5LJEA

Crystal structure of holo human crbp1/k40l,q108l mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
134
structure length
134
Chain Sequence
PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDLEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTLWIEGDELHLEMRVEGVVCKQVFKKVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Retinol-binding protein
molecule keywords Retinol-binding protein 1
publication title Structural and molecular determinants affecting the interaction of retinol with human CRBP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5ljeA00
2JU8A 1ZRYA 2QOSC 3FR4A 3KFIA 5HCEC 5BVTA 2HMBA 4QGWA 3AKNA 4IMOA 3F9DA 5D48A 3EYCA 1XKIA 3B2HA 2ASNX 1CBIA 1PMPA 3P6EA 3U0DA 3WBGA 1B4MA 2AKQA 2O62A 1AELA 1FELA 1QWDA 3MVFA 1LIDA 5EEDA 5HBSA 1YWDA 1IFBA 2CBRA 4YKMA 1GXAA 2F73A 5FFHA 3VG7A 4I9RA 4A60A 5EDBA 4ZCBA 3NQ3A 2L67A 4BVMA 4KIIA 3C77X 5L8NA 1ADLA 1TOWA 1BLRA 1XCAA 3FEPA 1A3YA 4GRJA 4TLJA 2BLGA 2FS6A 1JBHA 2WSJA 1DZJA 1KGLA 1TXLA 3NR3A 4IB7A 3TGAA 2HZRA 3UEXA 3CWKA 3HK1A 4GNYA 1TW4A 1EALA 4EFGA 3P6DA 2QO6A 4YCEA 2LKKA 2XKLA 1SY3A 3B2IA 3FIQA 1X8NA 3BX8A 1MX8A 1S44A 4I3BA 2GTFX 5IO5A 2IFBA 3ZQ3A 1O8VA 4AZOA 5AQ6A 3FMZA 2WWPA 4AZRA 2A13A 5F58A 2OFMX 3D97A 1FEMA 4EEJA 1EQDA 1EUOA 5EDCA 4EDEA 4YGZA 5KHPA 2K23A 1P6PA 3KFGA 1BSOA 3QKGA 4A8ZA 4WFUA 1GKAB 3NX2A 4ALBA 4ORXA 4ORRA 5FENA 2WEXA 3U9PC 1BWYA 1QABE 3BRNA 2Q2MA 1DZKA 1MX7A 1ZNDA 3PH6A 3STKA 4HPAA 3STMX 1SXYA 4ZH9A 1LKEA 2W2BA 1E06A 4IAXA 1BRQA 1TOUA 3O22A 4YBUA 1LNMA 3D95A 3BDRA 3FR5A 2HNXA 2AT3X 4ZJ0A 3O2YA 5LKFA 1D3SA 4YH0A 1X8OA 1GT1A 1CRBA 4YMYA 1OPBA 4M6SA 1KOIA 3TGCA 4BOEA 5HTDA 5HZ9A 5L8OA 3D96A 2Q9SA 5EPQA 3K3LA 3HWGA 4HFOA 4RUNA 1YWBA 2AT5X 3NPOA 3P6GA 4MVIA 2GC9A 1BJ7A 5D47A 1VYFA 1OEKA 2DM5A 1HBQA 1FENA 4TJZA 2G78A 4QGXA 2W2FA 2QO5A 4ORYA 3VG5A 1OBUA 4LKTA 4BQUA 4NNSA 4QZUA 2MO5A 1DF3A 5LJCA 3PEDA 1MVGA 4ODDA 5HA1A 2P8GA 1KZWA 5DG4A 1LICA 1HN2A 4ORSA 3VG3A 5JR8A 1KZXA 2POAA 2XSTA 1LIFA 4Y0PA 2QO4A 2A2UA 3UEWA 4AZQA 5LJKA 2AT0X 2MM3A 1QFTA 5B29A 1YP7A 1IIUA 4XMDA 1S2PA 4I3CA 3FLLA 3WJBA 3ZUIA 3I17A 1KT3A 1HQPA 1CBSA 5LJGA 5D45A 4WFVA 4ES7A 3I0AA 1ZNEA 5CE4A 3BSZE 1PM1X 2FR2A 3DSZA 5DPQA 3KZAA 4YGGA 3BLGA 1G85A 4UU2A 3WVMA 1LFOA 1BEBA 3NX1A 4GNWA 3FELA 3VG4A 5EZ2A 4YDAA 1SY1A 1B0OA 3UEUA 2FS7A 3MBTA 4ZHDA 5F6BA 1AB0A 2W2AA 1KT5A 2LBVA 4HPCA 1SXWA 5HZ6A 1QY0A 3DTQA 4Y0QA 4IAWA 3KFHA 2HZQA 1ML7A 3WJGA 5D4AA 4TKJA 5HWZA 3FA6A 2WQAE 1HBPA 2FTBA 1E5PA 2JU7A 4AW8A 4ORUA 3EBKA 1DFVA 4LZUA 4ZHHA 2CM9A 2RQ0A 2RCTA 3B2KA 2CZTA 2CZUA 1CBQA 3CBSA 2QM9A 2FT9A 4ZFXA 2NP1A 1QQSA 1N0SA 1ZNKA 3EM0A 1ACDA 4OMWA 5IO6A 2OZQA 2A0AA 5HZQA 4EXZA 3TGBA 1U18A 3HWEA 2NNQA 3PPTA 3BS2A 1CBRA 4Y0RA 1O1VA 1YP6A 1H91A 2ALLX 1KT4A 4I9SA 1EXSA 1OEJA 1JJJA 3FEKA 2R56A 2OFRX 2AH7X 2X45A 3ZUOA 1GX9A 4AYHA 2A2GA 4AZMA 4LZVA 5D8JA 4K19A 4UU3A 2LB6A 2L68A 1KQWA 3PH5A 4N7CA 4YFRA 2ANSA 4GH7A 1SA8A 1QG5A 1YUPA 4HPDA 5F6ZA 3P6CA 3BY0A 1R0UA 4RUUA 4YKOA 4ORWA 1X8QA 2EU7X 3SAOA 1YWAA 3WJEA 5LJEA 1OEEA 1SXUA 1SY0A 2G79A 2JN3A 1IKEA 4QZTA 2N93A 4QYPA 5EEEA 5H9KA 2RCQA 3PECA 1JYDA 5K06A 3FA8A 2WR6A 3Q6LA 3RZYA 2FRSA 1LIEA 3FENA 2OVDA 5LKEA 2G7BA 3ELXA 4NYQA 1S7DA 2R73A 3STNA 1BSQA 4IB6A 3UEVA 5HAEA 4YCHA 4DQ4A 5H9AA 1KT7A 5F7GA 3PP6A 1OBQA 1A18A 4YGHA 3TF6A 1ZNGA 4HPBA 1IW2A 4IMNA 5HCCC 2WUTA 1GM6A 1KXOA 2K62A 3WJDA 4ZH6A 4YBPA 3CQNA 1OPAA 2ACOA 1DZMA 2AL0X 5C0NA 5HTEA 1LIBA 4ARHA 3EBWA 1AVGI 2WQ9A 3EMMA 2R74A 4DQ3A 1G74A 4NNTA 2FR3A 3BU9A 3WXQA 2JOZA 3IFBA 2FLJA 5L8IA 1IFCA 2L5PA 1NP1A 2Q39A 2LFOA 2AT8X 4IB8A 1TVQA 4XMFA 3NP1A 1VPRA 1I4UA 3P6HA 4O9SA 5KICA 1PBOA 4XMGA 2AT6X 1PEEA 1ERXA 4IBAA 1U0XA 1QFVA 3JS1A 5HZ5A 3CBCA 1U17A 4ALOA 2KTDA 1GT3A 1T0VA 4ZHCA 1JJXA 2E4JA 1KT6A 1OBPA 4LKPA 3WJFA 1GGLA 1SY2A 4I3DA 1JV4A 3FA7A 1EIIA 3BX7A 1HMTA 2LBAA 3NADA 3AKMA 4ZHGA 4N7DA 1UZ2X 2HYSA 1YIVA 5B27A 5BVQA 3B2JA 1EPAA 4XMEA 3C76X 3IA8A 1DC9A 1A2DA 3HWFA 3OJYC 1KQXA 3WJCA 1RBPA 3CMPA 1T68X 3ELZA 4IB9A 4NYRA 4OMXA 3VG6A 4A1HA 1NGLA 2Q4NA 1GKAA 2X46A 3S26A 5F1EA 1E00A 1SXXA 3G7XA 3CR6A 2MJIA 2JU3A 2KT4B 3FR2A 4GETA 1X8PA 3CQRA 1HMSA 5HCDC 1X8UA 2WEWA 3JSQA 4MVLA 4CK4A 3RSWA 1GT4A 4XMCA 4M7MA 4AZPA 1RLBE 3L4RA 3C78X 2Q2PA 3HWDA 4GE1A 3GAQA 1BM5A 4Y0SA 5LJBA 1X89A 1VYGA 4WBKA 2CM4A 3KQ0A 5HZ8A 1UREA 4OS3A 1A57A 4MVKA 1FDQA 1HMRA 3BU1A 4NP1A 4YFPA 2GJ5A 4YDBA 4D6BA 5KIDA 2CBSA 4OS0A 2OVAA 2OVEA 5HA0A 5IO7A 3T1DA 3VG2A 4YFQA 2YG2A 3APVA 1QY2A 1FE3A 1ALBA 5H8TA 1BRPA 1E02A 3APUA 3FA9A 4QAEA 5BVSA 4TKBA 4D6AA 3APWA 2A3FX 1D2UA 3P6FA 1YWCA 4NLJA 3F8AA 1I05A 4QGVA 1EW3A 3U03A 4NLIA 2HLVA 1FTPA 5H9NA 4R0BA 2PY1A 1I04A 4ZR2A 1G7NA 4A1YA 2NNDA 4AZNA 4GKCA 1EPBA 4QYNA 4ZHFA 2ACPX 4PSQA 2RD7C 1JZUA 1ZNLA 1L6MA 2AMMX 1B56A 4XMHA 3FW5A 1BSYA 1ICNA 1T8VA 5FAZA 1ICMA 3NQ9A 1GT5A 2FWVA 4TKHA 5H9LA 1MDCA 1BBPA 3APXA 2L9CA 4TNNA 3B2LA 1MUPA 5LJHA 1CJ5A 3KFFA 3O19A 4OS8A 1G5WA 4ZGUA 1IKJA 1GX8A 3TZSA 1JYJA 2NNEA 1DZPA 1B8EA 2RA6A 1AQBA 1EIOA 1I06A 1ERBA 1NP4A 1LPJA 1DV9A 3FW4A 1Z24A 1O1UA 1X71A 4TQ2A 5LJDA 1ZNHA 1QY1A 1LF7A
chains in the Genus database with same CATH superfamily
