4MVLA

Crystal structure of an engineered lipocalin (anticalin h1ga) in complex with the alzheimer amyloid peptide abeta1-40
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
173
structure length
173
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGAAGNVLLREDKDPLKMYATIYELKEDKSYNVTSVGFDDKKCLYKIRTFVPGSQPGEFTLGRIKSEPGGTSWLVRVVSTNYNQHAMVFFKEVAQNRETFNITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/protein fibril
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title High-affinity Anticalins with aggregation-blocking activity directed against the Alzheimer beta-amyloid peptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4mvlA00
3FA9A 4ALBA 4UU3A 1TVQA 2QOSC 1OEEA 1ACDA 1KQXA 1IKJA 2JU8A 5HCCC 2OVAA 1GX9A 3D96A 3FLLA 5B29A 1JZUA 4ZHGA 1U18A 3BSZE 4AZMA 1AVGI 3B2HA 2A3FX 3STKA 5D47A 4YMYA 3BLGA 3PP6A 1LIDA 1MUPA 2WQAE 1TW4A 1L6MA 1FELA 3VG5A 5HCEC 4MVKA 1O1UA 2IFBA 3TF6A 3WJGA 5LJDA 4D6BA 4YGGA 1LICA 4GNYA 5HZQA 5CE4A 4I3CA 4WBKA 1DF3A 5B27A 4MVIA 4IB8A 1B4MA 2K23A 3CBSA 4YGHA 2LFOA 2AL0X 3UEXA 1O8VA 2GJ5A 3O22A 1GM6A 1EPAA 5C0NA 1OPAA 2XKLA 1PMPA 1KT6A 3CR6A 3NQ3A 1BBPA 3KFGA 4YKOA 4YDAA 2E4JA 4RUUA 1LIFA 3WBGA 5LKEA 2CM9A 1QQSA 4IAXA 4LZVA 4ZGUA 2MO5A 4OMWA 5JR8A 4ES7A 1IKEA 4I3DA 4ZH6A 4A60A 1EIIA 1AB0A 2WQ9A 1CBRA 1PBOA 4XMHA 1HQPA 1LKEA 2CBSA 3L4RA 5HCDC 3B2KA 5LJKA 1GT4A 1VPRA 1LF7A 2DM5A 2FS6A 3HWFA 2GC9A 4I9RA 4AZNA 1VYGA 1UREA 4BQUA 3WVMA 4GETA 4R0BA 3T1DA 1IFCA 1PM1X 1ZRYA 1ZNLA 2AT3X 1JYDA 2Q9SA 1SXYA 4ODDA 1A18A 2LKKA 4IMNA 1X89A 4YH0A 2NNEA 1I06A 4LKPA 2RCQA 2HMBA 3BDRA 5H9LA 3P6HA 5BVSA 2PY1A 1Z24A 3WJEA 1DZKA 2L68A 4AZOA 3MVFA 1A2DA 5EDBA 4ORRA 4Y0SA 4QYNA 1OPBA 3NADA 4TNNA 3BX7A 3CWKA 2BLGA 3FENA 5KHPA 1EQDA 5H9KA 1QY0A 3ELZA 3APXA 1S44A 1D3SA 1AQBA 3TGAA 1JBHA 5EPQA 4XMEA 1OBUA 4AZRA 4M7MA 3BU9A 1ICNA 1QFVA 2ALLX 3RSWA 3KFHA 1BSQA 5F6ZA 1QG5A 5DPQA 3MBTA 4BOEA 5HWZA 4QAEA 3NX1A 5H9AA 4ZCBA 4XMFA 1KZXA 2AT6X 4YCHA 3C77X 3UEWA 1CBIA 1JV4A 1U0XA 2NNDA 3VG2A 1IIUA 4AYHA 1DZJA 2X45A 4NLJA 2OVEA 1B56A 4Y0QA 2WEXA 1R0UA 1A3YA 1ZNGA 3FR2A 4IB7A 5HZ6A 1YP7A 4ZR2A 4OS3A 5HZ9A 4QGVA 3HWEA 1EXSA 2X46A 3CQRA 3C76X 2XSTA 1X8PA 3P6GA 4TLJA 3WJBA 4ARHA 1QY1A 3B2IA 4TKBA 2AT8X 3FR4A 1YUPA 3ZUOA 2RQ0A 4WFVA 1BRPA 3FA7A 3NX2A 4OS0A 4ORYA 2AMMX 3FR5A 5HTDA 1KGLA 3DSZA 1ALBA 5FFHA 1JJJA 1GT3A 2POAA 4EEJA 4YKMA 1X8UA 1VYFA 4QZUA 4GRJA 5KICA 2A0AA 2AT0X 3FELA 2CBRA 3U0DA 3RZYA 1HMRA 4N7DA 1O1VA 4BVMA 3ZQ3A 1DFVA 5BVTA 5L8NA 4UU2A 2R56A 3APWA 2LBVA 1EPBA 1FDQA 1LPJA 2RD7C 3F8AA 1H91A 1P6PA 4YDBA 5FENA 3FA6A 1HMSA 5HTEA 2HZRA 4HFOA 1NP4A 1GT5A 3BY0A 4I9SA 1TOWA 3OJYC 3UEUA 3CMPA 2JN3A 1E5PA 1UZ2X 3PH6A 3VG4A 2YG2A 1QFTA 2FLJA 1OEKA 1KT5A 3ELXA 5LJEA 5LJCA 2LB6A 1ADLA 2QM9A 1SXXA 3P6EA 4NNTA 2W2BA 2G7BA 1YWAA 5FAZA 3AKNA 2L5PA 1T68X 1EW3A 1X8NA 2Q39A 2FWVA 3FW5A 3KQ0A 5BVQA 1DZMA 4IMOA 1SXUA 3K3LA 5D45A 1QY2A 4PSQA 1ZNEA 2FTBA 1LNMA 3VG6A 3WXQA 1G85A 4HPBA 3IA8A 4IB6A 2A2GA 4YFPA 4YBPA 1G74A 3B2LA 1EIOA 4KIIA 4ORUA 1BEBA 3BX8A 1GKAA 4XMCA 4ZJ0A 2ACPX 3TGBA 1GKAB 5D48A 2AKQA 4YCEA 5EEEA 5EZ2A 1LIBA 3KZAA 5HZ8A 1SA8A 1KT3A 1HN2A 5K06A 2QO4A 5F58A 4CK4A 1GX8A 3FMZA 2Q4NA 1FE3A 4AW8A 1ZNHA 2FR2A 1LFOA 1I05A 4EFGA 1BSOA 1DZPA 2W2AA 3EBKA 4ZHDA 2CM4A 1MVGA 3JS1A 4AZPA 2AH7X 1I04A 2HNXA 3KFFA 2WR6A 1G7NA 5H8TA 2AT5X 1X8OA 4NP1A 3B2JA 3FIQA 1GXAA 1ZNKA 4Y0RA 4HPCA 2MM3A 2OFMX 5IO5A 1KQWA 4NLIA 1SY1A 5HA1A 1JJXA 1ML7A 4IB9A 3TZSA 1IFBA 3STMX 1X71A 2R74A 5F6BA 2RCTA 1ERXA 4O9SA 1ZNDA 3EM0A 4QYPA 4ZH9A 1LIEA 1HMTA 3C78X 2A2UA 5IO7A 1CBQA 1KXOA 2NP1A 3VG3A 1S2PA 1E00A 4ALOA 4QZTA 4ORXA 4K19A 1JYJA 4XMGA 2G78A 2OFRX 1EALA 4IBAA 1D2UA 1A57A 3BS2A 2QO5A 3P6DA 3FW4A 1NP1A 3SAOA 4TKJA 4ORSA 4LZUA 2HLVA 2FRSA 2WSJA 4EXZA 2OZQA 3CQNA 4QGWA 3IFBA 1CRBA 4DQ4A 1OBPA 4QGXA 3NP1A 3BU1A 4ZHFA 4NYRA 1T0VA 1FTPA 2QO6A 1S7DA 4N7CA 1MX7A 2RA6A 4WFUA 3F9DA 2KT4B 2HYSA 1B8EA 3CBCA 2KTDA 1ERBA 2WUTA 3O2YA 5LJHA 4OS8A 4YGZA 3ZUIA 1DC9A 3S26A 1BJ7A 3HWGA 4HPDA 2F73A 2JU3A 4NNSA 5LKFA 5EEDA 3AKMA 1SY3A 5DG4A 2GTFX 1KOIA 2JU7A 1TOUA 2HZQA 2Q2PA 3KFIA 3VG7A 4NYQA 1RLBE 4HPAA 3NPOA 3I0AA 1KZWA 4M6SA 3FA8A 2A13A 2ANSA 2EU7X 2ACOA 2L67A 1GGLA 4ORWA 3D95A 4A1HA 4YFQA 1EUOA 4A8ZA 2FR3A 5LJBA 5D8JA 5KIDA 2WEWA 5EDCA 4TQ2A 3HWDA 2JOZA 2G79A 3DTQA 3EYCA 4MVLA 1AELA 1QABE 3WJCA 1BSYA 3U03A 2OVDA 3NR3A 3TGCA 2P8GA 4TKHA 3U9PC 2Q2MA 1KT4A 1SY0A 3WJDA 4IAWA 2FS7A 5F1EA 5HZ5A 1BM5A 2WWPA 2R73A 4A1YA 1CJ5A 1FEMA 5L8OA 2CZTA 1G5WA 1XCAA 3D97A 4DQ3A 2K62A 5HAEA 3JSQA 2CZUA 3FEPA 1I4UA 4EDEA 1MDCA 1OBQA 1E02A 2LBAA 1OEJA 4TJZA 3I17A 1MX8A 1N0SA 3P6CA 4GNWA 4XMDA 4YFRA 1SY2A 2L9CA 1XKIA 1B0OA 1NGLA 4I3BA 2ASNX 3PECA 5F7GA 1IW2A 5IO6A 1BWYA 3UEVA 2N93A 1BRQA 1X8QA 1HBPA 3P6FA 4YBUA 1KT7A 4GH7A 4D6AA 1YP6A 1YIVA 3WJFA 3EMMA 1U17A 3PPTA 1CBSA 2NNQA 4GE1A 5H9NA 5L8IA 4OMXA 4GKCA 4ZHCA 1YWCA 4ZHHA 1SXWA 3EBWA 4AZQA 5LJGA 2O62A 3O19A 3PEDA 3APUA 4RUNA 1QWDA 4ZFXA 3FEKA 4LKTA 4Y0PA 5D4AA 5HA0A 1HBQA 2W2FA 1ICMA 1YWDA 3NQ9A 1BLRA 3GAQA 5AQ6A 1E06A 1TXLA 1YWBA 1FENA 3BRNA 3PH5A 3G7XA 3QKGA 2FT9A 3Q6LA 1DV9A 3HK1A 1GT1A 1T8VA 2MJIA 1RBPA 3APVA 3STNA 1PEEA 5HBSA
chains in the Genus database with same CATH superfamily
