 A;  3NBX X;  3N91 A;  2GTL M;  3BLG A;  4Q8H A;  1RBP A;  1VWI B;  1X8O A;  3FIQ A;  3P6F A;  4QGX A;  1G5W A;  2FE8 A;  5FQ8 E;  1O0E A;  3WZP A;  1GT3 A;  4IB8 A;  4I95 A;  1KZX A;  4OMX A;  1ATK A;  3ZUI A;  2ZAG A;  4EFG A;  3WXQ A;  3NAD A;  2IZI A;  1AEL A;  1VWC B;  3WBG A;  1PBO A;  5F7G A;  4DQ3 A;  1E02 A;  2MWH A;  1G74 A;  1U5I A;  4XMF A;  4YDB A;  3CKF A;  1SRJ A;  3FR5 A;  1F29 A;  2B1N A;  3AEH A;  3BU1 A;  3FEN A;  3P5U A;  2RA6 A;  1W6F A;  2M4L A;  1FTP A;  3ZZV A;  5IRW A;  1Y52 X;  1BSO A;  2JW1 A;  2FS7 A;  1SWP A;  1GX3 A;  2DC8 A;  3T6L A;  3FEL A;  1BLR A;  4YV8 A;  5PAD A;  3D95 A;  4BX7 A;  1AU0 A;  3PHU A;  1ERB A;  4ZR2 A;  1ME3 A;  5J94 A;  3USV A;  4HWY A;  4WFV A;  1A18 A;  3NR3 A;  1N0S A;  4OEL A;  4ZH9 A;  4D8B A;  4CDC A;  1UZ2 X;  2FT2 A;  2IFB A;  1VWE B;  1SWB A;  2RTM A;  1IFB A;  4XUI A;  2RCQ A;  3HWN A;  1IKJ A;  4ORY A;  3H89 A;  1AQB A;  4D6A A;  1KXR A;  5HZ5 A;  2Q39 A;  1LF7 A;  1ML7 A;  4WUR A;  4RKX A;  3CBS A;  3W30 A;  3O19 A;  2OVA A;  2RTF B;  3BSZ E;  3C77 X;  1HY2 A;  3PHW A;  4RF1 A; 
#chains in the Genus database with same CATH homology
 1CJL A;  3BWK A;  2R9N A;  2VHS A;  1U9W A;  4W4U A;  4YYQ A;  3F75 A;  2Y6E A;  1MS6 A;  1PPN A;  3WXG A;  6PAD A;  3TNX A;  2HH5 A;  1CS8 A;  2XU1 A;  1AU3 A;  3BC3 A;  1NB3 A;  3D6S A;  5FPW A;  3RVX A;  1GEC E;  2BSZ A;  2OP3 A;  5A24 A;  2AYN A;  1PXV A;  4MZS A;  3M99 A;  2AS8 A;  3KW9 A;  1PPO A;  3O1G A;  4PAD A;  4N8W A;  4K7C A;  3S3Q A;  1AU2 A;  2GHU A;  3OF8 A;  2DCC A;  3WXF A;  2AUX A;  4PP1 A;  3KKU A;  1AU4 A;  1EWL A;  2CB5 A;  4DMX A;  3IEJ A;  8PCH A;  4DMY A;  2XU5 A;  2DZZ A;  7PCK A;  3MTN A;  4FIP A;  2FYE A;  1QXP A;  1KHP A;  1VJV A;  1JQP A;  3QSD A;  1E2T A;  2AUZ A;  3KX1 A;  1AYW A;  1CSB B;  4RY2 A;  1CB5 A;  3IV2 A;  4QH6 A;  2IBI A;  3PNR A;  3OVZ A;  3U8E A;  2YJ9 A;  3H8B A;  4YVA A;  3CBK A;  3DF0 A;  1AIM A;  1KHQ A;  4CDD B;  4MZO A;  4NV7 A;  5CVM A;  3IOQ A;  4P6G A;  2DCA A;  3QJ3 A;  3NHE A;  1TU6 A;  3MOR A;  3P5X A;  2FRA A;  1U9Q X;  1NL6 A;  3N4C A;  1GLO A;  4GUZ A;  1AYV A;  2DCD A;  3IMA A;  3MHS A;  3HD3 A;  3ERV A;  3K8U A;  5CHV A;  4X6J A;  1KFX L;  3KWB X;  3CH3 X;  2JQF R;  2GFO A;  5F02 A;  1X9Y A;  2C0Y A;  1DEU A;  2Y5B A;  2JQG R;  4FK5 A;  2G7Y A;  1MIR A;  4PP2 E;  1M6D A;  2DJF B;  1YAL A;  3HHI A;  4OEM A;  3AI8 A;  4YYS A;  2VHF A;  2YJC A;  3O0U A;  3CBJ A;  1SP4 B;  2YJ2 A;  