4MEEA 2RTHB 2JU8A 1ZRYA 1SWCA 2QOSC 2RTLA 4ARHA 2X32A 3FR4A 3KFIA 1VYOA 5HCEC 5BVTA 2RN4A 5EEEA 2HMBA 4QGWA 1VWPB 2GH7A 3AKNA 4IMOA 3F9DA 4NW4A 3EYCA 1XKIA 3B2HA 1VWGB 5D48A 2ASNX 1CBIA 1PMPA 3P6EA 3U0DA 3WBGA 4GJVA 1B4MA 2AKQA 2O62A 3ZW0B 1FELA 1AELA 1QWDA 3MVFA 3P24A 1LIDA 5EEDA 4DCBA 4Z2PA 4GDAA 1VWDB 5HBSA 1YWDA 1IFBA 2CBRA 4YKMA 3WOVA 3CKGA 1GXAA 2F73A 5FFHA 3AUMO 3VG7A 1HXLA 4I9RA 4A60A 5EDBA 4ZCBA 4U46A 3NQ3A 4QRLA 2YMSA 2L67A 4BVMA 4KIIA 5IRWA 3C77X 2Z4HA 5AEOA 5L8NA 1ADLA 1TOWA 1K24A 2F09A 3SOTA 2DJFA 1LDQA 2RTMA 1VWBB 1XCAA 1BLRA 1K3BA 3FEPA 1A3YA 4GRJA 4TLJA 2BLGA 2RTPB 2FS6A 1KFFA 1JBHA 2WSJA 1DZJA 4HWMA 1KGLA 4NV7A 1EI5A 1TXLA 3NR3A 4IB7A 2GTLM 3TGAA 2HZRA 4BX6B 3UEXA 1KL4A 4BX5A 3CWKA 3HK1A 3AEHA 5B5GA 4GNYA 4JGLA 1TW4A 1EALA 4EFGA 2RTIB 3P6DA 4O3ZA 2QO6A 4YCEA 2LKKA 1MM9A 1N9MA 2XKLA 4GZVA 3UAQA 1SY3A 1SWHA 3B2IA 3QQ2A 4I60A 3FIQA 1X8NA 4CPHA 3BX8A 1WUBA 2X4MA 1MX8A 1S44A 4I3BA 2GTFX 5IO5A 2IFBA 4CDDA 3ZQ3A 1O8VA 2F01A 4AZOA 4KC8A 5AQ6A 1STPA 3FMZA 2IZFB 4QQ1A 2WWPA 4AZRA 2A13A 4MVEA 5F58A 4JNJA 4YVBA 2OFMX 3D97A 2RTDB 1FEMA 5B10O 1SWNA 1EQDA 1EUOA 5EDCA 4EDEA 2RTJA 4EEJA 4BBOA 4YGZA 3S5VA 2K23A 1P6PA 1SWRA 1BSOA 3KFGA 3QKGA 4A8ZA 4WFUA 3S5XA 4Z27A 4GGRA 1W4TA 1GKAB 3NX2A 4ALBA 4ORXA 4ORRA 5FENA 2WEXA 3WZNA 3U9PC 1BWYA 1MOYA 1QABE 1SWUA 3BRNA 2Q2MA 1DZKA 5K68A 1MX7A 1ZNDA 4L1NA 1Y9TA 3PH6A 3RDXA 5BYPA 3STKA 2OFAA 4HPAA 1SLEB 1N7YA 3STMX 1WBIA 2OY8A 1SXYA 4ZH9A 1LKEA 2OFBA 2RTKA 1E06A 2W2BA 4IAXA 1BRQA 1TOUA 3O22A 4YBUA 3T2XA 1Y52X 3VPJE 4O4XA 1SLDB 4CPHB 1LNMA 1NQNA 3D95A 4Y59A 3VHIA 3BDRA 1KL3A 2FKGA 3FR5A 4GGZA 2HNXA 2AT3X 4JO6A 3KVNA 3VHHA 4ZJ0A 2OY7A 3O2YA 5LKFA 1D3SA 1MK5A 4YH0A 1X8OA 1GT1A 1CRBA 4ML7B 4YMYA 1OPBA 1SWKA 4M6SA 2VFCA 1KOIA 1Y53X 3TGCA 4BOEA 5HTDA 5HZ9A 5L8OA 3FDCA 3D96A 2Q9SA 5EPQA 3K3LA 3HWGA 4HFOA 4RUNA 1YWBA 2AT5X 3LHNA 1AVEA 3NPOA 3P6GA 3Q34A 4MVIA 2GC9A 1BJ7A 5D47A 1VYFA 3EW2A 4I6SA 1OEKA 2DM5A 1HBQA 1RSUB 1FENA 1SWQA 4TJZA 2G78A 5KHPA 1NDJA 1N4JA 4QGXA 2W2FA 2RTRB 1SWTA 2QO5A 4MISA 4ORYA 3VG5A 1OBUA 4LKTA 4BQUA 4NNSA 4QZUA 2MO5A 3VE1A 1DF3A 3RDOA 3S60A 3PEDA 5LJCA 4Z2OA 1MVGA 3OD9A 4ODDA 3ZWEA 5HA1A 2P8GA 1VWHB 1KZWA 5DG4A 5L3YA 3HPEA 2X8SA 1LICA 1HN2A 4ORSA 3VG3A 5JR8A 2UZ2A 1KZXA 3WZPA 2IZGB 2POAA 2XSTA 1LIFA 4Y0PA 1VWQB 1VWCB 3SLOA 2QO4A 4NV8A 3VHMA 2A2UA 2JMBA 3UEWA 2OY5O 3ZI8A 4AZQA 5LJKA 2AT0X 3P02A 2MM3A 1QFTA 2OY1O 2RTAA 1LUQA 5B29A 1YP7A 2FKJA 1IIUA 4XMDA 1S2PA 4I3CA 3FLLA 4FQBB 3WJBA 3ZUIA 1SWJA 3I17A 1KT3A 1HQPA 1CBSA 5LJGA 2IZAA 3RE6A 3VU1A 5D45A 4WFVA 4ES7A 3I0AA 1SRJA 5IRUA 1ZNEA 5CE4A 3BSZE 1PM1X 2FR2A 3DSZA 5DPQA 3KZAA 4BX7A 5B5FA 4PJ2A 3BLGA 4YGGA 1G85A 2FHLA 5FQ7E 4UU2A 4ZGFA 3WVMA 1LFOA 2JGSA 2OL6O 1LCWA 1BEBA 3T2WA 3ZW2A 3NX1A 4GNWA 3FELA 3VG4A 3VGWA 2X55A 5EZ2A 4GK9A 4YDAA 2Y3EA 1SY1A 1B0OA 3UEUA 5LJEA 2FS7A 3MBTA 4KC7A 2M4LA 4ZHDA 5F6BA 2X8TA 4OEMA 4L3RA 4IABA 1AB0A 2W2AA 1KT5A 2LBVA 4HPCA 1SXWA 3SLTA 5HZ6A 1QY0A 3DTQA 2ZSCA 2IZKA 4Y0QA 4IAWA 4KCAA 1SLFB 3KFHA 1NC9A 1SWPA 1VWMB 2HZQA 4GD9A 1ML7A 3WJGA 5D4AA 4FBRA 4TKJA 3T6FA 1SRHA 5HWZA 3FA6A 2WQAE 1HBPA 1LDOA 2FTBA 1E5PA 2JU7A 5B3MO 4AW8A 4O3XB 4ORUA 1Y55X 4Y5DA 3EBKA 3WYPA 1DFVA 4LZUA 4INNA 4ZHHA 2CM9A 2RQ0A 1I78A 2I5ZO 3RBYA 1SMPI 2IZLB 2RCTA 3B2KA 2CZTA 3HTYA 2CZUA 1CBQA 3CBSA 2G8CO 2QM9A 2RTFB 2FT9A 4ZFXA 4GUZA 1SWBA 2NP1A 1QQSA 1N0SA 1VWLB 1ZNKA 4IRWA 4O4UA 2Z4IA 3EM0A 1ACDA 4OMWA 5IO6A 2OZQA 1E2TA 2A0AA 5HZQA 4EXZA 3TGBA 2A5CA 1U18A 3HWEA 2NNQA 3PPTA 5AJCA 3BS2A 5CSEA 1CBRA 4Y0RA 3OBLA 1O1VA 1OSPO 1H91A 1YP6A 2ALLX 1KT4A 4I9SA 4LQZA 5FQ8E 1EXSA 1OEJA 4BX5B 1RXHA 2C1QA 1JJJA 3RDSA 3FEKA 3SZHA 4D6BA 2R56A 2OFRX 3WZOA 2AH7X 2X45A 3ZUOA 1GX9A 4AYHA 3PQSA 4CSBA 2A2GA 4QNIA 4AZMA 1SRGA 2OL8O 2VDFA 4LZVA 5D8JA 4K19A 2FHNX 4UU3A 2LB6A 2L68A 1KQWA 3PH5A 4CV7A 4YBPA 1SWOA 4N7CA 2RTQB 4YFRA 3MG5A 2ANSA 4GH7A 1SA8A 1QG5A 1YUPA 4HPDA 5CHKA 1VWEB 5F6ZA 3P6CA 2LA7A 3BY0A 3ZW1A 2PI3O 1SWLA 1JJUA 1R0UA 2WPUA 4RUUA 4YKOA 4ORWA 1X8QA 2EU7X 3SAOA 1VWRB 1YWAA 2G5LA 2ZAIA 3MM0A 3WJEA 1OEEA 1SXUA 1SY0A 1W6FA 2G79A 1IKEA 1VWNB 2JN3A 2N93A 3EW1A 4QYPA 4QZTA 5K67A 2VFBA 5H9KA 2RCQA 3CKFA 3E3CA 1JYDA 2KD2A 3PECA 3PK2A 5K06A 3FA8A 2WR6A 3Q6LA 5IRAA 3RZYA 2FRSA 4BCSA 1HY2A 1LIEA 3FENA 3SZIA 2OVDA 5LKEA 2G7BA 2IZIA 3ELXA 4NYQA 3ZZVA 2IZBA 1S7DA 2R73A 4U9CA 3STNA 2IZCB 1BSQA 4IB6A 3UEVA 5HAEA 4YCHA 4DQ4A 5H9AA 1KT7A 5F7GA 3PP6A 1OBQA 1A18A 4YGHA 3TF6A 5F2BA 1ZNGA 4HPBA 1IW2A 2BS6A 4ID2A 4IMNA 5HCCC 2WUTA 1GM6A 1KXOA 2K62A 2MWHA 3WJDA 4ZH6A 2QMIA 3PDFA 3CQNA 1OPAA 2ACOA 1DZMA 2AL0X 2IZEB 2KTSA 1LIBA 3D4RA 4ON1A 5HTEA 3ZW0A 3EBWA 1AVGI 2WQ9A 3EMMA 2R74A 1JMZA 1G74A 4DQ3A 2CAMA 4NNTA 3PQUA 2FR3A 2I5VO 4OKAA 3BU9A 3WXQA 2JOZA 3IFBA 2FLJA 4FBVA 4BGFA 1Y9LA 2BSZA 1RAVA 5L8IA 1IFCA 4GGTA 2C1SA 2L5PA 1NP1A 2Q39A 2LFOA 3F6ZB 4JHQA 1W5RA 2AT8X 4IB8A 1TVQA 4XMFA 1PBYA 3NP1A 1VPRA 1VWOB 1I4UA 3P6HA 1VWJB 4O9SA 5KICA 2GTLO 3LTWA 1PBOA 4XMGA 1NBXA 2AT6X 2BT9A 2KW1A 3JQOA 1PEEA 1SWSA 5B2AO 4Z6JA 4CPEA 1ERXA 1SWFA 4IBAA 1U0XA 1QFVA 3JS1A 5B11O 3RKGA 4B55A 4BX6A 5HZ5A 1JQPA 4KH8A 3CBCA 1U17A 4ALOA 1PTSA 2KTDA 1GT3A 1SRIA 1T0VA 2MHDA 3RY2A 4ZHCA 1JJXA 2E4JA 5IXGA 1KL5A 1KT6A 1OBPA 4LKPA 3WJFA 3WZQA 1GGLA 1LELA 1SY2A 4I3DA 1JV4A 3FA7A 1EIIA 4OELA 4CDFA 1UYOX 2RTBB 2OVSA 1MEPA 3BX7A 1HMTA 1N43A 2LBAA 5C0NA 3NADA 3AKMA 4ZHGA 4N7DA 1UZ2X 2HYSA 1YIVA 5B27A 5BVQA 3B2JA 4U8UO 3HOLA 1EPAA 2FGSA 2JW1A 4XMEA 3C76X 3FYFA 2Y3FA 1DC9A 3IA8A 1A2DA 3HWFA 3OJYC 4DNEA 1KQXA 3WJCA 1SRFA 1RBPA 3CMPA 1T68X 3ELZA 3HOEA 3MX7A 4IB9A 4NYRA 4OMXA 3VG6A 2X34A 4A1HA 1GX3A 1NGLA 3RDUA 2Q4NA 1GKAA 2X46A 4CPIA 1I9HA 3S26A 2RTNB 4CDCA 4BX7B 2IZDB 5F1EA 1E00A 1SXXA 3G7XA 4MIRA 2X8FA 1SWAA 2RTGB 3CR6A 2MJIA 2JU3A 2KT4B 3FR2A 4GDZA 4O3YA 1VWIB 4GETA 1X8PA 3CQRA 1Y0GA 1VWAB 1RXJA 1HMSA 5HCDC 1RSTB 2HKDA 1X8UA 2WEWA 