1VWLB 3FA9A 1VWDB 4ALBA 4UU3A 1LDQA 1MK5A 1TVQA 1VWIB 4IABA 4KC7A 4MISA 5B5FA 2AVIA 2QOSC 1OEEA 1LCZA 1ACDA 3LHNA 1KQXA 3RDQA 2RTCB 3FIDA 1IKJA 2IZJA 2JU8A 3PQSA 4FBRA 3WZOA 5HCCC 1SLEB 1GX9A 2OVAA 1SWFA 2M4LA 3D96A 3FLLA 4NV7A 5B29A 4CPFA 1JZUA 2JMBA 4BBOA 4ZHGA 1U18A 1E2TA 1LDOA 3BSZE 4AZMA 1AVGI 3B2HA 2A3FX 2KW1A 3STKA 5D47A 1VWRB 3E3CA 1EI5A 4YMYA 3BLGA 3PP6A 2ZAIA 1LIDA 1MUPA 1W5RA 2WQAE 2WPUA 1TW4A 4QNIA 1L6MA 1FELA 4KCAA 2FHLA 3VG5A 2MWHA 4MVKA 5HCEC 4DNEA 1O1UA 2IFBA 5B5GA 2IZDB 3TF6A 3WJGA 5LJDA 4D6BA 4YGGA 1LICA 4GNYA 2HKDA 5HZQA 3NBXX 5CE4A 4I3CA 4WBKA 1DF3A 1SRFA 4MVIA 5B27A 1SRIA 2LA7A 4ML7B 4IB8A 2BT9A 2K23A 4O4SA 3CBSA 4YGHA 2LFOA 1B4MA 1VWPB 2MF6A 2AL0X 1UYNX 2OFBA 3UEXA 4GK9A 1O8VA 5FQ7E 2GJ5A 4INNA 3O22A 1GM6A 1EPAA 2OF9A 1OPAA 1RXKA 2XKLA 4MVEA 1SWBA 1PMPA 5C0NA 1KT6A 3CR6A 3NQ3A 1BBPA 3KFGA 4YKOA 2I5VO 4O3XB 2E4JA 4YDAA 5IRUA 5JD2A 4GUZA 4RUUA 2RTFB 2OL7A 1LIFA 3WBGA 5LKEA 2CM9A 3FYFA 1QQSA 4IAXA 4LZVA 4ZGUA 2MO5A 4OMWA 5JR8A 4ES7A 3WZQA 1IKEA 4I3DA 4ZH6A 4A60A 1EIIA 5FQ6E 1AB0A 2WQ9A 3RWXA 1CBRA 1PBOA 4XMHA 3T2WA 1HQPA 1LKEA 1VWBB 2CBSA 3L4RA 4Z6JA 3SLTA 5HCDC 3B2KA 5CHKA 5LJKA 4ON1A 2QMIA 1GT4A 1VPRA 1LF7A 2DM5A 2RTEB 2FS6A 3HWFA 1STRB 1FJ1E 2GC9A 4I9RA 4AZNA 1VYGA 1UREA 4BQUA 2JGSA 2BHVA 3MG5A 3WVMA 4GETA 4R0BA 3T1DA 3VU1A 1IFCA 1PM1X 1RXJA 1ZNLA 1ZRYA 1JYDA 2AT3X 2Q9SA 4I95A 1SXYA 3RDXA 4ODDA 1A18A 1LCWA 4Z28A 2LKKA 4IMNA 1X89A 2G8CO 4YH0A 2IZAA 2NNEA 1I06A 4LKPA 2RCQA 2HMBA 3BDRA 2OL8O 5H9LA 3P6HA 5BVSA 2PY1A 1Z24A 4PJ2A 4U3QA 3WJEA 1DZKA 4FBVA 3ZW1A 2L68A 4AZOA 2IZBA 3EW1A 3MVFA 3RDMA 3QQ2A 1A2DA 4CPHA 5EDBA 2QOMA 3SLOA 1LCVA 1SWKA 3HOLA 4ORRA 3T2XA 4Y0SA 4QYNA 1OPBA 3NADA 4TNNA 1DF8A 3BX7A 2RTLA 3CWKA 2IZFB 2FGSA 2IZEB 2OY1O 3S60A 4GDZA 2BLGA 3FENA 5KHPA 2YMSA 1EQDA 2RTIB 5H9KA 1QY0A 1SWDA 3ELZA 3APXA 3PQUA 1K24A 2RN4A 1S44A 1D3SA 1AQBA 1SWTA 3AUMO 1SWLA 3KVNA 3TGAA 1JBHA 2DJFA 2FHNX 5EPQA 4XMEA 1OBUA 4AZRA 3ZI8A 4M7MA 3BU9A 2RTKA 1ICNA 1QFVA 2ALLX 3RDOA 3RSWA 3KFHA 4WHIA 1BSQA 2GTLO 3AEHA 5F6ZA 1QG5A 5DPQA 1WBIA 3MBTA 2IZIA 4BOEA 2BC3A 5HWZA 4QAEA 3NX1A 4A1HA 5H9AA 1VWMB 1VWQB 4ZCBA 4XMFA 2OF8A 2PI3O 1KZXA 1N9YA 2AT6X 2X8SA 4YCHA 2JW1A 3C77X 2FKJA 3UEWA 1CBIA 1JV4A 1SWUA 1U0XA 2NNDA 4JO6A 3VG2A 1IIUA 4AYHA 1DZJA 3VPJE 3LV4A 2RTRB 2X45A 2OVEA 4NLJA 3WYPA 3SOTA 1B56A 4Y0QA 2WEXA 4HWMA 1R0UA 2RTQB 1A3YA 1ZNGA 3FR2A 1JIWI 4IB7A 1YP7A 4L1NA 4ZR2A 3ZZVA 5HZ6A 4OS3A 2VDFA 2BS5A 4QGVA 5HZ9A 3HWEA 1EXSA 2X46A 3CQRA 4O3YA 1Y9TA 3C76X 4KH8A 3VE2A 2A5CA 2XSTA 3PDFA 1X8PA 2VFCA 1KL3A 3P6GA 4KT5A 4TLJA 3WJBA 4ARHA 1VWCB 4JNJA 1QY1A 3B2IA 3T6LA 4ID2A 3RE6A 2OFAA 4TKBA 2IZKA 2AT8X 1SLDB 3FR4A 4Z2VA 5IRWA 3RDSA 1YUPA 3ZUOA 1W6FA 2OYBO 2RQ0A 4JHQA 4WFVA 1BRPA 3FA7A 3NX2A 4GU8A 4OS0A 4ORYA 2G5LA 2AMMX 2UZ2A 3H3IA 1VWNB 3FR5A 3RE5A 5HTDA 2RTBB 1KGLA 1VWAB 3DSZA 1ALBA 5FFHA 5AJBA 5AEOA 2UYWA 1GT3A 2POAA 1JJJA 5B10O 4EEJA 2KTSA 4YKMA 1X8UA 1VYFA 4QZUA 4GRJA 3UAQA 5KICA 2A0AA 2AT0X 3FELA 2CBRA 2Y32A 5F2BA 3RKGA 3RZYA 3WOVA 5FQ8E 4CDCA 1HMRA 3U0DA 4N7DA 1O1VA 4BVMA 3ZQ3A 1VWEB 4CSBA 1DFVA 2I5ZO 5BVTA 4FBOA 5L8NA 4UU2A 2R56A 3APWA 2LBVA 1EPBA 4I6SA 1FDQA 4OKAA 3S5VA 1LPJA 2RD7C 3F8AA 2IZHB 4GGZA 2VFBA 1H91A 1VWOB 3P02A 1P6PA 4O49A 4YDBA 5FENA 3FA6A 3V8UA 1HMSA 3OE3A 5HTEA 2HZRA 4HFOA 1VWJB 1NP4A 1GT5A 3BY0A 4I9SA 1TOWA 3OJYC 3UEUA 4CDEA 3CMPA 2JN3A 1E5PA 1UZ2X 3PH6A 3SZHA 2YG2A 3VG4A 1HY2A 1QFTA 2FLJA 5L3YA 1OEKA 1KT5A 4ZGFA 3ELXA 5LJEA 5LJCA 2LB6A 2RTJA 1WUBA 1ADLA 2QM9A 5K68A 1SXXA 3P6EA 4BX5A 4NNTA 5BYPA 2W2BA 2G7BA 1YWAA 2X34A 5FAZA 2Z4HA 3AKNA 2L5PA 1T68X 2Z4IA 1EW3A 4Z2OA 1X8NA 2FWVA 2Q39A 4BX5B 3FW5A 3KQ0A 5BVQA 3RBYA 1K3BA 1DZMA 4CPIA 3T6FA 2RTMA 4IMOA 1SXUA 3K3LA 3NQKA 5D45A 4Z27A 1QY2A 5CYBA 4PSQA 1ZNEA 2FTBA 4O4OA 1LNMA 3SLJA 3VG6A 3WXQA 1G85A 1SREA 1SWGA 1SWSA 4HPBA 1KFFA 1LELA 3IA8A 1SWJA 4IB6A 2A2GA 4YFPA 4YBPA 1G74A 3RY2A 1Y9LA 3B2LA 2OY8A 1EIOA 4KIIA 3MM0A 4ORUA 1VYOA 1BEBA 3BX8A 1VWGB 1GKAA 4CDDA 3LTWA 4XMCA 4Z2PA 3D4RA 1N9MA 3JQOA 4BJ8A 4ZJ0A 1PTSA 2ACPX 2X32A 1JMXA 3FDCA 4GGTA 3TGBA 5CSEA 1UYOX 1GKAB 5D48A 4CPEA 2AKQA 4YCEA 1OSPO 5EEEA 4Y59A 3HOEA 5EZ2A 4FQBB 1W4TA 1LIBA 3KZAA 5HZ8A 1SA8A 2RTAA 1KT3A 1HN2A 5K06A 2QO4A 5F58A 4CK4A 1GX8A 1HXZA 3FMZA 2Q4NA 1FE3A 2RTOB 1ZNHA 2FR2A 4AW8A 1LFOA 1I05A 4EFGA 1BSOA 1DZPA 2W2AA 1IJ8A 1SLGB 3EBKA 4ZHDA 2CM4A 4U8UN 1MVGA 3JS1A 4EQAC 1STSB 4AZPA 2AH7X 1I04A 2HNXA 3KFFA 2WR6A 1G7NA 1NQMA 5H8TA 2AT5X 1X8OA 4NP1A 3B2JA 3FIQA 1BWYA 1KL4A 1GXAA 4FGIB 5AJCA 4U8UM 5LJHA 1ZNKA 4Y0RA 1RXHA 4QRLA 4HPCA 2MM3A 2OFMX 5IO5A 1KQWA 4NLIA 1SY1A 1VWFB 5HA1A 1SWNA 1JJXA 1ML7A 2C1QA 4IB9A 3ZW2A 2Y3EA 3TZSA 1PBYA 1IFBA 3N91A 3STMX 1SMPI 1X71A 2R74A 5F6BA 3ZWEA 2RCTA 2RTPB 3S5XA 1ERXA 1RAVA 4O9SA 1ZNDA 3EM0A 4GJVA 3VGWA 4O4XA 3X00A 4QYPA 4ZH9A 1LIEA 1AVEA 3ZW0B 1HMTA 3C78X 2CAMA 2A2UA 4U46A 4DCBA 5IO7A 1CBQA 1KXOA 2NP1A 3VG3A 1S2PA 1E00A 4ALOA 4QZTA 4ORXA 4K19A 2C1SA 1JYJA 1NDJA 2G78A 2OFRX 1SWHA 4MIRA 4XMGA 1EALA 4IBAA 4I60A 1D2UA 2BS6A 1A57A 3BS2A 1SWQA 2QO5A 2X8TA 3P6DA 3FW4A 1NP1A 3SAOA 4TKJA 4ORSA 4LZUA 2HLVA 2FRSA 1JJUA 2QCBA 4BCSA 2IZLB 2WSJA 4EXZA 2OZQA 3CQNA 4QGWA 3IFBA 1CRBA 4DQ4A 1OBPA 1NBXA 1HXLA 1SRGA 2RTNB 3BU1A 1JMZA 3NP1A 4QGXA 4ZHFA 4NYRA 1T0VA 1FTPA 2IZCB 1S7DA 2F01A 2QO6A 2X55A 4N7CA 1MX7A 2RA6A 4GZVA 2OY5O 3VHHA 4WFUA 3F9DA 2KT4B 2X8FA 4BX6A 2HYSA 1B8EA 3EC5A 3CBCA 4A8ZA 2KTDA 1ERBA 2WUTA 2Y3FA 3MX7A 3O2YA 3EW2A 4OS8A 4YGZA 3ZUIA 1DC9A 3S26A 1BJ7A 3HWGA 4HPDA 1MOYA 2F73A 2JU3A 4KC8A 4NNSA 5EEDA 1JQPA 1SY3A 3AKMA 5DG4A 5LKFA 4BX6B 2GTFX 1KOIA 1MM9A 1Y53X 2JU7A 1SWEA 1TOUA 2FKGA 2HZQA 2OY7A 3OBLA 4CDFA 2Q2PA 3KFIA 3VG7A 4NYQA 1RLBE 4HPAA 3NPOA 3I0AA 1KZWA 4M6SA 3FA8A 1SWPA 2A13A 2ANSA 2EU7X 2ACOA 2L67A 1GGLA 4O4UA 3D95A 1SWCA 1RSTB 1EUOA 4ORWA 