2BDL A;  1Y08 A;  2VFC A;  2NQD B;  3H6S A;  4W5C A;  4P6E A;  3LFY A;  3N3G A;  2OZ2 A;  2VFB A;  3BPM A;  1CPJ A;  3IUT A;  3F5V A;  3IHP A;  1TLO A;  4BS6 A;  1PPD A;  1CV8 A;  2G8J A;  1F2C A;  4ZUX U;  1BY8 A;  3BPF A;  3QT4 A;  1ICF A;  4Q8G A;  2E00 A;  1QOL A;  2FO5 A;  5EF4 A;  2R9M A;  2E01 A;  1POP A;  2WBF X;  1Y4H A;  4CDE B;  1PIP A;  2R9C A;  2FRQ A;  3V6E A;  1ZCM A;  3OVX A;  2YJB A;  4PI3 A;  3LXS A;  1EWM A;  3RVW A;  1QDQ A;  3E1Z B;  1YT7 A;  3PBH A;  2F7D A;  2YJ8 A;  1U9X A;  4QRV A;  5CVN B;  1VSN A;  4B55 A;  1YVB A;  4CDD A;  2FUD A;  2DC6 A;  3LTW A;  1W5R A;  1S4V A;  1GMY A;  1EWO A;  2DZY A;  2BDZ A;  3K9M A;  3N3K A;  1PBH A;  1MHW A;  2IPP B;  1EWP A;  2PBH A;  4BPV A;  4BSQ A;  2HD5 A;  4YYV A;  1F2A A;  3BCN A;  3C9E A;  1PCI A;  2ARY A;  2PRE A;  1GCB A;  3GCB A;  1AYU A;  2G8E A;  5K16 A;  3PW3 A;  4G54 A;  1PE6 A;  4MSX A;  2OUL A;  2P86 A;  3RVV A;  2E02 A;  4C5P A;  4QBB A;  4WA6 A;  5JA7 A;  2R9F A;  4AXL A;  1AEC A;  4BS5 A;  3I06 A;  3P5V A;  2DC9 A;  2P7U A;  2DJF A;  2DJG A;  4QRX A;  3H8C A;  3ZUA A;  3HHA A;  1IWD A;  1DF0 A;  4CDF B;  1NLJ A;  4CDC B;  2AIM A;  3KSE A;  1K3B B;  1CVZ A;  1BP4 A;  1TL9 A;  2AVW A;  4I04 A;  4I05 A;  2PAD A;  5CHT A;  1ITO A;  2R9O A;  3H7D A;  1THE A;  1MDW A;  1MEG A;  4X6I A;  2HHN A;  1NPZ A;  1CQD A;  2DC7 A;  4NV8 A;  1MEM A;  4AXM A;  4YYU A;  5EGW A;  1W4T A;  1U9V A;  2NQI A;  4CDE A;  3KFQ A;  1NB5 A;  4Q8H A;  4BQV A;  2H7J A;  3PDF A;  3I3T A;  2F1G A;  1ZIV A;  2NQA A;  1STF E;  2AU1 A;  1PAD A;  1O0E A;  4W5B A;  1FH0 A;  1SNK A;  2HXZ A;  2E03 A;  2ATO A;  9PAP A;  3B79 A;  1ATK A;  2XU3 A;  2FTD A;  4KLB A;  4YYR A;  1BQI A;  2PNS A;  1NQC A;  3V6C A;  4CZW A;  3OIS A;  1HUC B;  3K24 A;  1QMY A;  1ME4 A;  3KWZ A;  1U5I A;  4XR7 A;  4FJC A;  1BGO A;  2B1M A;  1F29 A;  4N4Z A;  3WXE A;  2B1N A;  2R6N A;  4YYW A;  3P5U A;  1A6R A;  1PPP A;  1W6F A;  2NQG A;  1XKG A;  1YK7 A;  2DCB A;  4I07 A;  4X6H A;  1GX3 A;  2DC8 A;  2G6D A;  4BGF A;  1CTE A;  4YV8 A;  5PAD A;  1AU0 A;  3CH2 X;  2P0R A;  1YK8 A;  3OF9 A;  1ME3 A;  5J94 A;  3USV A;  4HWY A;  4OEL A;  4N79 A;  2AYO A;  4CDF A;  2CIO A;  1EF7 A;  4CDC A;  4QRG A;  3S3R A;  1K3B A;  2FT2 A;  5CVO B;  3P5W A;  2XU4 A;  4XUI A;  3HWN A;  3MHH A;  3H89 A;  1KXR A;  1F2B A;  3D9W A;  1Q6K A;  5JH3 A;  2FQ9 A;  1KFU L;  2DJG B;  2O6X A;  2ACT A;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...