3JSQA 3NBXX 4MVLA 4WHIA 3RDQA 4CK4A 3RSWA 1SWDA 1GT4A 4XMCA 5FQ6E 4M7MA 4AZPA 2OL7A 1RLBE 3L4RA 1SLGB 2ZAGA 3C78X 2Y32A 1SWEA 2Q2PA 3HWDA 4GE1A 4O49A 3RWXA 3GAQA 3SZJA 1BM5A 4FBOA 4GU8A 4Y0SA 2OF8A 5CYBA 5LJBA 1X89A 2RTEB 1VYGA 4WBKA 2CM4A 3KQ0A 4KT5A 4C5PA 1JIWI 1UREA 4OS3A 5HZ8A 2AF5A 1A57A 4MVKA 1FDQA 3SLJA 1HMRA 2QOMA 1HXZA 2RTCB 3BU1A 1RXKA 3FIDA 2GJ5A 4I95A 4NP1A 4YDBA 4YFPA 4Z28A 1VWKB 2CBSA 2BC3A 4EQAC 5KIDA 2X56A 2OVAA 4OS0A 3VE2A 4U8UM 2OVEA 5HA0A 5IO7A 3T1DA 3VG2A 4YFQA 2YG2A 3APVA 1QY2A 1FE3A 4COTA 3X00A 1ALBA 5H8TA 1BRPA 1E02A 3APUA 3FA9A 4QAEA 2GTLN 5BVSA 4TKBA 4D6AA 3APWA 4O3WA 2A3FX 1D2UA 2DJGA 1YWCA 3P6FA 4NLJA 3F8AA 1I05A 4QGVA 1EW3A 4CDEA 1N9YA 4NLIA 4EKVA 3U03A 1HQQA 2HLVA 1FTPA 2IZHB 5H9NA 4R0BA 2PY1A 1I04A 4ZR2A 1G7NA 2BHVA 1JMXA 4A1YA 2NNDA 1NQMA 4AZNA 4GKCA 4O4SA 3T6LA 1EPBA 2UYWA 3GE2A 4U3QA 1AVDA 3H3IA 4QYNA 5LJDA 4ZHFA 3OE3A 2ACPX 4PSQA 2RD7C 1JZUA 1ZNLA 1L6MA 2AMMX 1B56A 2RTOB 4XMHA 4BJ8A 3FW5A 1BSYA 5JD2A 1FJ1E 1ICNA 1UYNX 3RDMA 1T8VA 5FAZA 1ICMA 5AJBA 3NQ9A 1GT5A 1VWFB 1STRB 1SREA 2FWVA 1STSB 1IJ8A 2A8GA 1MDCA 1BBPA 4TKHA 4FGIB 4U8UN 3APXA 2L9CA 2BS5A 4TNNA 2AVIA 3B2LA 1MUPA 3NQKA 4Z2VA 5LJHA 3KFFA 3O19A 4OS8A 1CJ5A 1G5WA 4ZGUA 2OYBO 4GJSA 1IKJA 1GX8A 1LCZA 1LCVA 3V8UA 2IZJA 3RY1A 2C4IA 3ZW1B 3TZSA 3N91A 1JYJA 2NNEA 1DZPA 1B8EA 2RA6A 1SWGA 3LV4A 5H9LA 3RE5A 3D9WA 1AQBA 4CPFA 2OF9A 1EIOA 1I06A 1ERBA 3WYQA 1NP4A 1LPJA 1DV9A 3FW4A 1Z24A 4O4OA 1O1UA 1X71A 2A5BA 4TQ2A 2QCBA 3EC5A 2MF6A 1ZNHA 1QY1A 1DF8A 1LF7A
chains in the Genus database with same CATH topology
2JU8A 1ZRYA 2QOSC 3FR4A 3KFIA 5HCEC 5BVTA 2RN4A 2HMBA 4QGWA 3AKNA 4IMOA 3F9DA 4NW4A 3EYCA 1XKIA 3B2HA 5D48A 2ASNX 1CBIA 1PMPA 3P6EA 3U0DA 3WBGA 1B4MA 2AKQA 2O62A 3ZW0B 1FELA 1AELA 1QWDA 3MVFA 3P24A 1LIDA 5EEDA 5HBSA 3WOVA 1YWDA 1IFBA 2CBRA 4YKMA 1GXAA 2F73A 5FFHA 3VG7A 4I9RA 4A60A 5EDBA 4ZCBA 3NQ3A 4QRLA 2YMSA 2L67A 4BVMA 4KIIA 3C77X 2Z4HA 5AEOA 5L8NA 1ADLA 1TOWA 2F09A 3SOTA 1BLRA 1XCAA 3FEPA 1A3YA 4GRJA 4TLJA 2BLGA 2FS6A 1JBHA 2WSJA 1DZJA 4HWMA 1KGLA 1EI5A 1TXLA 3NR3A 4IB7A 2GTLM 3TGAA 2HZRA 3UEXA 3CWKA 3HK1A 4GNYA 4JGLA 1TW4A 1EALA 4EFGA 3P6DA 4O3ZA 2QO6A 4YCEA 2LKKA 2XKLA 4GZVA 3UAQA 1SY3A 3B2IA 3FIQA 1X8NA 3BX8A 1MX8A 1S44A 4I3BA 2GTFX 5IO5A 2IFBA 3ZQ3A 1O8VA 4AZOA 4KC8A 5AQ6A 3FMZA 4QQ1A 2WWPA 4AZRA 2A13A 4MVEA 5F58A 2OFMX 3D97A 1FEMA 4EEJA 1EQDA 1EUOA 5EDCA 4EDEA 4YGZA 3S5VA 2K23A 1P6PA 3KFGA 1BSOA 5KHPA 3QKGA 4A8ZA 4WFUA 3S5XA 1GKAB 3NX2A 4ALBA 4ORXA 4ORRA 5FENA 2WEXA 3U9PC 1BWYA 1QABE 3BRNA 2Q2MA 1DZKA 1MX7A 1ZNDA 4L1NA 1Y9TA 3PH6A 5BYPA 3STKA 4HPAA 3STMX 1SXYA 4ZH9A 1LKEA 2W2BA 1E06A 4IAXA 1BRQA 1TOUA 3O22A 4YBUA 3VPJE 4O4XA 1LNMA 3D95A 3BDRA 3FR5A 2HNXA 2AT3X 4ZJ0A 3O2YA 5LKFA 1D3SA 4YH0A 1X8OA 1GT1A 1CRBA 4ML7B 4YMYA 1OPBA 4M6SA 1KOIA 3TGCA 4BOEA 5HTDA 5HZ9A 5L8OA 3D96A 2Q9SA 5EPQA 3K3LA 3HWGA 4HFOA 4RUNA 1YWBA 2AT5X 3LHNA 3NPOA 3P6GA 4MVIA 2GC9A 1BJ7A 5D47A 1VYFA 4I6SA 1OEKA 2DM5A 1HBQA 1FENA 4TJZA 2G78A 4QGXA 2W2FA 2QO5A 4ORYA 4MISA 3VG5A 1OBUA 4LKTA 4BQUA 4NNSA 4QZUA 2MO5A 3VE1A 1DF3A 3S60A 3PEDA 5LJCA 1MVGA 3OD9A 4ODDA 3ZWEA 5HA1A 2P8GA 1KZWA 5DG4A 2X8SA 1LICA 1HN2A 4ORSA 3VG3A 5JR8A 1KZXA 2POAA 2XSTA 1LIFA 4Y0PA 2QO4A 2A2UA 2JMBA 3UEWA 3ZI8A 4AZQA 5LJKA 2AT0X 3P02A 2MM3A 1QFTA 5B29A 1YP7A 1IIUA 4XMDA 1S2PA 4I3CA 3FLLA 4FQBB 3WJBA 3ZUIA 3I17A 1KT3A 1HQPA 1CBSA 5LJGA 3VU1A 5D45A 4WFVA 4ES7A 3I0AA 1ZNEA 5CE4A 3BSZE 1PM1X 2FR2A 3DSZA 5DPQA 3KZAA 4PJ2A 3BLGA 4YGGA 1G85A 5FQ7E 4UU2A 4ZGFA 3WVMA 1LFOA 3ZW2A 1BEBA 3NX1A 4GNWA 3FELA 3VG4A 5EZ2A 4GK9A 4YDAA 1SY1A 1B0OA 3UEUA 2FS7A 3MBTA 4KC7A 2M4LA 4ZHDA 5F6BA 2X8TA 4L3RA 4IABA 1AB0A 2W2AA 1KT5A 2LBVA 4HPCA 1SXWA 5HZ6A 1QY0A 3DTQA 4Y0QA 4IAWA 4KCAA 3KFHA 2HZQA 1ML7A 3WJGA 5D4AA 4FBRA 4TKJA 5HWZA 3FA6A 2WQAE 1HBPA 2FTBA 1E5PA 2JU7A 4AW8A 4O3XB 4ORUA 3EBKA 1DFVA 4LZUA 4INNA 4ZHHA 2CM9A 2RQ0A 3RBYA 1SMPI 2RCTA 3B2KA 3HTYA 2CZTA 2CZUA 1CBQA 3CBSA 2QM9A 2FT9A 4ZFXA 2NP1A 1QQSA 1N0SA 1ZNKA 4O4UA 2Z4IA 3EM0A 1ACDA 4OMWA 5IO6A 2OZQA 2A0AA 5HZQA 4EXZA 3TGBA 1U18A 3HWEA 2NNQA 3PPTA 5AJCA 3BS2A 1CBRA 4Y0RA 3OBLA 1O1VA 1YP6A 1H91A 2ALLX 1KT4A 4I9SA 4LQZA 5FQ8E 1EXSA 1OEJA 1JJJA 3FEKA 2R56A 2OFRX 2AH7X 2X45A 3ZUOA 1GX9A 4AYHA 3PQSA 4CSBA 2A2GA 4QNIA 4AZMA 4LZVA 5D8JA 4K19A 4UU3A 2LB6A 2L68A 1KQWA 3PH5A 4CV7A 4N7CA 4YFRA 2ANSA 4GH7A 1SA8A 1QG5A 1YUPA 4HPDA 5F6ZA 3P6CA 2LA7A 3BY0A 3ZW1A 1R0UA 4RUUA 4YKOA 4ORWA 1X8QA 2EU7X 3SAOA 1YWAA 2ZAIA 3WJEA 5LJEA 1OEEA 1SXUA 1SY0A 2G79A 2JN3A 1IKEA 4QZTA 2N93A 4QYPA 5EEEA 5H9KA 2RCQA 3PECA 3E3CA 1JYDA 2KD2A 5K06A 3FA8A 2WR6A 3Q6LA 3RZYA 2FRSA 1LIEA 3FENA 2OVDA 5LKEA 2G7BA 3ELXA 4NYQA 3ZZVA 1S7DA 2R73A 4U9CA 3STNA 1BSQA 4IB6A 3UEVA 5HAEA 4YCHA 4DQ4A 5H9AA 1KT7A 5F7GA 3PP6A 1OBQA 1A18A 4YGHA 3TF6A 1ZNGA 4HPBA 1IW2A 2BS6A 4ID2A 4IMNA 5HCCC 2WUTA 1GM6A 1KXOA 2K62A 2MWHA 3WJDA 4ZH6A 2QMIA 4YBPA 3CQNA 1OPAA 2ACOA 1DZMA 2AL0X 2KTSA 3D4RA 1LIBA 4ON1A 5HTEA 3ZW0A 4ARHA 3EBWA 1AVGI 2WQ9A 3EMMA 2R74A 4DQ3A 1G74A 4NNTA 3PQUA 2FR3A 3BU9A 3WXQA 2JOZA 3IFBA 2FLJA 4FBVA 1Y9LA 5L8IA 1IFCA 2L5PA 1NP1A 2Q39A 2LFOA 3F6ZB 2AT8X 4IB8A 1TVQA 4XMFA 3NP1A 1VPRA 1I4UA 3P6HA 4O9SA 5KICA 2GTLO 1PBOA 4XMGA 3JQOA 2AT6X 2BT9A 2KW1A 1PEEA 1ERXA 4IBAA 1U0XA 1QFVA 3JS1A 3RKGA 5HZ5A 4KH8A 3CBCA 1U17A 4ALOA 2KTDA 1GT3A 1T0VA 2MHDA 4ZHCA 1JJXA 2E4JA 1KT6A 1OBPA 4LKPA 3WJFA 1GGLA 1SY2A 4I3DA 1JV4A 3FA7A 1EIIA 2OVSA 3BX7A 1HMTA 5C0NA 2LBAA 3NADA 3AKMA 4ZHGA 4N7DA 1UZ2X 2HYSA 1YIVA 5B27A 5BVQA 3B2JA 