4YFQA 2FR3A 2RTHB 2X56A 3Q34A 5D8JA 5LJBA 5KIDA 2WEWA 5EDCA 4TQ2A 3HWDA 2JOZA 1SRHA 4NV8A 3WZPA 1GX3A 2G79A 3DTQA 3EYCA 4MVLA 1AELA 1QABE 3WJCA 1BSYA 1Y0GA 3U03A 2OVDA 3NR3A 4O3WA 2P8GA 4TKHA 3VHIA 3U9PC 3RY1A 2Q2MA 3TGCA 1I9HA 1KT4A 4LQZA 1SY0A 3WJDA 5IXGA 4IAWA 2FS7A 5F1EA 5HZ5A 4BGFA 1BM5A 2WWPA 1NC9A 2R73A 4A1YA 1CJ5A 1FEMA 2KD2A 3VHMA 1N4JA 3SZJA 2MHDA 2CZTA 5L8OA 1G5WA 1XCAA 5B11O 4JGLA 3D97A 4DQ3A 2IZGB 2K62A 4NW4A 5HAEA 1SWRA 3JSQA 3VE1A 1Y55X 2RTGB 2CZUA 3FEPA 4EKVA 1I4UA 2AF5A 2OL6O 4B55A 1MDCA 1OBQA 4EDEA 4QQ1A 1E02A 4CV7A 2LBAA 1OEJA 5IRAA 4TJZA 2A8GA 3I17A 4MEEA 1MX8A 1N0SA 3P6CA 1VWKB 4GNWA 4XMDA 1KL5A 1SY2A 2L9CA 4Y5DA 1XKIA 1B0OA 1NGLA 4GDAA 4YFRA 4I3BA 2A5BA 2ASNX 2OVSA 1IW2A 3PECA 4U9CA 5F7GA 4GGRA 3RDUA 3UEVA 5IO6A 2N93A 4O3ZA 1BRQA 1STPA 1X8QA 3HPEA 3SZIA 1HBPA 4GJSA 3P6FA 2C4IA 4YBUA 1AVDA 1KT7A 3CKFA 4GH7A 3ZW1B 1SRJA 1YIVA 1YP6A 3P24A 4IRWA 3WJFA 4D6AA 3EMMA 3WYQA 1U17A 3PPTA 4CPHB 3D9WA 1HQQA 1SWAA 1CBSA 2NNQA 4GE1A 2GTLN 5H9NA 5L8IA 4OMXA 4GKCA 4YVBA 4ZHCA 2RTDB 1MEPA 1YWCA 4ZHHA 2GH7A 1SXWA 3EBWA 4AZQA 3HTYA 5LJGA 2GTLM 2O62A 2F09A 3O19A 3PEDA 5K67A 4GD9A 3APUA 5B3MO 3ZW0A 4RUNA 4OEMA 3CKGA 1QWDA 4ZFXA 2ZSCA 4BX7A 3FEKA 1NQNA 1SLFB 4LKTA 3F6ZB 4U8UO 1VWHB 4Y0PA 1LUQA 1Y52X 5B2AO 3PK2A 5D4AA 1I78A 5HA0A 4C5PA 1HBQA 1N43A 1ICMA 2W2FA 1YWDA 4OELA 3NQ9A 4COTA 4BX7B 1BLRA 2X4MA 3GAQA 1N7YA 5AQ6A 1E06A 1TXLA 1YWBA 1FENA 3BRNA 3PH5A 3G7XA 3QKGA 2FT9A 3Q6LA 1DV9A 3WZNA 2DJGA 1SWOA 3GE2A 3HK1A 1GT1A 1T8VA 1RBPA 2MJIA 5HBSA 2ZAGA 3APVA 3STNA 4L3RA 1PEEA 3OD9A 2BSZA 1RSUB
chains in the Genus database with same CATH topology
3FA9A 4ALBA 4UU3A 1TVQA 4IABA 4MISA 4KC7A 2QOSC 1OEEA 1ACDA 3LHNA 1KQXA 1IKJA 2JU8A 3PQSA 4FBRA 5HCCC 2OVAA 1GX9A 3D96A 2M4LA 3FLLA 5B29A 1JZUA 2JMBA 4ZHGA 1U18A 3BSZE 4AZMA 1AVGI 3B2HA 2A3FX 2KW1A 3STKA 5D47A 3E3CA 1EI5A 4YMYA 3BLGA 3PP6A 2ZAIA 1LIDA 1MUPA 2WQAE 1TW4A 4QNIA 1L6MA 1FELA 4KCAA 3VG5A 2MWHA 4MVKA 5HCEC 1O1UA 2IFBA 3TF6A 3WJGA 5LJDA 4D6BA 4YGGA 1LICA 4GNYA 5HZQA 3NBXX 5CE4A 4I3CA 4WBKA 1DF3A 5B27A 4MVIA 2LA7A 4ML7B 4IB8A 2BT9A 2K23A 4O4SA 3CBSA 4YGHA 2LFOA 1B4MA 2AL0X 3UEXA 4GK9A 1O8VA 5FQ7E 2GJ5A 4INNA 3O22A 1GM6A 1EPAA 5C0NA 1OPAA 2XKLA 4MVEA 1PMPA 1KT6A 3CR6A 3NQ3A 1BBPA 3KFGA 4YKOA 4O3XB 4YDAA 2E4JA 4RUUA 1LIFA 3WBGA 5LKEA 2CM9A 3FYFA 1QQSA 4IAXA 4LZVA 4ZGUA 2MO5A 4OMWA 5JR8A 4ES7A 1IKEA 4I3DA 4ZH6A 4A60A 1EIIA 5FQ6E 1AB0A 2WQ9A 3RWXA 1CBRA 1PBOA 4XMHA 1HQPA 1LKEA 2CBSA 3L4RA 5HCDC 3B2KA 5LJKA 4ON1A 2QMIA 1GT4A 1VPRA 1LF7A 2DM5A 2FS6A 3HWFA 2GC9A 4I9RA 4AZNA 1VYGA 1UREA 4BQUA 2BHVA 3WVMA 4GETA 4R0BA 3T1DA 3VU1A 1IFCA 1PM1X 1ZRYA 1ZNLA 2AT3X 1JYDA 2Q9SA 4I95A 1SXYA 4ODDA 1A18A 2LKKA 4IMNA 1X89A 4YH0A 2NNEA 1I06A 4LKPA 2RCQA 2HMBA 3BDRA 5H9LA 3P6HA 5BVSA 2PY1A 1Z24A 4PJ2A 4U3QA 3WJEA 1DZKA 4FBVA 3ZW1A 2L68A 4AZOA 3MVFA 1A2DA 5EDBA 3HOLA 4ORRA 4Y0SA 4QYNA 1OPBA 3NADA 4TNNA 3BX7A 3CWKA 3S60A 4GDZA 2BLGA 3FENA 5KHPA 2YMSA 1EQDA 5H9KA 1QY0A 3ELZA 3APXA 3PQUA 2RN4A 1S44A 1D3SA 1AQBA 3TGAA 1JBHA 5EPQA 4XMEA 1OBUA 4AZRA 3ZI8A 4M7MA 3BU9A 1ICNA 1QFVA 2ALLX 3RSWA 3KFHA 4WHIA 1BSQA 2GTLO 5F6ZA 1QG5A 5DPQA 3MBTA 4BOEA 5HWZA 4QAEA 3NX1A 5H9AA 4ZCBA 4XMFA 1KZXA 2AT6X 2X8SA 4YCHA 2JW1A 3C77X 3UEWA 1CBIA 1JV4A 1U0XA 2NNDA 3VG2A 1IIUA 4AYHA 1DZJA 3VPJE 3LV4A 2X45A 4NLJA 2OVEA 3SOTA 1B56A 4Y0QA 2WEXA 4HWMA 1R0UA 1A3YA 1ZNGA 3FR2A 1JIWI 4IB7A 1YP7A 4L1NA 4ZR2A 3ZZVA 5HZ6A 4OS3A 2BS5A 4QGVA 5HZ9A 3HWEA 1EXSA 2X46A 3CQRA 4O3YA 1Y9TA 3C76X 4KH8A 3VE2A 2XSTA 1X8PA 3P6GA 4KT5A 4TLJA 3WJBA 4ARHA 1QY1A 3B2IA 4ID2A 4TKBA 2AT8X 3FR4A 1YUPA 3ZUOA 2RQ0A 4WFVA 1BRPA 3FA7A 3NX2A 4GU8A 4OS0A 4ORYA 2AMMX 3H3IA 3FR5A 5HTDA 1KGLA 3DSZA 1ALBA 5FFHA 5AJBA 5AEOA 1JJJA 1GT3A 2POAA 4EEJA 2KTSA 4YKMA 1X8UA 1VYFA 4QZUA 4GRJA 3UAQA 5KICA 2A0AA 2AT0X 3FELA 2CBRA 3RKGA 3RZYA 3WOVA 3U0DA 5FQ8E 1HMRA 4N7DA 1O1VA 4BVMA 3ZQ3A 4CSBA 1DFVA 5BVTA 4FBOA 5L8NA 4UU2A 2R56A 3APWA 2LBVA 1EPBA 4I6SA 1FDQA 3S5VA 1LPJA 2RD7C 3F8AA 4O49A 1H91A 3P02A 1P6PA 4YDBA 5FENA 3FA6A 3V8UA 1HMSA 3OE3A 5HTEA 2HZRA 4HFOA 1NP4A 1GT5A 3BY0A 4I9SA 1TOWA 3OJYC 3UEUA 3CMPA 2JN3A 1E5PA 1UZ2X 3PH6A 3VG4A 2YG2A 1QFTA 2FLJA 1OEKA 1KT5A 4ZGFA 3ELXA 5LJEA 5LJCA 2LB6A 1ADLA 2QM9A 1SXXA 3P6EA 4NNTA 5BYPA 2W2BA 2G7BA 1YWAA 5FAZA 2Z4HA 3AKNA 2L5PA 1T68X 2Z4IA 1EW3A 1X8NA 2FWVA 2Q39A 3FW5A 3KQ0A 5BVQA 3RBYA 1DZMA 4IMOA 1SXUA 3K3LA 3NQKA 5D45A 1QY2A 5CYBA 4PSQA 1ZNEA 2FTBA 4O4OA 1LNMA 3VG6A 3WXQA 1G85A 4HPBA 3IA8A 4IB6A 2A2GA 4YFPA 4YBPA 1G74A 1Y9LA 3B2LA 1EIOA 4KIIA 4ORUA 1BEBA 3BX8A 1GKAA 4XMCA 3D4RA 3JQOA 4ZJ0A 2ACPX 3TGBA 1GKAB 5D48A 2AKQA 4YCEA 5EEEA 3HOEA 5EZ2A 4FQBB 1LIBA 3KZAA 5HZ8A 1SA8A 1KT3A 1HN2A 5K06A 2QO4A 5F58A 4CK4A 1GX8A 3FMZA 2Q4NA 1FE3A 4AW8A 1ZNHA 2FR2A 1LFOA 1I05A 4EFGA 1BSOA 1DZPA 2W2AA 3EBKA 4ZHDA 2CM4A 4U8UN 1MVGA 3JS1A 4EQAC 4AZPA 2AH7X 1I04A 2HNXA 3KFFA 2WR6A 1G7NA 5H8TA 2AT5X 1X8OA 4NP1A 3B2JA 3FIQA 4FGIB 1GXAA 5AJCA 4U8UM 1ZNKA 4Y0RA 4QRLA 4HPCA 2MM3A 2OFMX 5IO5A 1KQWA 4NLIA 1SY1A 5HA1A 1JJXA 1ML7A 4IB9A 3ZW2A 3TZSA 3N91A 1IFBA 3STMX 1SMPI 1X71A 2R74A 5F6BA 3ZWEA 2RCTA 3S5XA 1ERXA 4O9SA 1ZNDA 3EM0A 3ZW0B 4O4XA 4QYPA 4ZH9A 1LIEA 1HMTA 3C78X 2A2UA 5IO7A 1CBQA 1KXOA 2NP1A 3VG3A 1S2PA 1E00A 4ALOA 4QZTA 4ORXA 4K19A 1JYJA 4XMGA 2G78A 2OFRX 4MIRA 1EALA 4IBAA 1D2UA 2BS6A 1A57A 3BS2A 2QO5A 2X8TA 3P6DA 3FW4A 1NP1A 3SAOA 4TKJA 4ORSA 4LZUA 2HLVA 2FRSA 2WSJA 4EXZA 2OZQA 3CQNA 4QGWA 3IFBA 1CRBA 4DQ4A 1OBPA 4QGXA 3NP1A 3BU1A 4ZHFA 4NYRA 1T0VA 1FTPA 2QO6A 1S7DA 4N7CA 1MX7A 2RA6A 4GZVA 4WFUA 3F9DA 2KT4B 2X8FA 2HYSA 1B8EA 3CBCA 4A8ZA 2KTDA 1ERBA 2WUTA 3MX7A 3O2YA 5LJHA 4OS8A 4YGZA 3ZUIA 1DC9A 3S26A 1BJ7A 3HWGA 4HPDA 2F73A 2JU3A 4KC8A 4NNSA 5LKFA 5EEDA 3AKMA 1SY3A 5DG4A 2GTFX 1KOIA 2JU7A 1TOUA 2HZQA 3OBLA 2Q2PA 3KFIA 3VG7A 4NYQA 1RLBE 4HPAA 3NPOA 3I0AA 1KZWA 4M6SA 3FA8A 2A13A 2ANSA 2EU7X 2ACOA 2L67A 1GGLA 4O4UA 3D95A 4ORWA 4YFQA 1EUOA 4A1HA 2FR3A 5LJBA 5D8JA 5KIDA 2WEWA 5EDCA 4TQ2A 3HWDA 2JOZA 2G79A 3DTQA 3EYCA 4MVLA 1AELA 1QABE 3WJCA 1BSYA 3U03A 2OVDA 3NR3A 4O3WA 2P8GA 4TKHA 3TGCA 3U9PC 2Q2MA 1KT4A 4LQZA 1SY0A 3WJDA 4IAWA 2FS7A 5F1EA 5HZ5A 1BM5A 2WWPA 2R73A 4A1YA 1CJ5A 1FEMA 2KD2A 2MHDA 2CZTA 5L8OA 1G5WA 1XCAA 4JGLA 3D97A 4DQ3A 2K62A 4NW4A 5HAEA 3VE1A 3JSQA 2CZUA 3FEPA 1I4UA 4EDEA 1MDCA 1OBQA 4QQ1A 1E02A 4CV7A 2LBAA 1OEJA 4TJZA 3I17A 1MX8A 1N0SA 3P6CA 4GNWA 4XMDA 4YFRA 1SY2A 2L9CA 1XKIA 1B0OA 1NGLA 4I3BA 2ASNX 3PECA 2OVSA 1IW2A 4U9CA 5F7GA 5IO6A 1BWYA 3UEVA 2N93A 4O3ZA 1BRQA 1X8QA 1HBPA 3P6FA 4YBUA 1KT7A 4GH7A 3ZW1B 1YP6A 1YIVA 3P24A 3WJFA 4D6AA 3EMMA 1U17A 3PPTA 1CBSA 2NNQA 4GE1A 2GTLN 5H9NA 5L8IA 4OMXA 4GKCA 4ZHCA 1YWCA 4ZHHA 1SXWA 3EBWA 4AZQA 3HTYA 5LJGA 2GTLM 2O62A 2F09A 3O19A 3PEDA 3APUA 3ZW0A 4RUNA 1QWDA 4ZFXA 3FEKA 4LKTA 4U8UO 3F6ZB 4Y0PA 5D4AA 5HA0A 1HBQA 2W2FA 1ICMA 1YWDA 4COTA 3NQ9A 1BLRA 3GAQA 5AQ6A 1E06A 1TXLA 1YWBA 1FENA 3BRNA 3PH5A 3G7XA 3QKGA 2FT9A 3Q6LA 1DV9A 3GE2A 3HK1A 5HBSA 1GT1A 1T8VA 2MJIA 1RBPA 2ZAGA 3APVA 3STNA 4L3RA 1PEEA 3OD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FA9 A;  4ALB A;  4UU3 A;  1TVQ A;  2QOS C;  1OEE A;  1ACD A;  1KQX A;  1IKJ A;  2JU8 A;  5HCC C;  2OVA A;  1GX9 A;  3D96 A;  3FLL A;  5B29 A;  1JZU A;  4ZHG A;  1U18 A;  3BSZ E;  4AZM A;  1AVG I;  3B2H A;  2A3F X;  3STK A;  5D47 A;  4YMY A;  3BLG A;  3PP6 A;  1LID A;  1MUP A;  2WQA E;  1TW4 A;  1L6M A;  1FEL A;  3VG5 A;  5HCE C;  4MVK A;  1O1U A;  2IFB A;  3TF6 A;  3WJG A;  5LJD A;  4D6B A;  4YGG A;  1LIC A;  4GNY A;  5HZQ A;  5CE4 A;  4I3C A;  4WBK A;  1DF3 A;  5B27 A;  4MVI A;  4IB8 A;  1B4M A;  2K23 A;  3CBS A;  4YGH A;  2LFO A;  2AL0 X;  3UEX A;  1O8V A;  2GJ5 A;  3O22 A;  1GM6 A;  1EPA A;  5C0N A;  1OPA A;  2XKL A;  1PMP A;  1KT6 A;  3CR6 A;  3NQ3 A;  1BBP A;  3KFG A;  4YKO A;  4YDA A;  2E4J A;  4RUU A;  1LIF A;  3WBG A;  5LKE A;  2CM9 A;  1QQS A;  4IAX A;  4LZV A;  4ZGU A;  2MO5 A;  4OMW A;  5JR8 A;  4ES7 A;  1IKE A;  4I3D A;  4ZH6 A;  4A60 A;  1EII A;  1AB0 A;  2WQ9 A;  1CBR A;  1PBO A;  4XMH A;  1HQP A;  1LKE A;  2CBS A;  3L4R A;  5HCD C;  3B2K A;  5LJK A;  1GT4 A;  1VPR A;  1LF7 A;  2DM5 A;  2FS6 A;  3HWF A;  2GC9 A;  4I9R A;  4AZN A;  1VYG A;  1URE A;  4BQU A;  3WVM A;  4GET A;  4R0B A;  3T1D A;  1IFC A;  1PM1 X;  1ZRY A;  1ZNL A;  2AT3 X;  1JYD A;  2Q9S A;  1SXY A;  4ODD A;  1A18 A;  2LKK A;  4IMN A;  1X89 A;  4YH0 A;  2NNE A;  1I06 A;  4LKP A;  2RCQ A;  2HMB A;  3BDR A;  5H9L A;  3P6H A;  5BVS A;  2PY1 A;  1Z24 A;  3WJE A;  1DZK A;  2L68 A;  4AZO A;  3MVF A;  1A2D A;  5EDB A;  4ORR A;  4Y0S A;  4QYN A;  1OPB A;  3NAD A;  4TNN A;  3BX7 A;  3CWK A;  2BLG A;  3FEN A;  5KHP A;  1EQD A;  5H9K A;  1QY0 A;  3ELZ A;  3APX A;  1S44 A;  1D3S A;  1AQB A;  3TGA A;  1JBH A;  5EPQ A;  4XME A;  1OBU A;  4AZR A;  4M7M A;  3BU9 A;  1ICN A;  1QFV A;  2ALL X;  3RSW A;  3KFH A;  1BSQ A;  5F6Z A;  1QG5 A;  5DPQ A;  3MBT A;  4BOE A;  5HWZ A;  4QAE A;  3NX1 A;  5H9A A;  4ZCB A;  4XMF A;  1KZX A;  2AT6 X;  4YCH A;  3C77 X;  3UEW A;  1CBI A;  1JV4 A;  1U0X A;  2NND A;  3VG2 A;  1IIU A;  4AYH A;  1DZJ A;  2X45 A;  4NLJ A;  2OVE A;  1B56 A;  4Y0Q A;  2WEX A;  1R0U A;  1A3Y A;  1ZNG A;  3FR2 A;  4IB7 A;  5HZ6 A;  1YP7 A;  4ZR2 A;  4OS3 A;  5HZ9 A;  4QGV A;  3HWE A;  1EXS A;  2X46 A;  3CQR A;  3C76 X;  2XST A;  1X8P A;  3P6G A;  4TLJ A;  3WJB A;  4ARH A;  1QY1 A;  3B2I A;  4TKB A;  2AT8 X;  3FR4 A;  1YUP A;  3ZUO A;  2RQ0 A;  4WFV A;  1BRP A;  3FA7 A;  3NX2 A;  4OS0 A;  4ORY A;  2AMM X;  3FR5 A;  5HTD A;  1KGL A;  3DSZ A;  1ALB A;  5FFH A;  1JJJ A;  1GT3 A;  2POA A;  4EEJ A;  4YKM A;  1X8U A;  1VYF A;  4QZU A;  4GRJ A;  5KIC A;  2A0A A;  2AT0 X;  3FEL A;  2CBR A;  3U0D A;  3RZY A;  1HMR A;  4N7D A;  1O1V A;  4BVM A;  3ZQ3 A;  1DFV A;  5BVT A;  5L8N A;  4UU2 A;  2R56 A;  3APW A;  2LBV A;  1EPB A;  1FDQ A;  1LPJ A;  2RD7 C;  3F8A A;  1H91 A;  1P6P A;  4YDB A;  5FEN A;  3FA6 A;  1HMS A;  5HTE A;  2HZR A;  4HFO A;  1NP4 A;  1GT5 A;  3BY0 A;  4I9S A;  1TOW A;  3OJY C;  3UEU A;  3CMP A;  2JN3 A;  1E5P A;  1UZ2 X;  3PH6 A;  3VG4 A;  2YG2 A;  1QFT A;  2FLJ A;  1OEK A;  1KT5 A;  3ELX A;  5LJE A;  5LJC A;  2LB6 A;  1ADL A;  2QM9 A;  1SXX A;  3P6E A;  4NNT A;  2W2B A;  2G7B A;  1YWA A;  5FAZ A;  3AKN A;  2L5P A;  1T68 X;  1EW3 A;  1X8N A;  2Q39 A;  2FWV A;  3FW5 A;  3KQ0 A;  5BVQ A;  1DZM A;  4IMO A;  1SXU A;  3K3L A;  5D45 A;  1QY2 A;  4PSQ A;  1ZNE A;  2FTB A;  1LNM A;  3VG6 A;  3WXQ A;  1G85 A;  4HPB A;  3IA8 A;  4IB6 A;  2A2G A;  4YFP A;  4YBP A;  1G74 A;  3B2L A;  1EIO A;  4KII A;  4ORU A;  1BEB A;  3BX8 A;  1GKA A;  4XMC A;  4ZJ0 A;  2ACP X;  3TGB A;  1GKA B;  5D48 A;  2AKQ A;  4YCE A;  5EEE A;  5EZ2 A;  1LIB A;  3KZA A;  5HZ8 A;  1SA8 A;  1KT3 A;  1HN2 A;  5K06 A;  2QO4 A;  5F58 A;  4CK4 A;  1GX8 A;  3FMZ A;  2Q4N A;  1FE3 A;  4AW8 A;  1ZNH A;  2FR2 A;  1LFO A;  1I05 A;  4EFG A;  1BSO A;  1DZP A;  2W2A A;  3EBK A;  4ZHD A;  2CM4 A;  1MVG A;  3JS1 A;  4AZP A;  2AH7 X;  1I04 A;  2HNX A;  3KFF A;  2WR6 A;  1G7N