4U8UO 3HOLA 1EPAA 2JW1A 4XMEA 3C76X 3FYFA 3IA8A 1DC9A 1A2DA 3HWFA 3OJYC 1KQXA 3WJCA 1RBPA 3CMPA 1T68X 3ELZA 3HOEA 3MX7A 4IB9A 4NYRA 4OMXA 3VG6A 4A1HA 1NGLA 2Q4NA 1GKAA 2X46A 3S26A 5F1EA 1E00A 1SXXA 3G7XA 4MIRA 2X8FA 3CR6A 2MJIA 2JU3A 2KT4B 3FR2A 4GDZA 4O3YA 4GETA 1X8PA 3CQRA 1HMSA 5HCDC 1X8UA 2WEWA 3JSQA 3NBXX 4MVLA 4CK4A 3RSWA 1GT4A 4XMCA 5FQ6E 4M7MA 4AZPA 1RLBE 3L4RA 2ZAGA 3C78X 2Q2PA 3HWDA 4GE1A 4O49A 3RWXA 3GAQA 1BM5A 4FBOA 4GU8A 4Y0SA 5CYBA 5LJBA 1X89A 1VYGA 4WBKA 2CM4A 3KQ0A 4KT5A 1JIWI 1UREA 4OS3A 5HZ8A 1A57A 4MVKA 1FDQA 1HMRA 3BU1A 4NP1A 4YFPA 2GJ5A 4I95A 4YDBA 4D6BA 5KIDA 2CBSA 4EQAC 4OS0A 2OVAA 3VE2A 4U8UM 2OVEA 5HA0A 5IO7A 3T1DA 3VG2A 4YFQA 2YG2A 3APVA 1QY2A 1FE3A 4COTA 1ALBA 5H8TA 1BRPA 1E02A 3APUA 3FA9A 4QAEA 2GTLN 5BVSA 4TKBA 4D6AA 3APWA 4O3WA 2A3FX 1D2UA 3P6FA 1YWCA 4NLJA 3F8AA 1I05A 4QGVA 1EW3A 3U03A 4NLIA 2HLVA 1FTPA 5H9NA 4R0BA 2PY1A 1I04A 4ZR2A 1G7NA 2BHVA 4A1YA 2NNDA 4AZNA 4GKCA 4O4SA 1EPBA 3GE2A 4U3QA 3H3IA 4QYNA 4ZHFA 3OE3A 2ACPX 4PSQA 2RD7C 1JZUA 1ZNLA 1L6MA 2AMMX 1B56A 4XMHA 3FW5A 1BSYA 1ICNA 1T8VA 5FAZA 1ICMA 5AJBA 3NQ9A 1GT5A 2FWVA 4TKHA 5H9LA 1MDCA 1BBPA 4U8UN 4FGIB 3APXA 2L9CA 2BS5A 4TNNA 3B2LA 1MUPA 3NQKA 5LJHA 1CJ5A 3KFFA 3O19A 4OS8A 1G5WA 4ZGUA 1IKJA 1GX8A 3V8UA 3ZW1B 3TZSA 3N91A 1JYJA 2NNEA 1DZPA 1B8EA 2RA6A 3LV4A 1AQBA 1EIOA 1I06A 1ERBA 1NP4A 1LPJA 1DV9A 3FW4A 1Z24A 4O4OA 1O1UA 1X71A 4TQ2A 5LJDA 1ZNHA 1QY1A 4WHIA 1LF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU8 A;  1ZRY A;  2QOS C;  3FR4 A;  3KFI A;  5HCE C;  5BVT A;  2HMB A;  4QGW A;  3AKN A;  4IMO A;  3F9D A;  5D48 A;  3EYC A;  1XKI A;  3B2H A;  2ASN X;  1CBI A;  1PMP A;  3P6E A;  3U0D A;  3WBG A;  1B4M A;  2AKQ A;  2O62 A;  1AEL A;  1FEL A;  1QWD A;  3MVF A;  1LID A;  5EED A;  5HBS A;  1YWD A;  1IFB A;  2CBR A;  4YKM A;  1GXA A;  2F73 A;  5FFH A;  3VG7 A;  4I9R A;  4A60 A;  5EDB A;  4ZCB A;  3NQ3 A;  2L67 A;  4BVM A;  4KII A;  3C77 X;  5L8N A;  1ADL A;  1TOW A;  1BLR A;  1XCA A;  3FEP A;  1A3Y A;  4GRJ A;  4TLJ A;  2BLG A;  2FS6 A;  1JBH A;  2WSJ A;  1DZJ A;  1KGL A;  1TXL A;  3NR3 A;  4IB7 A;  3TGA A;  2HZR A;  3UEX A;  3CWK A;  3HK1 A;  4GNY A;  1TW4 A;  1EAL A;  4EFG A;  3P6D A;  2QO6 A;  4YCE A;  2LKK A;  2XKL A;  1SY3 A;  3B2I A;  3FIQ A;  1X8N A;  3BX8 A;  1MX8 A;  1S44 A;  4I3B A;  2GTF X;  5IO5 A;  2IFB A;  3ZQ3 A;  1O8V A;  4AZO A;  5AQ6 A;  3FMZ A;  2WWP A;  4AZR A;  2A13 A;  5F58 A;  2OFM X;  3D97 A;  1FEM A;  4EEJ A;  1EQD A;  1EUO A;  5EDC A;  4EDE A;  4YGZ A;  5KHP A;  2K23 A;  1P6P A;  3KFG A;  1BSO A;  3QKG A;  4A8Z A;  4WFU A;  1GKA B;  3NX2 A;  4ALB A;  4ORX A;  4ORR A;  5FEN A;  2WEX A;  3U9P C;  1BWY A;  1QAB E;  3BRN A;  2Q2M A;  1DZK A;  1MX7 A;  1ZND A;  3PH6 A;  3STK A;  4HPA A;  3STM X;  1SXY A;  4ZH9 A;  1LKE A;  2W2B A;  1E06 A;  4IAX A;  1BRQ A;  1TOU A;  3O22 A;  4YBU A;  1LNM A;  3D95 A;  3BDR A;  3FR5 A;  2HNX A;  2AT3 X;  4ZJ0 A;  3O2Y A;  5LKF A;  1D3S A;  4YH0 A;  1X8O A;  1GT1 A;  1CRB A;  4YMY A;  1OPB A;  4M6S A;  1KOI A;  3TGC A;  4BOE A;  5HTD A;  5HZ9 A;  5L8O A;  3D96 A;  2Q9S A;  5EPQ A;  3K3L A;  3HWG A;  4HFO A;  4RUN A;  1YWB A;  2AT5 X;  3NPO A;  3P6G A;  4MVI A;  2GC9 A;  1BJ7 A;  5D47 A;  1VYF A;  1OEK A;  2DM5 A;  1HBQ A;  1FEN A;  4TJZ A;  2G78 A;  4QGX A;  2W2F A;  2QO5 A;  4ORY A;  3VG5 A;  1OBU A;  4LKT A;  4BQU A;  4NNS A;  4QZU A;  2MO5 A;  1DF3 A;  5LJC A;  3PED A;  1MVG A;  4ODD A;  5HA1 A;  2P8G A;  1KZW A;  5DG4 A;  1LIC A;  1HN2 A;  4ORS A;  3VG3 A;  5JR8 A;  1KZX A;  2POA A;  2XST A;  1LIF A;  4Y0P A;  2QO4 A;  2A2U A;  3UEW A;  4AZQ A;  5LJK A;  2AT0 X;  2MM3 A;  1QFT A;  5B29 A;  1YP7 A;  1IIU A;  4XMD A;  1S2P A;  4I3C A;  3FLL A;  3WJB A;  3ZUI A;  3I17 A;  1KT3 A;  1HQP A;  1CBS A;  5LJG A;  5D45 A;  4WFV A;  4ES7 A;  3I0A A;  1ZNE A;  5CE4 A;  3BSZ E;  1PM1 X;  2FR2 A;  3DSZ A;  5DPQ A;  3KZA A;  4YGG A;  3BLG A;  1G85 A;  4UU2 A;  3WVM A;  1LFO A;  1BEB A;  3NX1 A;  4GNW A;  3FEL A;  3VG4 A;  5EZ2 A;  4YDA A;  1SY1 A;  1B0O A;  3UEU A;  2FS7 A;  3MBT A;  4ZHD A;  5F6B A;  1AB0 A;  2W2A A;  1KT5 A;  2LBV A;  4HPC A;  1SXW A;  5HZ6 A;  1QY0 A;  3DTQ A;  4Y0Q A;  4IAW A;  3KFH A;  2HZQ A;  1ML7 A;  3WJG A;  5D4A A;  4TKJ A;  5HWZ A;  3FA6 A;  2WQA E;  1HBP A;  2FTB A;  1E5P A;  2JU7 A;  4AW8 A;  4ORU A;  3EBK A;  1DFV A;  4LZU A;  4ZHH A;  2CM9 A;  2RQ0 A;  2RCT A;  3B2K A;  2CZT A;  2CZU A;  1CBQ A;  3CBS A;  2QM9 A;  2FT9 A;  4ZFX A;  2NP1 A;  1QQS A;  1N0S A;  1ZNK A;  3EM0 A;  1ACD A;  4OMW A;  5IO6 A;  2OZQ A;  2A0A A;  5HZQ A;  4EXZ A;  3TGB A;  1U18 A;  3HWE A;  2NNQ A;  3PPT A;  3BS2 A;  1CBR A;  4Y0R A;  1O1V A;  1YP6 A;  1H91 A;  2ALL X;  1KT4 A;  4I9S A;  1EXS A;  1OEJ A;  1JJJ A;  3FEK A;  2R56 A;  2OFR X;  2AH7 X;  2X45 A;  3ZUO A;  1GX9 A;  4AYH A;  2A2G A;  4AZM A;  4LZV A;  5D8J A;  4K19 A;  4UU3 A;  2LB6 A;  2L68 A;  1KQW A;  3PH5 A;  4N7C A;  4YFR A;  2ANS A;  4GH7 A;  1SA8 A;  1QG5 A;  1YUP A;  4HPD A;  5F6Z A;  3P6C A;  3BY0 A;  1R0U A;  4RUU A;  4YKO A;  4ORW A;  1X8Q A;  2EU7 X;  3SAO A;  1YWA A;  3WJE A;  5LJE A;  1OEE A;  1SXU A;  1SY0 A;  2G79 A;  2JN3 A;  1IKE A;  4QZT A;  2N93 A;  4QYP A;  5EEE A;  5H9K A;  2RCQ A;  3PEC A;  1JYD A;  5K06 A;  3FA8 A;  2WR6 A;  3Q6L A;  3RZY A;  2FRS A;  1LIE A;  3FEN A;  2OVD A;  5LKE A;  2G7B A;  3ELX A;  4NYQ A;  1S7D A;  2R73 A;  3STN A;  1BSQ A;  4IB6 A;  3UEV A;  5HAE A;  4YCH A;  4DQ4 A;  5H9A A;  