A;  5H8T A;  2AT5 X;  1X8O A;  4NP1 A;  3B2J A;  3FIQ A;  1GXA A;  1ZNK A;  4Y0R A;  4HPC A;  2MM3 A;  2OFM X;  5IO5 A;  1KQW A;  4NLI A;  1SY1 A;  5HA1 A;  1JJX A;  1ML7 A;  4IB9 A;  3TZS A;  1IFB A;  3STM X;  1X71 A;  2R74 A;  5F6B A;  2RCT A;  1ERX A;  4O9S A;  1ZND A;  3EM0 A;  4QYP A;  4ZH9 A;  1LIE A;  1HMT A;  3C78 X;  2A2U A;  5IO7 A;  1CBQ A;  1KXO A;  2NP1 A;  3VG3 A;  1S2P A;  1E00 A;  4ALO A;  4QZT A;  4ORX A;  4K19 A;  1JYJ A;  4XMG A;  2G78 A;  2OFR X;  1EAL A;  4IBA A;  1D2U A;  1A57 A;  3BS2 A;  2QO5 A;  3P6D A;  3FW4 A;  1NP1 A;  3SAO A;  4TKJ A;  4ORS A;  4LZU A;  2HLV A;  2FRS A;  2WSJ A;  4EXZ A;  2OZQ A;  3CQN A;  4QGW A;  3IFB A;  1CRB A;  4DQ4 A;  1OBP A;  4QGX A;  3NP1 A;  3BU1 A;  4ZHF A;  4NYR A;  1T0V A;  1FTP A;  2QO6 A;  1S7D A;  4N7C A;  1MX7 A;  2RA6 A;  4WFU A;  3F9D A;  2KT4 B;  2HYS A;  1B8E A;  3CBC A;  2KTD A;  1ERB A;  2WUT A;  3O2Y A;  5LJH A;  4OS8 A;  4YGZ A;  3ZUI A;  1DC9 A;  3S26 A;  1BJ7 A;  3HWG A;  4HPD A;  2F73 A;  2JU3 A;  4NNS A;  5LKF A;  5EED A;  3AKM A;  1SY3 A;  5DG4 A;  2GTF X;  1KOI A;  2JU7 A;  1TOU A;  2HZQ A;  2Q2P A;  3KFI A;  3VG7 A;  4NYQ A;  1RLB E;  4HPA A;  3NPO A;  3I0A A;  1KZW A;  4M6S A;  3FA8 A;  2A13 A;  2ANS A;  2EU7 X;  2ACO A;  2L67 A;  1GGL A;  4ORW A;  3D95 A;  4A1H A;  4YFQ A;  1EUO A;  4A8Z A;  2FR3 A;  5LJB A;  5D8J A;  5KID A;  2WEW A;  5EDC A;  4TQ2 A;  3HWD A;  2JOZ A;  2G79 A;  3DTQ A;  3EYC A;  4MVL A;  1AEL A;  1QAB E;  3WJC A;  1BSY A;  3U03 A;  2OVD A;  3NR3 A;  3TGC A;  2P8G A;  4TKH A;  3U9P C;  2Q2M A;  1KT4 A;  1SY0 A;  3WJD A;  4IAW A;  2FS7 A;  5F1E A;  5HZ5 A;  1BM5 A;  2WWP A;  2R73 A;  4A1Y A;  1CJ5 A;  1FEM A;  5L8O A;  2CZT A;  1G5W A;  1XCA A;  3D97 A;  4DQ3 A;  2K62 A;  5HAE A;  3JSQ A;  2CZU A;  3FEP A;  1I4U A;  4EDE A;  1MDC A;  1OBQ A;  1E02 A;  2LBA A;  1OEJ A;  4TJZ A;  3I17 A;  1MX8 A;  1N0S A;  3P6C A;  4GNW A;  4XMD A;  4YFR A;  1SY2 A;  2L9C A;  1XKI A;  1B0O A;  1NGL A;  4I3B A;  2ASN X;  3PEC A;  5F7G A;  1IW2 A;  5IO6 A;  1BWY A;  3UEV A;  2N93 A;  1BRQ A;  1X8Q A;  1HBP A;  3P6F A;  4YBU A;  1KT7 A;  4GH7 A;  4D6A A;  1YP6 A;  1YIV A;  3WJF A;  3EMM A;  1U17 A;  3PPT A;  1CBS A;  2NNQ A;  4GE1 A;  5H9N A;  5L8I A;  4OMX A;  4GKC A;  4ZHC A;  1YWC A;  4ZHH A;  1SXW A;  3EBW A;  4AZQ A;  5LJG A;  2O62 A;  3O19 A;  3PED A;  3APU A;  4RUN A;  1QWD A;  4ZFX A;  3FEK A;  4LKT A;  4Y0P A;  5D4A A;  5HA0 A;  1HBQ A;  2W2F A;  1ICM A;  1YWD A;  3NQ9 A;  1BLR A;  3GAQ A;  5AQ6 A;  1E06 A;  1TXL A;  1YWB A;  1FEN A;  3BRN A;  3PH5 A;  3G7X A;  3QKG A;  2FT9 A;  3Q6L A;  1DV9 A;  3HK1 A;  1GT1 A;  1T8V A;  2MJI A;  1RBP A;  3APV A;  3STN A;  1PEE A;  5HBS A; 
#chains in the Genus database with same CATH topology
 1VWL B;  3FA9 A;  1VWD B;  4ALB A;  4UU3 A;  1LDQ A;  1MK5 A;  1TVQ A;  1VWI B;  4IAB A;  4KC7 A;  4MIS A;  5B5F A;  2AVI A;  2QOS C;  1OEE A;  1LCZ A;  1ACD A;  3LHN A;  1KQX A;  3RDQ A;  2RTC B;  3FID A;  1IKJ A;  2IZJ A;  2JU8 A;  3PQS A;  4FBR A;  3WZO A;  5HCC C;  1SLE B;  1GX9 A;  2OVA A;  1SWF A;  2M4L A;  3D96 A;  3FLL A;  4NV7 A;  5B29 A;  4CPF A;  1JZU A;  2JMB A;  4BBO A;  4ZHG A;  1U18 A;  1E2T A;  1LDO A;  3BSZ E;  4AZM A;  1AVG I;  3B2H A;  2A3F X;  2KW1 A;  3STK A;  5D47 A;  1VWR B;  3E3C A;  1EI5 A;  4YMY A;  3BLG A;  3PP6 A;  2ZAI A;  1LID A;  1MUP A;  1W5R A;  2WQA E;  2WPU A;  1TW4 A;  4QNI A;  1L6M A;  1FEL A;  4KCA A;  2FHL A;  3VG5 A;  2MWH A;  4MVK A;  5HCE C;  4DNE A;  1O1U A;  2IFB A;  5B5G A;  2IZD B;  3TF6 A;  3WJG A;  5LJD A;  4D6B A;  4YGG A;  1LIC A;  4GNY A;  2HKD A;  5HZQ A;  3NBX X;  5CE4 A;  4I3C A;  4WBK A;  1DF3 A;  1SRF A;  4MVI A;  5B27 A;  1SRI A;  2LA7 A;  4ML7 B;  4IB8 A;  2BT9 A;  2K23 A;  4O4S A;  3CBS A;  4YGH A;  2LFO A;  1B4M A;  1VWP B;  2MF6 A;  2AL0 X;  1UYN X;  2OFB A;  3UEX A;  4GK9 A;  1O8V A;  5FQ7 E;  2GJ5 A;  4INN A;  3O22 A;  1GM6 A;  1EPA A;  2OF9 A;  1OPA A;  1RXK A;  2XKL A;  4MVE A;  1SWB A;  1PMP A;  5C0N A;  1KT6 A;  3CR6 A;  3NQ3 A;  1BBP A;  3KFG A;  4YKO A;  2I5V O;  4O3X B;  2E4J A;  4YDA A;  5IRU A;  5JD2 A;  4GUZ A;  4RUU A;  2RTF B;  2OL7 A;  1LIF A;  3WBG A;  5LKE A;  2CM9 A;  3FYF A;  1QQS A;  4IAX A;  4LZV A;  4ZGU A;  2MO5 A;  4OMW A;  5JR8 A;  4ES7 A;  3WZQ A;  1IKE A;  4I3D A;  4ZH6 A;  4A60 A;  1EII A;  5FQ6 E;  1AB0 A;  2WQ9 A;  3RWX A;  1CBR A;  1PBO A;  4XMH A;  3T2W A;  1HQP A;  1LKE A;  1VWB B;  2CBS A;  3L4R A;  4Z6J A;  3SLT A;  5HCD C;  3B2K A;  5CHK A;  5LJK A;  4ON1 A;  2QMI A;  1GT4 A;  1VPR A;  1LF7 A;  2DM5 A;  2RTE B;  2FS6 A;  3HWF A;  1STR B;  1FJ1 E;  2GC9 A;  4I9R A;  4AZN A;  1VYG A;  1URE A;  4BQU A;  2JGS A;  2BHV A;  3MG5 A;  3WVM A;  4GET A;  4R0B A;  3T1D A;  3VU1 A;  1IFC A;  1PM1 X;  1RXJ A;  1ZNL A;  1ZRY A;  1JYD A;  2AT3 X;  2Q9S A;  4I95 A;  1SXY A;  3RDX A;  4ODD A;  1A18 A;  1LCW A;  4Z28 A;  2LKK A;  4IMN A;  1X89 A;  2G8C O;  4YH0 A;  2IZA A;  2NNE A;  1I06 A;  4LKP A;  2RCQ A;  2HMB A;  3BDR A;  2OL8 O;  5H9L A;  3P6H A;  5BVS A;  2PY1 A;  1Z24 A;  4PJ2 A;  4U3Q A;  3WJE A;  1DZK A;  4FBV A;  3ZW1 A;  2L68 A;  4AZO A;  2IZB A;  3EW1 A;  3MVF A;  3RDM A;  3QQ2 A;  1A2D A;  4CPH A;  5EDB A;  2QOM A;  3SLO A;  1LCV A;  1SWK A;  3HOL A;  4ORR A;  3T2X A;  4Y0S A;  4QYN A;  1OPB A;  3NAD A;  4TNN A;  1DF8 A;  3BX7 A;  2RTL A;  3CWK A;  2IZF B;  2FGS A;  2IZE B;  2OY1 O;  3S60 A;  4GDZ A;  2BLG A;  3FEN A;  5KHP A;  