1KT7 A;  5F7G A;  3PP6 A;  1OBQ A;  1A18 A;  4YGH A;  3TF6 A;  1ZNG A;  4HPB A;  1IW2 A;  4IMN A;  5HCC C;  2WUT A;  1GM6 A;  1KXO A;  2K62 A;  3WJD A;  4ZH6 A;  4YBP A;  3CQN A;  1OPA A;  2ACO A;  1DZM A;  2AL0 X;  5C0N A;  5HTE A;  1LIB A;  4ARH A;  3EBW A;  1AVG I;  2WQ9 A;  3EMM A;  2R74 A;  4DQ3 A;  1G74 A;  4NNT A;  2FR3 A;  3BU9 A;  3WXQ A;  2JOZ A;  3IFB A;  2FLJ A;  5L8I A;  1IFC A;  2L5P A;  1NP1 A;  2Q39 A;  2LFO A;  2AT8 X;  4IB8 A;  1TVQ A;  4XMF A;  3NP1 A;  1VPR A;  1I4U A;  3P6H A;  4O9S A;  5KIC A;  1PBO A;  4XMG A;  2AT6 X;  1PEE A;  1ERX A;  4IBA A;  1U0X A;  1QFV A;  3JS1 A;  5HZ5 A;  3CBC A;  1U17 A;  4ALO A;  2KTD A;  1GT3 A;  1T0V A;  4ZHC A;  1JJX A;  2E4J A;  1KT6 A;  1OBP A;  4LKP A;  3WJF A;  1GGL A;  1SY2 A;  4I3D A;  1JV4 A;  3FA7 A;  1EII A;  3BX7 A;  1HMT A;  2LBA A;  3NAD A;  3AKM A;  4ZHG A;  4N7D A;  1UZ2 X;  2HYS A;  1YIV A;  5B27 A;  5BVQ A;  3B2J A;  1EPA A;  4XME A;  3C76 X;  3IA8 A;  1DC9 A;  1A2D A;  3HWF A;  3OJY C;  1KQX A;  3WJC A;  1RBP A;  3CMP A;  1T68 X;  3ELZ A;  4IB9 A;  4NYR A;  4OMX A;  3VG6 A;  4A1H A;  1NGL A;  2Q4N A;  1GKA A;  2X46 A;  3S26 A;  5F1E A;  1E00 A;  1SXX A;  3G7X A;  3CR6 A;  2MJI A;  2JU3 A;  2KT4 B;  3FR2 A;  4GET A;  1X8P A;  3CQR A;  1HMS A;  5HCD C;  1X8U A;  2WEW A;  3JSQ A;  4MVL A;  4CK4 A;  3RSW A;  1GT4 A;  4XMC A;  4M7M A;  4AZP A;  1RLB E;  3L4R A;  3C78 X;  2Q2P A;  3HWD A;  4GE1 A;  3GAQ A;  1BM5 A;  4Y0S A;  5LJB A;  1X89 A;  1VYG A;  4WBK A;  2CM4 A;  3KQ0 A;  5HZ8 A;  1URE A;  4OS3 A;  1A57 A;  4MVK A;  1FDQ A;  1HMR A;  3BU1 A;  4NP1 A;  4YFP A;  2GJ5 A;  4YDB A;  4D6B A;  5KID A;  2CBS A;  4OS0 A;  2OVA A;  2OVE A;  5HA0 A;  5IO7 A;  3T1D A;  3VG2 A;  4YFQ A;  2YG2 A;  3APV A;  1QY2 A;  1FE3 A;  1ALB A;  5H8T A;  1BRP A;  1E02 A;  3APU A;  3FA9 A;  4QAE A;  5BVS A;  4TKB A;  4D6A A;  3APW A;  2A3F X;  1D2U A;  3P6F A;  1YWC A;  4NLJ A;  3F8A A;  1I05 A;  4QGV A;  1EW3 A;  3U03 A;  4NLI A;  2HLV A;  1FTP A;  5H9N A;  4R0B A;  2PY1 A;  1I04 A;  4ZR2 A;  1G7N A;  4A1Y A;  2NND A;  4AZN A;  4GKC A;  1EPB A;  4QYN A;  4ZHF A;  2ACP X;  4PSQ A;  2RD7 C;  1JZU A;  1ZNL A;  1L6M A;  2AMM X;  1B56 A;  4XMH A;  3FW5 A;  1BSY A;  1ICN A;  1T8V A;  5FAZ A;  1ICM A;  3NQ9 A;  1GT5 A;  2FWV A;  4TKH A;  5H9L A;  1MDC A;  1BBP A;  3APX A;  2L9C A;  4TNN A;  3B2L A;  1MUP A;  5LJH A;  1CJ5 A;  3KFF A;  3O19 A;  4OS8 A;  1G5W A;  4ZGU A;  1IKJ A;  1GX8 A;  3TZS A;  1JYJ A;  2NNE A;  1DZP A;  1B8E A;  2RA6 A;  1AQB A;  1EIO A;  1I06 A;  1ERB A;  1NP4 A;  1LPJ A;  1DV9 A;  3FW4 A;  1Z24 A;  1O1U A;  1X71 A;  4TQ2 A;  5LJD A;  1ZNH A;  1QY1 A;  1LF7 A; 
#chains in the Genus database with same CATH topology
 4MEE A;  2RTH B;  2JU8 A;  1ZRY A;  1SWC A;  2QOS C;  2RTL A;  4ARH A;  2X32 A;  3FR4 A;  3KFI A;  1VYO A;  5HCE C;  5BVT A;  2RN4 A;  5EEE A;  2HMB A;  4QGW A;  1VWP B;  2GH7 A;  3AKN A;  4IMO A;  3F9D A;  4NW4 A;  3EYC A;  1XKI A;  3B2H A;  1VWG B;  5D48 A;  2ASN X;  1CBI A;  1PMP A;  3P6E A;  3U0D A;  3WBG A;  4GJV A;  1B4M A;  2AKQ A;  2O62 A;  3ZW0 B;  1FEL A;  1AEL A;  1QWD A;  3MVF A;  3P24 A;  1LID A;  5EED A;  4DCB A;  4Z2P A;  4GDA A;  1VWD B;  5HBS A;  1YWD A;  1IFB A;  2CBR A;  4YKM A;  3WOV A;  3CKG A;  1GXA A;  2F73 A;  5FFH A;  3AUM O;  3VG7 A;  1HXL A;  4I9R A;  4A60 A;  5EDB A;  4ZCB A;  4U46 A;  3NQ3 A;  4QRL A;  2YMS A;  2L67 A;  4BVM A;  4KII A;  5IRW A;  3C77 X;  2Z4H A;  5AEO A;  5L8N A;  1ADL A;  1TOW A;  1K24 A;  2F09 A;  3SOT A;  2DJF A;  1LDQ A;  2RTM A;  1VWB B;  1XCA A;  1BLR A;  1K3B A;  3FEP A;  1A3Y A;  4GRJ A;  4TLJ A;  2BLG A;  2RTP B;  2FS6 A;  1KFF A;  1JBH A;  2WSJ A;  1DZJ A;  4HWM A;  1KGL A;  4NV7 A;  1EI5 A;  1TXL A;  3NR3 A;  4IB7 A;  2GTL M;  3TGA A;  2HZR A;  4BX6 B;  3UEX A;  1KL4 A;  4BX5 A;  3CWK A;  3HK1 A;  3AEH A;  5B5G A;  4GNY A;  4JGL A;  1TW4 A;  1EAL A;  4EFG A;  2RTI B;  3P6D A;  4O3Z A;  2QO6 A;  4YCE A;  2LKK A;  1MM9 A;  1N9M A;  2XKL A;  4GZV A;  3UAQ A;  1SY3 A;  1SWH A;  3B2I A;  3QQ2 A;  4I60 A;  3FIQ A;  1X8N A;  4CPH A;  3BX8 A;  1WUB A;  2X4M A;  1MX8 A;  1S44 A;  4I3B A;  2GTF X;  5IO5 A;  2IFB A;  4CDD A;  3ZQ3 A;  1O8V A;  2F01 A;  4AZO A;  4KC8 A;  5AQ6 A;  1STP A;  3FMZ A;  2IZF B;  4QQ1 A;  2WWP A;  4AZR A;  2A13 A;  4MVE A;  5F58 A;  4JNJ A;  4YVB A;  2OFM X;  3D97 A;  2RTD B;  1FEM A;  5B10 O;  1SWN A;  1EQD A;  1EUO A;  5EDC A;  4EDE A;  2RTJ A;  4EEJ A;  4BBO A;  4YGZ A;  3S5V A;  2K23 A;  1P6P A;  1SWR A;  1BSO A;  3KFG A;  3QKG A;  4A8Z A;  4WFU A;  3S5X A;  4Z27 A;  4GGR A;  1W4T A;  1GKA B;  3NX2 A;  4ALB A;  4ORX A;  4ORR A;  5FEN A;  2WEX A;  3WZN A;  3U9P C;  1BWY A;  1MOY A;  1QAB E;  1SWU A;  3BRN A;  2Q2M A;  1DZK A;  5K68 A;  1MX7 A;  1ZND A;  4L1N A;  1Y9T A;  3PH6 A;  3RDX A;  5BYP A;  3STK A;  2OFA A;  4HPA A;  1SLE B;  1N7Y A;  3STM X;  1WBI A;  2OY8 A;  1SXY A;  4ZH9 A;  1LKE A;  2OFB A;  2RTK A;  1E06 A;  2W2B A;  4IAX A;  1BRQ A;  1TOU A;  3O22 A;  4YBU A;  3T2X A;  1Y52 X;  3VPJ E;  4O4X A;  1SLD B;  4CPH B;  1LNM A;  1NQN A;  3D95 A;  4Y59 A;  3VHI A;  3BDR A;  1KL3 A;  2FKG A;  3FR5 A;  4GGZ A;  2HNX A;  2AT3 X;  4JO6 A;  3KVN A;  3VHH A;  4ZJ0 A;  2OY7 A;  3O2Y A;  5LKF A;  1D3S A;  1MK5 A;  4YH0 A;  1X8O A;  1GT1 A;  1CRB A;  4ML7 B;  4YMY A;  1OPB A;  1SWK A;  4M6S A;  2VFC A;  1KOI A;  1Y53 X;  3TGC A;  4BOE A;  5HTD A;  5HZ9 A;  5L8O A;  3FDC A;  3D96 A;  2Q9S A;  5EPQ A;  3K3L A;  3HWG A;  4HFO A;  4RUN A;  1YWB A;  2AT5 X;  3LHN A;  1AVE A;  3NPO A;  3P6G A;  3Q34 A;  4MVI A;  2GC9 A;  1BJ7 A;  5D47 A;  1VYF A;  3EW2 A;  4I6S A;  1OEK A;  2DM5 A;  1HBQ A;  1RSU B;  1FEN A;  1SWQ A;  4TJZ A;  2G78 A;  5KHP A;  1NDJ A;  1N4J A;  4QGX A;  2W2F A;  2RTR B;  1SWT A;  2QO5 A;  4MIS A;  4ORY A;  3VG5 A;  1OBU A;  4LKT A;  4BQU A;  4NNS A;  4QZU A;  2MO5 A;  3VE1 A;  1DF3 A;  3RDO A;  3S60 A;  3PED A;  5LJC A;  4Z2O A;  1MVG A;  3OD9 A;  4ODD A;  3ZWE A;  5HA1 A;  2P8G A;  1VWH B;  1KZW A;  5DG4 A;  5L3Y A;  3HPE A;  2X8S A;  1LIC A;  1HN2 A;  4ORS A;  3VG3 A;  5JR8 A;  2UZ2 A;  1KZX A;  3WZP A;  2IZG B;  2POA A;  2XST A;  1LIF A;  4Y0P A;  1VWQ B;  1VWC B;  3SLO A;  2QO4 A;  4NV8 A;  3VHM A;  2A2U A;  2JMB A;  3UEW A;  2OY5 O;  3ZI8 A;  4AZQ A;  5LJK A;  2AT0 X;  3P02 A;  2MM3 A;  1QFT A;  2OY1 O;  2RTA A;  1LUQ A;  5B29 A;  1YP7 A;  2FKJ A;  1IIU A;  4XMD A;  1S2P A;  4I3C A;  3FLL A;  4FQB B;  3WJB A;  3ZUI A;  1SWJ A;  3I17 A;  1KT3 A;  1HQP A;  1CBS A;  5LJG A;  2IZA A;  3RE6 A;  3VU1 A;  5D45 A;  4WFV A;  4ES7 A;  3I0A A;  1SRJ A;  5IRU A;  1ZNE A;  5CE4 A;  3BSZ E;  1PM1 X;  2FR2 A;  3DSZ A;  5DPQ A;  3KZA A;  4BX7 A;  5B5F A;  4PJ2 A;  3BLG A;  4YGG A;  1G85 A;  2FHL A;  5FQ7 E;  4UU2 A;  4ZGF A;  3WVM A;  1LFO A;  2JGS A;  2OL6 O;  1LCW A;  1BEB A;  3T2W A;  3ZW2 A;  3NX1 A;  4GNW A;  3FEL A;  3VG4 A;  3VGW A;  2X55 A;  5EZ2 A;  4GK9 A;  4YDA A;  2Y3E A;  1SY1 A;  1B0O A;  3UEU A;  5LJE A;  2FS7 A;  3MBT A;  4KC7 A;  2M4L A;  4ZHD A;  5F6B A;  2X8T A;  4OEM A;  4L3R A;  4IAB A;  1AB0 A;  2W2A A;  1KT5 A;  2LBV A;  4HPC A;  1SXW A;  3SLT A;  5HZ6 A;  1QY0 A;  3DTQ A;  2ZSC A;  2IZK A;  4Y0Q A;  4IAW A;  4KCA A;  1SLF B;  3KFH A;  1NC9 A;  1SWP A;  1VWM B;  2HZQ A;  4GD9 A;  1ML7 A;  3WJG A;  5D4A A;  4FBR A;  4TKJ A;  3T6F A;  1SRH A;  5HWZ A;  3FA6 A;  2WQA E;  1HBP A;  1LDO A;  2FTB A;  1E5P A;  2JU7 A;  5B3M O;  4AW8 A;  4O3X B;  4ORU A;  1Y55 X;  4Y5D A;  3EBK A;  3WYP A;  1DFV A;  4LZU A;  4INN A;  4ZHH A;  2CM9 A;  2RQ0 A;  1I78 A;  2I5Z O;  3RBY A;  1SMP I;  2IZL B;  2RCT A;  3B2K A;  2CZT A;  3HTY A;  2CZU A;  1CBQ A;  3CBS A;  2G8C O;  2QM9 A;  2RTF B;  2FT9 A;  4ZFX A;  4GUZ A;  1SWB A;  2NP1 A;  1QQS A;  1N0S A;  1VWL B;  1ZNK A;  4IRW A;  4O4U A;  2Z4I A;  3EM0 A;  1ACD A;  4OMW A;  5IO6 A;  2OZQ A;  1E2T A;  2A0A A;  5HZQ A;  4EXZ A;  3TGB A;  2A5C A;  1U18 A;  3HWE A;  2NNQ A;  3PPT A;  5AJC A;  3BS2 A;  5CSE A;  1CBR A;  4Y0R A;  3OBL A;  1O1V A;  1OSP O;  1H91 A;  1YP6 A;  2ALL X;  1KT4 A;  4I9S A;  4LQZ A;  5FQ8 E;  1EXS A;  1OEJ A;  4BX5 B;  1RXH A;  2C1Q A;  1JJJ A;  3RDS A;  3FEK A;  3SZH A;  4D6B A;  2R56 A;  2OFR X;  3WZO A;  2AH7 X;  2X45 A;  3ZUO A;  1GX9 A;  4AYH A;  3PQS A;  4CSB A;  2A2G A;  4QNI A;  4AZM A;  1SRG A;  2OL8 O;  2VDF A;  4LZV A;  5D8J A;  4K19 A;  2FHN X;  4UU3 A;  2LB6 A;  2L68 A;  1KQW A;  3PH5 A;  4CV7 A;  4YBP A;  1SWO A;  4N7C A;  2RTQ B;  4YFR A;  3MG5 A;  2ANS A;  4GH7 A;  1SA8 A;  1QG5 A;  1YUP A;  4HPD A;  5CHK A;  1VWE B;  5F6Z A;  3P6C A;  2LA7 A;  3BY0 A;  3ZW1 A;  2PI3 O;  1SWL A;  1JJU A;  1R0U A;  2WPU A;  4RUU A;  4YKO A;  4ORW A;  1X8Q A;  2EU7 X;  3SAO A;  1VWR B;  1YWA A;  2G5L A;  2ZAI A;  3MM0 A;  3WJE A;  1OEE A;  1SXU A;  1SY0 A;  1W6F A;  2G79 A;  1IKE A;  1VWN B;  2JN3 A;  2N93 A;  3EW1 A;  4QYP A;  4QZT A;  5K67 A;  2VFB A;  5H9K A;  2RCQ A;  3CKF A;  3E3C A;  1JYD A;  2KD2 A;  3PEC A;  3PK2 A;  5K06 A;  3FA8 A;  2WR6 A;  3Q6L A;  5IRA A;  3RZY A;  2FRS A;  4BCS A;  1HY2 A;  1LIE A;  3FEN A;  3SZI A;  2OVD A;  5LKE A;  2G7B A;  2IZI A;  3ELX A;  4NYQ A;  3ZZV A;  2IZB A;  1S7D A;  2R73 A;  4U9C A;  3STN A;  2IZC B;  1BSQ A;  4IB6 A;  3UEV A;  5HAE A;  4YCH A;  4DQ4 A;  5H9A A;  1KT7 A;  5F7G A;  3PP6 A;  1OBQ A;  1A18 A;  4YGH A;  3TF6 A;  5F2B A;  1ZNG A;  4HPB A;  1IW2 A;  2BS6 A;  4ID2 A;  4IMN A;  5HCC C;  2WUT A;  1GM6 A;  1KXO A;  2K62 A;  2MWH A;  3WJD A;  4ZH6 A;  2QMI A;  3PDF A;  3CQN A;  1OPA A;  2ACO A;  1DZM A;  2AL0 X;  2IZE B;  2KTS A;  1LIB A;  3D4R A;  4ON1 A;  5HTE A;  3ZW0 A;  3EBW A;  1AVG I;  2WQ9 A;  3EMM A;  2R74 A;  1JMZ A;  1G74 A;  4DQ3 A;  2CAM A;  4NNT A;  3PQU A;  2FR3 A;  2I5V O;  4OKA A;  3BU9 A;  3WXQ A;  2JOZ A;  3IFB A;  2FLJ A;  4FBV A;  4BGF A;  1Y9L A;  2BSZ A;  1RAV A;  5L8I A;  1IFC A;  4GGT A;  2C1S A;  2L5P A;  1NP1 A;  2Q39 A;  2LFO A;  3F6Z B;  4JHQ A;  1W5R A;  2AT8 X;  4IB8 A;  1TVQ A;  4XMF A;  1PBY A;  3NP1 A;  1VPR A;  1VWO B;  1I4U A;  3P6H A;  1VWJ B;  4O9S A;  5KIC A;  2GTL O;  3LTW A;  1PBO A;  4XMG A;  1NBX A;  2AT6 X;  2BT9 A;  2KW1 A;  3JQO A;  1PEE A;  1SWS A;  5B2A O;  4Z6J A;  4CPE A;  1ERX A;  1SWF A;  4IBA A;  1U0X A;  1QFV A;  3JS1 A;  5B11 O;  3RKG A;  4B55 A;  4BX6 A;  5HZ5 A;  1JQP A;  4KH8 A;  3CBC A;  1U17 A;  4ALO A;  1PTS A;  2KTD A;  1GT3 A;  1SRI A;  1T0V A;  2MHD A;  3RY2 A;  4ZHC A;  1JJX A;  2E4J A;  5IXG A;  1KL5 A;  1KT6 A;  1OBP A;  4LKP A;  3WJF A;  3WZQ A;  1GGL A;  1LEL A;  1SY2 A;  4I3D A;  1JV4 A;  3FA7 A;  1EII A;  4OEL A;  4CDF A;  1UYO X;  2RTB B;  2OVS A;  1MEP A;  3BX7 A;  1HMT A;  1N43 A;  2LBA A;  5C0N A;  3NAD A;  3AKM A;  4ZHG A;  4N7D A;  1UZ2 X;  2HYS A;  1YIV A;  5B27 A;  5BVQ A;  3B2J A;  4U8U O;  3HOL A;  1EPA A;  2FGS A;  2JW1 A;  4XME A;  3C76 X;  3FYF A;  2Y3F A;  1DC9 A;  3IA8 A;  1A2D A;  3HWF A;  