2YMS A;  1EQD A;  2RTI B;  5H9K A;  1QY0 A;  1SWD A;  3ELZ A;  3APX A;  3PQU A;  1K24 A;  2RN4 A;  1S44 A;  1D3S A;  1AQB A;  1SWT A;  3AUM O;  1SWL A;  3KVN A;  3TGA A;  1JBH A;  2DJF A;  2FHN X;  5EPQ A;  4XME A;  1OBU A;  4AZR A;  3ZI8 A;  4M7M A;  3BU9 A;  2RTK A;  1ICN A;  1QFV A;  2ALL X;  3RDO A;  3RSW A;  3KFH A;  4WHI A;  1BSQ A;  2GTL O;  3AEH A;  5F6Z A;  1QG5 A;  5DPQ A;  1WBI A;  3MBT A;  2IZI A;  4BOE A;  2BC3 A;  5HWZ A;  4QAE A;  3NX1 A;  4A1H A;  5H9A A;  1VWM B;  1VWQ B;  4ZCB A;  4XMF A;  2OF8 A;  2PI3 O;  1KZX A;  1N9Y A;  2AT6 X;  2X8S A;  4YCH A;  2JW1 A;  3C77 X;  2FKJ A;  3UEW A;  1CBI A;  1JV4 A;  1SWU A;  1U0X A;  2NND A;  4JO6 A;  3VG2 A;  1IIU A;  4AYH A;  1DZJ A;  3VPJ E;  3LV4 A;  2RTR B;  2X45 A;  2OVE A;  4NLJ A;  3WYP A;  3SOT A;  1B56 A;  4Y0Q A;  2WEX A;  4HWM A;  1R0U A;  2RTQ B;  1A3Y A;  1ZNG A;  3FR2 A;  1JIW I;  4IB7 A;  1YP7 A;  4L1N A;  4ZR2 A;  3ZZV A;  5HZ6 A;  4OS3 A;  2VDF A;  2BS5 A;  4QGV A;  5HZ9 A;  3HWE A;  1EXS A;  2X46 A;  3CQR A;  4O3Y A;  1Y9T A;  3C76 X;  4KH8 A;  3VE2 A;  2A5C A;  2XST A;  3PDF A;  1X8P A;  2VFC A;  1KL3 A;  3P6G A;  4KT5 A;  4TLJ A;  3WJB A;  4ARH A;  1VWC B;  4JNJ A;  1QY1 A;  3B2I A;  3T6L A;  4ID2 A;  3RE6 A;  2OFA A;  4TKB A;  2IZK A;  2AT8 X;  1SLD B;  3FR4 A;  4Z2V A;  5IRW A;  3RDS A;  1YUP A;  3ZUO A;  1W6F A;  2OYB O;  2RQ0 A;  4JHQ A;  4WFV A;  1BRP A;  3FA7 A;  3NX2 A;  4GU8 A;  4OS0 A;  4ORY A;  2G5L A;  2AMM X;  2UZ2 A;  3H3I A;  1VWN B;  3FR5 A;  3RE5 A;  5HTD A;  2RTB B;  1KGL A;  1VWA B;  3DSZ A;  1ALB A;  5FFH A;  5AJB A;  5AEO A;  2UYW A;  1GT3 A;  2POA A;  1JJJ A;  5B10 O;  4EEJ A;  2KTS A;  4YKM A;  1X8U A;  1VYF A;  4QZU A;  4GRJ A;  3UAQ A;  5KIC A;  2A0A A;  2AT0 X;  3FEL A;  2CBR A;  2Y32 A;  5F2B A;  3RKG A;  3RZY A;  3WOV A;  5FQ8 E;  4CDC A;  1HMR A;  3U0D A;  4N7D A;  1O1V A;  4BVM A;  3ZQ3 A;  1VWE B;  4CSB A;  1DFV A;  2I5Z O;  5BVT A;  4FBO A;  5L8N A;  4UU2 A;  2R56 A;  3APW A;  2LBV A;  1EPB A;  4I6S A;  1FDQ A;  4OKA A;  3S5V A;  1LPJ A;  2RD7 C;  3F8A A;  2IZH B;  4GGZ A;  2VFB A;  1H91 A;  1VWO B;  3P02 A;  1P6P A;  4O49 A;  4YDB A;  5FEN A;  3FA6 A;  3V8U A;  1HMS A;  3OE3 A;  5HTE A;  2HZR A;  4HFO A;  1VWJ B;  1NP4 A;  1GT5 A;  3BY0 A;  4I9S A;  1TOW A;  3OJY C;  3UEU A;  4CDE A;  3CMP A;  2JN3 A;  1E5P A;  1UZ2 X;  3PH6 A;  3SZH A;  2YG2 A;  3VG4 A;  1HY2 A;  1QFT A;  2FLJ A;  5L3Y A;  1OEK A;  1KT5 A;  4ZGF A;  3ELX A;  5LJE A;  5LJC A;  2LB6 A;  2RTJ A;  1WUB A;  1ADL A;  2QM9 A;  5K68 A;  1SXX A;  3P6E A;  4BX5 A;  4NNT A;  5BYP A;  2W2B A;  2G7B A;  1YWA A;  2X34 A;  5FAZ A;  2Z4H A;  3AKN A;  2L5P A;  1T68 X;  2Z4I A;  1EW3 A;  4Z2O A;  1X8N A;  2FWV A;  2Q39 A;  4BX5 B;  3FW5 A;  3KQ0 A;  5BVQ A;  3RBY A;  1K3B A;  1DZM A;  4CPI A;  3T6F A;  2RTM A;  4IMO A;  1SXU A;  3K3L A;  3NQK A;  5D45 A;  4Z27 A;  1QY2 A;  5CYB A;  4PSQ A;  1ZNE A;  2FTB A;  4O4O A;  1LNM A;  3SLJ A;  3VG6 A;  3WXQ A;  1G85 A;  1SRE A;  1SWG A;  1SWS A;  4HPB A;  1KFF A;  1LEL A;  3IA8 A;  1SWJ A;  4IB6 A;  2A2G A;  4YFP A;  4YBP A;  1G74 A;  3RY2 A;  1Y9L A;  3B2L A;  2OY8 A;  1EIO A;  4KII A;  3MM0 A;  4ORU A;  1VYO A;  1BEB A;  3BX8 A;  1VWG B;  1GKA A;  4CDD A;  3LTW A;  4XMC A;  4Z2P A;  3D4R A;  1N9M A;  3JQO A;  4BJ8 A;  4ZJ0 A;  1PTS A;  2ACP X;  2X32 A;  1JMX A;  3FDC A;  4GGT A;  3TGB A;  5CSE A;  1UYO X;  1GKA B;  5D48 A;  4CPE A;  2AKQ A;  4YCE A;  1OSP O;  5EEE A;  4Y59 A;  3HOE A;  5EZ2 A;  4FQB B;  1W4T A;  1LIB A;  3KZA A;  5HZ8 A;  1SA8 A;  2RTA A;  1KT3 A;  1HN2 A;  5K06 A;  2QO4 A;  5F58 A;  4CK4 A;  1GX8 A;  1HXZ A;  3FMZ A;  2Q4N A;  1FE3 A;  2RTO B;  1ZNH A;  2FR2 A;  4AW8 A;  1LFO A;  1I05 A;  4EFG A;  1BSO A;  1DZP A;  2W2A A;  1IJ8 A;  1SLG B;  3EBK A;  4ZHD A;  2CM4 A;  4U8U N;  1MVG A;  3JS1 A;  4EQA C;  1STS B;  4AZP A;  2AH7 X;  1I04 A;  2HNX A;  3KFF A;  2WR6 A;  1G7N A;  1NQM A;  5H8T A;  2AT5 X;  1X8O A;  4NP1 A;  3B2J A;  3FIQ A;  1BWY A;  1KL4 A;  1GXA A;  4FGI B;  5AJC A;  4U8U M;  5LJH A;  1ZNK A;  4Y0R A;  1RXH A;  4QRL A;  4HPC A;  2MM3 A;  2OFM X;  5IO5 A;  1KQW A;  4NLI A;  1SY1 A;  1VWF B;  5HA1 A;  1SWN A;  1JJX A;  1ML7 A;  2C1Q A;  4IB9 A;  3ZW2 A;  2Y3E A;  3TZS A;  1PBY A;  1IFB A;  3N91 A;  3STM X;  1SMP I;  1X71 A;  2R74 A;  5F6B A;  3ZWE A;  2RCT A;  2RTP B;  3S5X A;  1ERX A;  1RAV A;  4O9S A;  1ZND A;  3EM0 A;  4GJV A;  3VGW A;  4O4X A;  3X00 A;  4QYP A;  4ZH9 A;  1LIE A;  1AVE A;  3ZW0 B;  1HMT A;  3C78 X;  2CAM A;  2A2U A;  4U46 A;  4DCB A;  5IO7 A;  1CBQ A;  1KXO A;  2NP1 A;  3VG3 A;  1S2P A;  1E00 A;  4ALO A;  4QZT A;  4ORX A;  4K19 A;  2C1S A;  1JYJ A;  1NDJ A;  2G78 A;  2OFR X;  1SWH A;  4MIR A;  4XMG A;  1EAL A;  4IBA A;  4I60 A;  1D2U A;  2BS6 A;  1A57 A;  3BS2 A;  1SWQ A;  2QO5 A;  2X8T A;  3P6D A;  3FW4 A;  1NP1 A;  3SAO A;  4TKJ A;  4ORS A;  4LZU A;  2HLV A;  2FRS A;  1JJU A;  2QCB A;  4BCS A;  2IZL B;  2WSJ A;  4EXZ A;  2OZQ A;  3CQN A;  4QGW A;  3IFB A;  1CRB A;  4DQ4 A;  1OBP A;  1NBX A;  1HXL A;  1SRG A;  2RTN B;  3BU1 A;  1JMZ A;  3NP1 A;  4QGX A;  4ZHF A;  4NYR A;  1T0V A;  1FTP A;  2IZC B;  1S7D A;  2F01 A;  2QO6 A;  2X55 A;  4N7C A;  1MX7 A;  2RA6 A;  4GZV A;  2OY5 O;  3VHH A;  4WFU A;  3F9D A;  2KT4 B;  2X8F A;  4BX6 A;  2HYS A;  1B8E A;  3EC5 A;  3CBC A;  4A8Z A;  2KTD A;  1ERB A;  2WUT A;  2Y3F A;  3MX7 A;  3O2Y A;  3EW2 A;  4OS8 A;  4YGZ A;  3ZUI A;  1DC9 A;  3S26 A;  