3OJY C;  4DNE A;  1KQX A;  3WJC A;  1SRF A;  1RBP A;  3CMP A;  1T68 X;  3ELZ A;  3HOE A;  3MX7 A;  4IB9 A;  4NYR A;  4OMX A;  3VG6 A;  2X34 A;  4A1H A;  1GX3 A;  1NGL A;  3RDU A;  2Q4N A;  1GKA A;  2X46 A;  4CPI A;  1I9H A;  3S26 A;  2RTN B;  4CDC A;  4BX7 B;  2IZD B;  5F1E A;  1E00 A;  1SXX A;  3G7X A;  4MIR A;  2X8F A;  1SWA A;  2RTG B;  3CR6 A;  2MJI A;  2JU3 A;  2KT4 B;  3FR2 A;  4GDZ A;  4O3Y A;  1VWI B;  4GET A;  1X8P A;  3CQR A;  1Y0G A;  1VWA B;  1RXJ A;  1HMS A;  5HCD C;  1RST B;  2HKD A;  1X8U A;  2WEW A;  3JSQ A;  3NBX X;  4MVL A;  4WHI A;  3RDQ A;  4CK4 A;  3RSW A;  1SWD A;  1GT4 A;  4XMC A;  5FQ6 E;  4M7M A;  4AZP A;  2OL7 A;  1RLB E;  3L4R A;  1SLG B;  2ZAG A;  3C78 X;  2Y32 A;  1SWE A;  2Q2P A;  3HWD A;  4GE1 A;  4O49 A;  3RWX A;  3GAQ A;  3SZJ A;  1BM5 A;  4FBO A;  4GU8 A;  4Y0S A;  2OF8 A;  5CYB A;  5LJB A;  1X89 A;  2RTE B;  1VYG A;  4WBK A;  2CM4 A;  3KQ0 A;  4KT5 A;  4C5P A;  1JIW I;  1URE A;  4OS3 A;  5HZ8 A;  2AF5 A;  1A57 A;  4MVK A;  1FDQ A;  3SLJ A;  1HMR A;  2QOM A;  1HXZ A;  2RTC B;  3BU1 A;  1RXK A;  3FID A;  2GJ5 A;  4I95 A;  4NP1 A;  4YDB A;  4YFP A;  4Z28 A;  1VWK B;  2CBS A;  2BC3 A;  4EQA C;  5KID A;  2X56 A;  2OVA A;  4OS0 A;  3VE2 A;  4U8U M;  2OVE A;  5HA0 A;  5IO7 A;  3T1D A;  3VG2 A;  4YFQ A;  2YG2 A;  3APV A;  1QY2 A;  1FE3 A;  4COT A;  3X00 A;  1ALB A;  5H8T A;  1BRP A;  1E02 A;  3APU A;  3FA9 A;  4QAE A;  2GTL N;  5BVS A;  4TKB A;  4D6A A;  3APW A;  4O3W A;  2A3F X;  1D2U A;  2DJG A;  1YWC A;  3P6F A;  4NLJ A;  3F8A A;  1I05 A;  4QGV A;  1EW3 A;  4CDE A;  1N9Y A;  4NLI A;  4EKV A;  3U03 A;  1HQQ A;  2HLV A;  1FTP A;  2IZH B;  5H9N A;  4R0B A;  2PY1 A;  1I04 A;  4ZR2 A;  1G7N A;  2BHV A;  1JMX A;  4A1Y A;  2NND A;  1NQM A;  4AZN A;  4GKC A;  4O4S A;  3T6L A;  1EPB A;  2UYW A;  3GE2 A;  4U3Q A;  1AVD A;  3H3I A;  4QYN A;  5LJD A;  4ZHF A;  3OE3 A;  2ACP X;  4PSQ A;  2RD7 C;  1JZU A;  1ZNL A;  1L6M A;  2AMM X;  1B56 A;  2RTO B;  4XMH A;  4BJ8 A;  3FW5 A;  1BSY A;  5JD2 A;  1FJ1 E;  1ICN A;  1UYN X;  3RDM A;  1T8V A;  5FAZ A;  1ICM A;  5AJB A;  3NQ9 A;  1GT5 A;  1VWF B;  1STR B;  1SRE A;  2FWV A;  1STS B;  1IJ8 A;  2A8G A;  1MDC A;  1BBP A;  4TKH A;  4FGI B;  4U8U N;  3APX A;  2L9C A;  2BS5 A;  4TNN A;  2AVI A;  3B2L A;  1MUP A;  3NQK A;  4Z2V A;  5LJH A;  3KFF A;  3O19 A;  4OS8 A;  1CJ5 A;  1G5W A;  4ZGU A;  2OYB O;  4GJS A;  1IKJ A;  1GX8 A;  1LCZ A;  1LCV A;  3V8U A;  2IZJ A;  3RY1 A;  2C4I A;  3ZW1 B;  3TZS A;  3N91 A;  1JYJ A;  2NNE A;  1DZP A;  1B8E A;  2RA6 A;  1SWG A;  3LV4 A;  5H9L A;  3RE5 A;  3D9W A;  1AQB A;  4CPF A;  2OF9 A;  1EIO A;  1I06 A;  1ERB A;  3WYQ A;  1NP4 A;  1LPJ A;  1DV9 A;  3FW4 A;  1Z24 A;  4O4O A;  1O1U A;  1X71 A;  2A5B A;  4TQ2 A;  2QCB A;  3EC5 A;  2MF6 A;  1ZNH A;  1QY1 A;  1DF8 A;  1LF7 A; 
#chains in the Genus database with same CATH homology
 2JU8 A;  1ZRY A;  2QOS C;  3FR4 A;  3KFI A;  5HCE C;  5BVT A;  2RN4 A;  2HMB A;  4QGW A;  3AKN A;  4IMO A;  3F9D A;  4NW4 A;  3EYC A;  1XKI A;  3B2H A;  5D48 A;  2ASN X;  1CBI A;  1PMP A;  3P6E A;  3U0D A;  3WBG A;  1B4M A;  2AKQ A;  2O62 A;  3ZW0 B;  1FEL A;  1AEL A;  1QWD A;  3MVF A;  3P24 A;  1LID A;  5EED A;  5HBS A;  3WOV A;  1YWD A;  1IFB A;  2CBR A;  4YKM A;  1GXA A;  2F73 A;  5FFH A;  3VG7 A;  4I9R A;  4A60 A;  5EDB A;  4ZCB A;  3NQ3 A;  4QRL A;  2YMS A;  2L67 A;  4BVM A;  4KII A;  3C77 X;  2Z4H A;  5AEO A;  5L8N A;  1ADL A;  1TOW A;  2F09 A;  3SOT A;  1BLR A;  1XCA A;  3FEP A;  1A3Y A;  4GRJ A;  4TLJ A;  2BLG A;  2FS6 A;  1JBH A;  2WSJ A;  1DZJ A;  4HWM A;  1KGL A;  1EI5 A;  1TXL A;  3NR3 A;  4IB7 A;  2GTL M;  3TGA A;  2HZR A;  3UEX A;  3CWK A;  3HK1 A;  4GNY A;  4JGL A;  1TW4 A;  1EAL A;  4EFG A;  3P6D A;  4O3Z A;  2QO6 A;  4YCE A;  2LKK A;  2XKL A;  4GZV A;  3UAQ A;  1SY3 A;  3B2I A;  3FIQ A;  1X8N A;  3BX8 A;  1MX8 A;  1S44 A;  4I3B A;  2GTF X;  5IO5 A;  2IFB A;  3ZQ3 A;  1O8V A;  4AZO A;  4KC8 A;  5AQ6 A;  3FMZ A;  4QQ1 A;  2WWP A;  4AZR A;  2A13 A;  4MVE A;  5F58 A;  2OFM X;  3D97 A;  1FEM A;  4EEJ A;  1EQD A;  1EUO A;  5EDC A;  4EDE A;  4YGZ A;  3S5V A;  2K23 A;  1P6P A;  3KFG A;  1BSO A;  5KHP A;  3QKG A;  4A8Z A;  4WFU A;  3S5X A;  1GKA B;  3NX2 A;  4ALB A;  4ORX A;  4ORR A;  5FEN A;  2WEX A;  3U9P C;  1BWY A;  1QAB E;  3BRN A;  2Q2M A;  1DZK A;  1MX7 A;  1ZND A;  4L1N A;  1Y9T A;  3PH6 A;  5BYP A;  3STK A;  4HPA A;  3STM X;  1SXY A;  4ZH9 A;  1LKE A;  2W2B A;  1E06 A;  4IAX A;  1BRQ A;  1TOU A;  3O22 A;  4YBU A;  3VPJ E;  4O4X A;  1LNM A;  3D95 A;  3BDR A;  3FR5 A;  2HNX A;  2AT3 X;  4ZJ0 A;  3O2Y A;  5LKF A;  1D3S A;  4YH0 A;  1X8O A;  1GT1 A;  1CRB A;  4ML7 B;  4YMY A;  1OPB A;  4M6S A;  1KOI A;  3TGC A;  4BOE A;  5HTD A;  5HZ9 A;  5L8O A;  3D96 A;  2Q9S A;  5EPQ A;  3K3L A;  3HWG A;  4HFO A;  4RUN A;  1YWB A;  2AT5 X;  3LHN A;  3NPO A;  3P6G A;  4MVI A;  2GC9 A;  1BJ7 A;  5D47 A;  1VYF A;  4I6S A;  1OEK A;  2DM5 A;  1HBQ A;  1FEN A;  4TJZ A;  2G78 A;  4QGX A;  2W2F A;  2QO5 A;  4ORY A;  4MIS A;  3VG5 A;  1OBU A;  4LKT A;  4BQU A;  4NNS A;  4QZU A;  2MO5 A;  3VE1 A;  1DF3 A;  3S60 A;  3PED A;  5LJC A;  1MVG A;  3OD9 A;  4ODD A;  3ZWE A;  5HA1 A;  2P8G A;  1KZW A;  5DG4 A;  2X8S A;  1LIC A;  1HN2 A;  4ORS A;  3VG3 A;  5JR8 A;  1KZX A;  2POA A;  2XST A;  1LIF A;  4Y0P A;  2QO4 A;  2A2U A;  2JMB A;  3UEW A;  3ZI8 A;  4AZQ A;  5LJK A;  2AT0 X;  3P02 A;  2MM3 A;  1QFT A;  5B29 A;  1YP7 A;  1IIU A;  