1BJ7 A;  3HWG A;  4HPD A;  1MOY A;  2F73 A;  2JU3 A;  4KC8 A;  4NNS A;  5EED A;  1JQP A;  1SY3 A;  3AKM A;  5DG4 A;  5LKF A;  4BX6 B;  2GTF X;  1KOI A;  1MM9 A;  1Y53 X;  2JU7 A;  1SWE A;  1TOU A;  2FKG A;  2HZQ A;  2OY7 A;  3OBL A;  4CDF A;  2Q2P A;  3KFI A;  3VG7 A;  4NYQ A;  1RLB E;  4HPA A;  3NPO A;  3I0A A;  1KZW A;  4M6S A;  3FA8 A;  1SWP A;  2A13 A;  2ANS A;  2EU7 X;  2ACO A;  2L67 A;  1GGL A;  4O4U A;  3D95 A;  1SWC A;  1RST B;  1EUO A;  4ORW A;  4YFQ A;  2FR3 A;  2RTH B;  2X56 A;  3Q34 A;  5D8J A;  5LJB A;  5KID A;  2WEW A;  5EDC A;  4TQ2 A;  3HWD A;  2JOZ A;  1SRH A;  4NV8 A;  3WZP A;  1GX3 A;  2G79 A;  3DTQ A;  3EYC A;  4MVL A;  1AEL A;  1QAB E;  3WJC A;  1BSY A;  1Y0G A;  3U03 A;  2OVD A;  3NR3 A;  4O3W A;  2P8G A;  4TKH A;  3VHI A;  3U9P C;  3RY1 A;  2Q2M A;  3TGC A;  1I9H A;  1KT4 A;  4LQZ A;  1SY0 A;  3WJD A;  5IXG A;  4IAW A;  2FS7 A;  5F1E A;  5HZ5 A;  4BGF A;  1BM5 A;  2WWP A;  1NC9 A;  2R73 A;  4A1Y A;  1CJ5 A;  1FEM A;  2KD2 A;  3VHM A;  1N4J A;  3SZJ A;  2MHD A;  2CZT A;  5L8O A;  1G5W A;  1XCA A;  5B11 O;  4JGL A;  3D97 A;  4DQ3 A;  2IZG B;  2K62 A;  4NW4 A;  5HAE A;  1SWR A;  3JSQ A;  3VE1 A;  1Y55 X;  2RTG B;  2CZU A;  3FEP A;  4EKV A;  1I4U A;  2AF5 A;  2OL6 O;  4B55 A;  1MDC A;  1OBQ A;  4EDE A;  4QQ1 A;  1E02 A;  4CV7 A;  2LBA A;  1OEJ A;  5IRA A;  4TJZ A;  2A8G A;  3I17 A;  4MEE A;  1MX8 A;  1N0S A;  3P6C A;  1VWK B;  4GNW A;  4XMD A;  1KL5 A;  1SY2 A;  2L9C A;  4Y5D A;  1XKI A;  1B0O A;  1NGL A;  4GDA A;  4YFR A;  4I3B A;  2A5B A;  2ASN X;  2OVS A;  1IW2 A;  3PEC A;  4U9C A;  5F7G A;  4GGR A;  3RDU A;  3UEV A;  5IO6 A;  2N93 A;  4O3Z A;  1BRQ A;  1STP A;  1X8Q A;  3HPE A;  3SZI A;  1HBP A;  4GJS A;  3P6F A;  2C4I A;  4YBU A;  1AVD A;  1KT7 A;  3CKF A;  4GH7 A;  3ZW1 B;  1SRJ A;  1YIV A;  1YP6 A;  3P24 A;  4IRW A;  3WJF A;  4D6A A;  3EMM A;  3WYQ A;  1U17 A;  3PPT A;  4CPH B;  3D9W A;  1HQQ A;  1SWA A;  1CBS A;  2NNQ A;  4GE1 A;  2GTL N;  5H9N A;  5L8I A;  4OMX A;  4GKC A;  4YVB A;  4ZHC A;  2RTD B;  1MEP A;  1YWC A;  4ZHH A;  2GH7 A;  1SXW A;  3EBW A;  4AZQ A;  3HTY A;  5LJG A;  2GTL M;  2O62 A;  2F09 A;  3O19 A;  3PED A;  5K67 A;  4GD9 A;  3APU A;  5B3M O;  3ZW0 A;  4RUN A;  4OEM A;  3CKG A;  1QWD A;  4ZFX A;  2ZSC A;  4BX7 A;  3FEK A;  1NQN A;  1SLF B;  4LKT A;  3F6Z B;  4U8U O;  1VWH B;  4Y0P A;  1LUQ A;  1Y52 X;  5B2A O;  3PK2 A;  5D4A A;  1I78 A;  5HA0 A;  4C5P A;  1HBQ A;  1N43 A;  1ICM A;  2W2F A;  1YWD A;  4OEL A;  3NQ9 A;  4COT A;  4BX7 B;  1BLR A;  2X4M A;  3GAQ A;  1N7Y A;  5AQ6 A;  1E06 A;  1TXL A;  1YWB A;  1FEN A;  3BRN A;  3PH5 A;  3G7X A;  3QKG A;  2FT9 A;  3Q6L A;  1DV9 A;  3WZN A;  2DJG A;  1SWO A;  3GE2 A;  3HK1 A;  1GT1 A;  1T8V A;  1RBP A;  2MJI A;  5HBS A;  2ZAG A;  3APV A;  3STN A;  4L3R A;  1PEE A;  3OD9 A;  2BSZ A;  1RSU B; 
#chains in the Genus database with same CATH homology
 3FA9 A;  4ALB A;  4UU3 A;  1TVQ A;  4IAB A;  4MIS A;  4KC7 A;  2QOS C;  1OEE A;  1ACD A;  3LHN A;  1KQX A;  1IKJ A;  2JU8 A;  3PQS A;  4FBR A;  5HCC C;  2OVA A;  1GX9 A;  3D96 A;  2M4L A;  3FLL A;  5B29 A;  1JZU A;  2JMB A;  4ZHG A;  1U18 A;  3BSZ E;  4AZM A;  1AVG I;  3B2H A;  2A3F X;  2KW1 A;  3STK A;  5D47 A;  3E3C A;  1EI5 A;  4YMY A;  3BLG A;  3PP6 A;  2ZAI A;  1LID A;  1MUP A;  2WQA E;  1TW4 A;  4QNI A;  1L6M A;  1FEL A;  4KCA A;  3VG5 A;  2MWH A;  4MVK A;  5HCE C;  1O1U A;  2IFB A;  3TF6 A;  3WJG A;  5LJD A;  4D6B A;  4YGG A;  1LIC A;  4GNY A;  5HZQ A;  3NBX X;  5CE4 A;  4I3C A;  4WBK A;  1DF3 A;  5B27 A;  4MVI A;  2LA7 A;  4ML7 B;  4IB8 A;  2BT9 A;  2K23 A;  4O4S A;  3CBS A;  4YGH A;  2LFO A;  1B4M A;  2AL0 X;  3UEX A;  4GK9 A;  1O8V A;  5FQ7 E;  2GJ5 A;  4INN A;  3O22 A;  1GM6 A;  1EPA A;  5C0N A;  1OPA A;  2XKL A;  4MVE A;  1PMP A;  1KT6 A;  3CR6 A;  3NQ3 A;  1BBP A;  3KFG A;  4YKO A;  4O3X B;  4YDA A;  2E4J A;  4RUU A;  1LIF A;  3WBG A;  5LKE A;  2CM9 A;  3FYF A;  1QQS A;  4IAX A;  4LZV A;  4ZGU A;  2MO5 A;  4OMW A;  5JR8 A;  4ES7 A;  1IKE A;  4I3D A;  4ZH6 A;  4A60 A;  1EII A;  5FQ6 E;  1AB0 A;  2WQ9 A;  3RWX A;  1CBR A;  1PBO A;  4XMH A;  1HQP A;  1LKE A;  2CBS A;  3L4R A;  5HCD C;  3B2K A;  5LJK A;  4ON1 A;  2QMI A;  1GT4 A;  1VPR A;  1LF7 A;  2DM5 A;  2FS6 A;  3HWF A;  2GC9 A;  4I9R A;  4AZN A;  1VYG A;  1URE A;  4BQU A;  2BHV A;  3WVM A;  4GET A;  4R0B A;  3T1D A;  3VU1 A;  1IFC A;  1PM1 X;  1ZRY A;  1ZNL A;  2AT3 X;  1JYD A;  2Q9S A;  4I95 A;  1SXY A;  4ODD A;  1A18 A;  2LKK A;  4IMN A;  1X89 A;  4YH0 A;  2NNE A;  1I06 A;  4LKP A;  2RCQ A;  2HMB A;  3BDR A;  5H9L A;  3P6H A;  5BVS A;  2PY1 A;  1Z24 A;  4PJ2 A;  4U3Q A;  3WJE A;  1DZK A;  4FBV A;  3ZW1 A;  2L68 A;  4AZO A;  3MVF A;  1A2D A;  5EDB A;  3HOL A;  4ORR A;  4Y0S A;  4QYN A;  1OPB A;  3NAD A;  4TNN A;  3BX7 A;  3CWK A;  3S60 A;  4GDZ A;  2BLG A;  3FEN A;  5KHP A;  2YMS A;  1EQD A;  5H9K A;  1QY0 A;  3ELZ A;  3APX A;  3PQU A;  2RN4 A;  1S44 A;  1D3S A;  1AQB A;  3TGA A;  1JBH A;  5EPQ A;  4XME A;  1OBU A;  4AZR A;  3ZI8 A;  4M7M A;  3BU9 A;  1ICN A;  1QFV A;  2ALL X;  3RSW A;  3KFH A;  4WHI A;  1BSQ A;  2GTL O;  5F6Z A;  1QG5 A;  5DPQ A;  3MBT A;  4BOE A;  5HWZ A;  4QAE A;  3NX1 A;  5H9A A;  4ZCB A;  4XMF A;  1KZX A;  2AT6 X;  2X8S A;  4YCH A;  2JW1 A;  3C77 X;  3UEW A;  1CBI A;  1JV4 A;  1U0X A;  2NND A;  3VG2 A;  1IIU A;  4AYH A;  1DZJ A;  3VPJ E;  3LV4 A;  2X45 A;  4NLJ A;  2OVE A;  3SOT A;  1B56 A;  4Y0Q A;  2WEX A;  4HWM