4XMD A;  1S2P A;  4I3C A;  3FLL A;  4FQB B;  3WJB A;  3ZUI A;  3I17 A;  1KT3 A;  1HQP A;  1CBS A;  5LJG A;  3VU1 A;  5D45 A;  4WFV A;  4ES7 A;  3I0A A;  1ZNE A;  5CE4 A;  3BSZ E;  1PM1 X;  2FR2 A;  3DSZ A;  5DPQ A;  3KZA A;  4PJ2 A;  3BLG A;  4YGG A;  1G85 A;  5FQ7 E;  4UU2 A;  4ZGF A;  3WVM A;  1LFO A;  3ZW2 A;  1BEB A;  3NX1 A;  4GNW A;  3FEL A;  3VG4 A;  5EZ2 A;  4GK9 A;  4YDA A;  1SY1 A;  1B0O A;  3UEU A;  2FS7 A;  3MBT A;  4KC7 A;  2M4L A;  4ZHD A;  5F6B A;  2X8T A;  4L3R A;  4IAB A;  1AB0 A;  2W2A A;  1KT5 A;  2LBV A;  4HPC A;  1SXW A;  5HZ6 A;  1QY0 A;  3DTQ A;  4Y0Q A;  4IAW A;  4KCA A;  3KFH A;  2HZQ A;  1ML7 A;  3WJG A;  5D4A A;  4FBR A;  4TKJ A;  5HWZ A;  3FA6 A;  2WQA E;  1HBP A;  2FTB A;  1E5P A;  2JU7 A;  4AW8 A;  4O3X B;  4ORU A;  3EBK A;  1DFV A;  4LZU A;  4INN A;  4ZHH A;  2CM9 A;  2RQ0 A;  3RBY A;  1SMP I;  2RCT A;  3B2K A;  3HTY A;  2CZT A;  2CZU A;  1CBQ A;  3CBS A;  2QM9 A;  2FT9 A;  4ZFX A;  2NP1 A;  1QQS A;  1N0S A;  1ZNK A;  4O4U A;  2Z4I A;  3EM0 A;  1ACD A;  4OMW A;  5IO6 A;  2OZQ A;  2A0A A;  5HZQ A;  4EXZ A;  3TGB A;  1U18 A;  3HWE A;  2NNQ A;  3PPT A;  5AJC A;  3BS2 A;  1CBR A;  4Y0R A;  3OBL A;  1O1V A;  1YP6 A;  1H91 A;  2ALL X;  1KT4 A;  4I9S A;  4LQZ A;  5FQ8 E;  1EXS A;  1OEJ A;  1JJJ A;  3FEK A;  2R56 A;  2OFR X;  2AH7 X;  2X45 A;  3ZUO A;  1GX9 A;  4AYH A;  3PQS A;  4CSB A;  2A2G A;  4QNI A;  4AZM A;  4LZV A;  5D8J A;  4K19 A;  4UU3 A;  2LB6 A;  2L68 A;  1KQW A;  3PH5 A;  4CV7 A;  4N7C A;  4YFR A;  2ANS A;  4GH7 A;  1SA8 A;  1QG5 A;  1YUP A;  4HPD A;  5F6Z A;  3P6C A;  2LA7 A;  3BY0 A;  3ZW1 A;  1R0U A;  4RUU A;  4YKO A;  4ORW A;  1X8Q A;  2EU7 X;  3SAO A;  1YWA A;  2ZAI A;  3WJE A;  5LJE A;  1OEE A;  1SXU A;  1SY0 A;  2G79 A;  2JN3 A;  1IKE A;  4QZT A;  2N93 A;  4QYP A;  5EEE A;  5H9K A;  2RCQ A;  3PEC A;  3E3C A;  1JYD A;  2KD2 A;  5K06 A;  3FA8 A;  2WR6 A;  3Q6L A;  3RZY A;  2FRS A;  1LIE A;  3FEN A;  2OVD A;  5LKE A;  2G7B A;  3ELX A;  4NYQ A;  3ZZV A;  1S7D A;  2R73 A;  4U9C A;  3STN A;  1BSQ A;  4IB6 A;  3UEV A;  5HAE A;  4YCH A;  4DQ4 A;  5H9A A;  1KT7 A;  5F7G A;  3PP6 A;  1OBQ A;  1A18 A;  4YGH A;  3TF6 A;  1ZNG A;  4HPB A;  1IW2 A;  2BS6 A;  4ID2 A;  4IMN A;  5HCC C;  2WUT A;  1GM6 A;  1KXO A;  2K62 A;  2MWH A;  3WJD A;  4ZH6 A;  2QMI A;  4YBP A;  3CQN A;  1OPA A;  2ACO A;  1DZM A;  2AL0 X;  2KTS A;  3D4R A;  1LIB A;  4ON1 A;  5HTE A;  3ZW0 A;  4ARH A;  3EBW A;  1AVG I;  2WQ9 A;  3EMM A;  2R74 A;  4DQ3 A;  1G74 A;  4NNT A;  3PQU A;  2FR3 A;  3BU9 A;  3WXQ A;  2JOZ A;  3IFB A;  2FLJ A;  4FBV A;  1Y9L A;  5L8I A;  1IFC A;  2L5P A;  1NP1 A;  2Q39 A;  2LFO A;  3F6Z B;  2AT8 X;  4IB8 A;  1TVQ A;  4XMF A;  3NP1 A;  1VPR A;  1I4U A;  3P6H A;  4O9S A;  5KIC A;  2GTL O;  1PBO A;  4XMG A;  3JQO A;  2AT6 X;  2BT9 A;  2KW1 A;  1PEE A;  1ERX A;  4IBA A;  1U0X A;  1QFV A;  3JS1 A;  3RKG A;  5HZ5 A;  4KH8 A;  3CBC A;  1U17 A;  4ALO A;  2KTD A;  1GT3 A;  1T0V A;  2MHD A;  4ZHC A;  1JJX A;  2E4J A;  1KT6 A;  1OBP A;  4LKP A;  3WJF A;  1GGL A;  1SY2 A;  4I3D A;  1JV4 A;  3FA7 A;  1EII A;  2OVS A;  3BX7 A;  1HMT A;  5C0N A;  2LBA A;  3NAD A;  3AKM A;  4ZHG A;  4N7D A;  1UZ2 X;  2HYS A;  1YIV A;  5B27 A;  5BVQ A;  3B2J A;  4U8U O;  3HOL A;  1EPA A;  2JW1 A;  4XME A;  3C76 X;  3FYF A;  3IA8 A;  1DC9 A;  1A2D A;  3HWF A;  3OJY C;  1KQX A;  3WJC A;  1RBP A;  3CMP A;  1T68 X;  3ELZ A;  3HOE A;  3MX7 A;  4IB9 A;  4NYR A;  4OMX A;  3VG6 A;  4A1H A;  1NGL A;  2Q4N A;  1GKA A;  2X46 A;  3S26 A;  5F1E A;  1E00 A;  1SXX A;  3G7X A;  4MIR A;  2X8F A;  3CR6 A;  2MJI A;  2JU3 A;  2KT4 B;  3FR2 A;  4GDZ A;  4O3Y A;  4GET A;  1X8P A;  3CQR A;  1HMS A;  5HCD C;  1X8U A;  2WEW A;  3JSQ A;  3NBX X;  4MVL A;  4CK4 A;  3RSW A;  1GT4 A;  4XMC A;  5FQ6 E;  4M7M A;  4AZP A;  1RLB E;  3L4R A;  2ZAG A;  3C78 X;  2Q2P A;  3HWD A;  4GE1 A;  4O49 A;  3RWX A;  3GAQ A;  1BM5 A;  4FBO A;  4GU8 A;  4Y0S A;  5CYB A;  5LJB A;  1X89 A;  1VYG A;  4WBK A;  2CM4 A;  3KQ0 A;  4KT5 A;  1JIW I;  1URE A;  4OS3 A;  5HZ8 A;  1A57 A;  4MVK A;  1FDQ A;  1HMR A;  3BU1 A;  4NP1 A;  4YFP A;  2GJ5 A;  4I95 A;  4YDB A;  4D6B A;  5KID A;  2CBS A;  4EQA C;  4OS0 A;  2OVA A;  3VE2 A;  4U8U M;  2OVE A;  5HA0 A;  5IO7 A;  3T1D A;  3VG2 A;  4YFQ A;  2YG2 A;  3APV A;  1QY2 A;  1FE3 A;  4COT A;  1ALB A;  5H8T A;  1BRP A;  1E02 A;  3APU A;  3FA9 A;  4QAE A;  2GTL N;  5BVS A;  4TKB A;  4D6A A;  3APW A;  4O3W A;  2A3F X;  1D2U A;  3P6F A;  1YWC A;  4NLJ A;  3F8A A;  1I05 A;  4QGV A;  1EW3 A;  3U03 A;  4NLI A;  2HLV A;  1FTP A;  5H9N A;  4R0B A;  2PY1 A;  1I04 A;  4ZR2 A;  1G7N A;  2BHV A;  4A1Y A;  2NND A;  4AZN A;  4GKC A;  4O4S A;  1EPB A;  3GE2 A;  4U3Q A;  3H3I A;  4QYN A;  4ZHF A;  3OE3 A;  2ACP X;  4PSQ A;  2RD7 C;  1JZU A;  1ZNL A;  1L6M A;  2AMM X;  1B56 A;  4XMH A;  3FW5 A;  1BSY A;  1ICN A;  1T8V A;  5FAZ A;  1ICM A;  5AJB A;  3NQ9 A;  1GT5 A;  2FWV A;  4TKH A;  5H9L A;  1MDC A;  1BBP A;  4U8U N;  4FGI B;  3APX A;  2L9C A;  2BS5 A;  4TNN A;  3B2L A;  1MUP A;  3NQK A;  5LJH A;  1CJ5 A;  3KFF A;  3O19 A;  4OS8 A;  1G5W A;  4ZGU A;  1IKJ A;  1GX8 A;  3V8U A;  3ZW1 B;  3TZS A;  3N91 A;  1JYJ A;  2NNE A;  1DZP A;  1B8E A;  2RA6 A;  3LV4 A;  1AQB A;  1EIO A;  1I06 A;  1ERB A;  1NP4 A;  1LPJ A;  1DV9 A;  3FW4 A;  1Z24 A;  4O4O A;  1O1U A;  1X71 A;  4TQ2 A;  5LJD A;  1ZNH A;  1QY1 A;  4WHI A;  1LF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...