A;  1R0U A;  1A3Y A;  1ZNG A;  3FR2 A;  1JIW I;  4IB7 A;  1YP7 A;  4L1N A;  4ZR2 A;  3ZZV A;  5HZ6 A;  4OS3 A;  2BS5 A;  4QGV A;  5HZ9 A;  3HWE A;  1EXS A;  2X46 A;  3CQR A;  4O3Y A;  1Y9T A;  3C76 X;  4KH8 A;  3VE2 A;  2XST A;  1X8P A;  3P6G A;  4KT5 A;  4TLJ A;  3WJB A;  4ARH A;  1QY1 A;  3B2I A;  4ID2 A;  4TKB A;  2AT8 X;  3FR4 A;  1YUP A;  3ZUO A;  2RQ0 A;  4WFV A;  1BRP A;  3FA7 A;  3NX2 A;  4GU8 A;  4OS0 A;  4ORY A;  2AMM X;  3H3I A;  3FR5 A;  5HTD A;  1KGL A;  3DSZ A;  1ALB A;  5FFH A;  5AJB A;  5AEO A;  1JJJ A;  1GT3 A;  2POA A;  4EEJ A;  2KTS A;  4YKM A;  1X8U A;  1VYF A;  4QZU A;  4GRJ A;  3UAQ A;  5KIC A;  2A0A A;  2AT0 X;  3FEL A;  2CBR A;  3RKG A;  3RZY A;  3WOV A;  3U0D A;  5FQ8 E;  1HMR A;  4N7D A;  1O1V A;  4BVM A;  3ZQ3 A;  4CSB A;  1DFV A;  5BVT A;  4FBO A;  5L8N A;  4UU2 A;  2R56 A;  3APW A;  2LBV A;  1EPB A;  4I6S A;  1FDQ A;  3S5V A;  1LPJ A;  2RD7 C;  3F8A A;  4O49 A;  1H91 A;  3P02 A;  1P6P A;  4YDB A;  5FEN A;  3FA6 A;  3V8U A;  1HMS A;  3OE3 A;  5HTE A;  2HZR A;  4HFO A;  1NP4 A;  1GT5 A;  3BY0 A;  4I9S A;  1TOW A;  3OJY C;  3UEU A;  3CMP A;  2JN3 A;  1E5P A;  1UZ2 X;  3PH6 A;  3VG4 A;  2YG2 A;  1QFT A;  2FLJ A;  1OEK A;  1KT5 A;  4ZGF A;  3ELX A;  5LJE A;  5LJC A;  2LB6 A;  1ADL A;  2QM9 A;  1SXX A;  3P6E A;  4NNT A;  5BYP A;  2W2B A;  2G7B A;  1YWA A;  5FAZ A;  2Z4H A;  3AKN A;  2L5P A;  1T68 X;  2Z4I A;  1EW3 A;  1X8N A;  2FWV A;  2Q39 A;  3FW5 A;  3KQ0 A;  5BVQ A;  3RBY A;  1DZM A;  4IMO A;  1SXU A;  3K3L A;  3NQK A;  5D45 A;  1QY2 A;  5CYB A;  4PSQ A;  1ZNE A;  2FTB A;  4O4O A;  1LNM A;  3VG6 A;  3WXQ A;  1G85 A;  4HPB A;  3IA8 A;  4IB6 A;  2A2G A;  4YFP A;  4YBP A;  1G74 A;  1Y9L A;  3B2L A;  1EIO A;  4KII A;  4ORU A;  1BEB A;  3BX8 A;  1GKA A;  4XMC A;  3D4R A;  3JQO A;  4ZJ0 A;  2ACP X;  3TGB A;  1GKA B;  5D48 A;  2AKQ A;  4YCE A;  5EEE A;  3HOE A;  5EZ2 A;  4FQB B;  1LIB A;  3KZA A;  5HZ8 A;  1SA8 A;  1KT3 A;  1HN2 A;  5K06 A;  2QO4 A;  5F58 A;  4CK4 A;  1GX8 A;  3FMZ A;  2Q4N A;  1FE3 A;  4AW8 A;  1ZNH A;  2FR2 A;  1LFO A;  1I05 A;  4EFG A;  1BSO A;  1DZP A;  2W2A A;  3EBK A;  4ZHD A;  2CM4 A;  4U8U N;  1MVG A;  3JS1 A;  4EQA C;  4AZP A;  2AH7 X;  1I04 A;  2HNX A;  3KFF A;  2WR6 A;  1G7N A;  5H8T A;  2AT5 X;  1X8O A;  4NP1 A;  3B2J A;  3FIQ A;  4FGI B;  1GXA A;  5AJC A;  4U8U M;  1ZNK A;  4Y0R A;  4QRL A;  4HPC A;  2MM3 A;  2OFM X;  5IO5 A;  1KQW A;  4NLI A;  1SY1 A;  5HA1 A;  1JJX A;  1ML7 A;  4IB9 A;  3ZW2 A;  3TZS A;  3N91 A;  1IFB A;  3STM X;  1SMP I;  1X71 A;  2R74 A;  5F6B A;  3ZWE A;  2RCT A;  3S5X A;  1ERX A;  4O9S A;  1ZND A;  3EM0 A;  3ZW0 B;  4O4X A;  4QYP A;  4ZH9 A;  1LIE A;  1HMT A;  3C78 X;  2A2U A;  5IO7 A;  1CBQ A;  1KXO A;  2NP1 A;  3VG3 A;  1S2P A;  1E00 A;  4ALO A;  4QZT A;  4ORX A;  4K19 A;  1JYJ A;  4XMG A;  2G78 A;  2OFR X;  4MIR A;  1EAL A;  4IBA A;  1D2U A;  2BS6 A;  1A57 A;  3BS2 A;  2QO5 A;  2X8T A;  3P6D A;  3FW4 A;  1NP1 A;  3SAO A;  4TKJ A;  4ORS A;  4LZU A;  2HLV A;  2FRS A;  2WSJ A;  4EXZ A;  2OZQ A;  3CQN A;  4QGW A;  3IFB A;  1CRB A;  4DQ4 A;  1OBP A;  4QGX A;  3NP1 A;  3BU1 A;  4ZHF A;  4NYR A;  1T0V A;  1FTP A;  2QO6 A;  1S7D A;  4N7C A;  1MX7 A;  2RA6 A;  4GZV A;  4WFU A;  3F9D A;  2KT4 B;  2X8F A;  2HYS A;  1B8E A;  3CBC A;  4A8Z A;  2KTD A;  1ERB A;  2WUT A;  3MX7 A;  3O2Y A;  5LJH A;  4OS8 A;  4YGZ A;  3ZUI A;  1DC9 A;  3S26 A;  1BJ7 A;  3HWG A;  4HPD A;  2F73 A;  2JU3 A;  4KC8 A;  4NNS A;  5LKF A;  5EED A;  3AKM A;  1SY3 A;  5DG4 A;  2GTF X;  1KOI A;  2JU7 A;  1TOU A;  2HZQ A;  3OBL A;  2Q2P A;  3KFI A;  3VG7 A;  4NYQ A;  1RLB E;  4HPA A;  3NPO A;  3I0A A;  1KZW A;  4M6S A;  3FA8 A;  2A13 A;  2ANS A;  2EU7 X;  2ACO A;  2L67 A;  1GGL A;  4O4U A;  3D95 A;  4ORW A;  4YFQ A;  1EUO A;  4A1H A;  2FR3 A;  5LJB A;  5D8J A;  5KID A;  2WEW A;  5EDC A;  4TQ2 A;  3HWD A;  2JOZ A;  2G79 A;  3DTQ A;  3EYC A;  4MVL A;  1AEL A;  1QAB E;  3WJC A;  1BSY A;  3U03 A;  2OVD A;  3NR3 A;  4O3W A;  2P8G A;  4TKH A;  3TGC A;  3U9P C;  2Q2M A;  1KT4 A;  4LQZ A;  1SY0 A;  3WJD A;  4IAW A;  2FS7 A;  5F1E A;  5HZ5 A;  1BM5 A;  2WWP A;  2R73 A;  4A1Y A;  1CJ5 A;  1FEM A;  2KD2 A;  2MHD A;  2CZT A;  5L8O A;  1G5W A;  1XCA A;  4JGL A;  3D97 A;  4DQ3 A;  2K62 A;  4NW4 A;  5HAE A;  3VE1 A;  3JSQ A;  2CZU A;  3FEP A;  1I4U A;  4EDE A;  1MDC A;  1OBQ A;  4QQ1 A;  1E02 A;  4CV7 A;  2LBA A;  1OEJ A;  4TJZ A;  3I17 A;  1MX8 A;  1N0S A;  3P6C A;  4GNW A;  4XMD A;  4YFR A;  1SY2 A;  2L9C A;  1XKI A;  1B0O A;  1NGL A;  4I3B A;  2ASN X;  3PEC A;  2OVS A;  1IW2 A;  4U9C A;  5F7G A;  5IO6 A;  1BWY A;  3UEV A;  2N93 A;  4O3Z A;  1BRQ A;  1X8Q A;  1HBP A;  3P6F A;  4YBU A;  1KT7 A;  4GH7 A;  3ZW1 B;  1YP6 A;  1YIV A;  3P24 A;  3WJF A;  4D6A A;  3EMM A;  1U17 A;  3PPT A;  1CBS A;  2NNQ A;  4GE1 A;  2GTL N;  5H9N A;  5L8I A;  4OMX A;  4GKC A;  4ZHC A;  1YWC A;  4ZHH A;  1SXW A;  3EBW A;  4AZQ A;  3HTY A;  5LJG A;  2GTL M;  2O62 A;  2F09 A;  3O19 A;  3PED A;  3APU A;  3ZW0 A;  4RUN A;  1QWD A;  4ZFX A;  3FEK A;  4LKT A;  4U8U O;  3F6Z B;  4Y0P A;  5D4A A;  5HA0 A;  1HBQ A;  2W2F A;  1ICM A;  1YWD A;  4COT A;  3NQ9 A;  1BLR A;  3GAQ A;  5AQ6 A;  1E06 A;  1TXL A;  1YWB A;  1FEN A;  3BRN A;  3PH5 A;  3G7X A;  3QKG A;  2FT9 A;  3Q6L A;  1DV9 A;  3GE2 A;  3HK1 A;  5HBS A;  1GT1 A;  1T8V A;  2MJI A;  1RBP A;  2ZAG A;  3APV A;  3STN A;  4L3R A;  1PEE A;  3OD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...