3WJGA

Crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPLLAESGYFRPRPDGSIEVVIACSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRWSTTTNPLQPLLKAILDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords UPF0678 fatty acid-binding protein-like protein At1g79260
publication title A Rhodium Complex-linked Hybrid Biocatalyst: Stereo-controlled Phenylacetylene Polymerization within an Engineered Protein Cavity
doi rcsb
source organism Arabidopsis thaliana
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08768 DUF1794 Domain of unknown function (DUF1794)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3wjgA00
1HMSA 1FENA 4NYQA 3VG2A 1B8EA 1GX9A 4QYPA 1PM1X 1ICMA 4Y0QA 1SA8A 2W2BA 2L67A 2WSJA 2HLVA 4AW8A 2XKLA 3EM0A 4GETA 4ORWA 5CE4A 4RUUA 2MO5A 3B2LA 5H9LA 1U18A 3NR3A 2ASNX 1X8OA 1MVGA 2MJIA 4EEJA 1FEMA 4GNWA 1X89A 5EEEA 2AT3X 3WJBA 4I9SA 5LKFA 4ORSA 2RCTA 1GXAA 4O9SA 3K3LA 4QZUA 1HMTA 2CZTA 4WFVA 1JZUA 2G78A 4N7DA 3D96A 2WQAE 5H9AA 4NNTA 1X8UA 3P6GA 1KT3A 3CQRA 3SAOA 1MX7A 5BVTA 1SY0A 2GC9A 2EU7X 1GM6A 2FT9A 5LJCA 1OBUA 2LBAA 3FA9A 1LIFA 2CBSA 3FMZA 4HPCA 4YCEA 1UZ2X 4D6BA 2RA6A 3PH5A 1XCAA 3IFBA 4ORRA 1ZNGA 2O62A 4XMCA 4ALBA 1VPRA 4YGZA 1OEEA 2AT5X 1EALA 3O19A 2IFBA 5EDBA 1IW2A 4BVMA 3UEVA 4YDAA 4OS3A 2QOSC 4KIIA 5KHPA 2LBVA 1O8VA 2L5PA 3BU1A 2OZQA 1FDQA 3F9DA 5FAZA 3VG4A 5LJBA 1KZWA 4ORUA 1X8QA 5HZQA 4IB7A 4LZVA 1S44A 1Z24A 1B4MA 1DZKA 5L8NA 3VG7A 4BQUA 1NP1A 2R74A 2KTDA 1LNMA 1JJXA 3BSZE 1OBQA 1FE3A 3WJEA 1BM5A 1HQPA 4HPBA 5HCEC 1B56A 1SXUA 2AT0X 3FR4A 1QQSA 5LJHA 1LFOA 1T0VA 2FR3A 3EMMA 1EIOA 4IB8A 2JU8A 3CWKA 3UEUA 4YGHA 3TZSA 2FTBA 1T8VA 3STNA 1B0OA 3APXA 3FA6A 4R0BA 2OVEA 5LJKA 3TGCA 2AH7X 5HCCC 2R73A 4YCHA 1AELA 2P8GA 4UU3A 5BVSA 5LJDA 1CBIA 1QFVA 4IBAA 4A1HA 2GTFX 3U9PC 3D95A 1G7NA 1BBPA 3APVA 3BX8A 5K06A 1IFCA 1S7DA 2NNQA 3FA8A 5IO5A 1YWAA 1E00A 2RQ0A 1A18A 4XMGA 3KZAA 5C0NA 1HBPA 2X46A 1QG5A 1BRPA 2FS7A 3CBCA 5EPQA 2Q2MA 1YWBA 3OJYC 3GAQA 2ACPX 2ACOA 4ZCBA 2NP1A 2Q2PA 1KT5A 1JYDA 1G5WA 1I04A 4Y0PA 2CM9A 4N7CA 1GKAA 3KFFA 3WJCA 2WR6A 4TJZA 4QGVA 4YH0A 3P6EA 1E5PA 4IMOA 1ADLA 4AZQA 5D8JA 5F7GA 1SY3A 2KT4B 1D3SA 2NNEA 1LIEA 1EPBA 3QKGA 5D48A 1A57A 1HBQA 3KFGA 1RLBE 3FW5A 5F6BA 3WJGA 4OMXA 1AQBA 4OS0A 3C78X 1QWDA 4GRJA 1G74A 1KGLA 1ZNKA 1ZRYA 2AKQA 5D45A 3PH6A 2HMBA 1BRQA 5IO6A 1RBPA 1YUPA 4TKJA 1BSOA 3FR5A 4XMEA 3BS2A 3NPOA 2FLJA 2LFOA 4YMYA 2PY1A 4QGXA 3ELXA 1SXYA 1GX8A 3P6DA 1OBPA 3TF6A 1LICA 4GH7A 1GT4A 1HN2A 5HZ5A 1DF3A 4A1YA 1CRBA 1CJ5A 5DPQA 4ZH9A 2A0AA 4AZPA 1ALBA 4DQ3A 1G85A 3BX7A 3STMX 3B2JA 4ZJ0A 3KFIA 4LKTA 1KZXA 4YGGA 5HAEA 4YBPA 3B2IA 3CQNA 3FA7A 2E4JA 4A8ZA 3WXQA 4PSQA 5LJEA 2WUTA 4TLJA 1DC9A 1E06A 3P6CA 3U0DA 2FWVA 5L8IA 3VG6A 3WBGA 3BLGA 2K23A 3WJFA 1JJJA 3RZYA 1TVQA 4RUNA 4XMFA 4LZUA 4EDEA 3NQ3A 4ORXA 2RD7C 1KQWA 3KQ0A 1FTPA 1KT4A 3PPTA 4ZHHA 4D6AA 3AKNA 2QO6A 4Y0RA 5LKEA 3CBSA 1U17A 3C77X 1XKIA 3IA8A 3NQ9A 5FFHA 2FRSA 5BVQA 1DFVA 5HCDC 2JU7A 3NP1A 2QO4A 3PECA 1JV4A 5HZ6A 5HBSA 1MX8A 3ZQ3A 2ALLX 3APUA 4M6SA 5EZ2A 5HA0A 1CBQA 4QYNA 3STKA 2OVAA 1GKAB 3BU9A 1QY1A 3B2KA 2Q4NA 3EYCA 3FLLA 3ELZA 3PP6A 5HTEA 2WWPA 2F73A 1S2PA 5H8TA 4ZHGA 1E02A 3T1DA 3P6HA 3S26A 1BJ7A 2HZRA 1O1UA 4QAEA 4YDBA 1NP4A 1N0SA 5DG4A 1X8NA 4NLIA 1D2UA 1DZMA 4TNNA 4AZMA 3D97A 1EUOA 4LKPA 3U03A 4NLJA 2AL0X 3DTQA 3I17A 4HPAA 4WBKA 1P6PA 4NP1A 4HFOA 2YG2A 1FELA 4GE1A 4UU2A 1ZNHA 2G79A 1DZJA 2A3FX 3BRNA 2A2UA 1X8PA 3KFHA 3MVFA 1CBRA 2W2AA 2WQ9A 5EEDA 2FS6A 1JBHA 1BWYA 1TOUA 2AT6X 2X45A 4ORYA 4ZH6A 2L68A 1SY2A 3I0AA 1OPBA 3HWEA 1QY2A 1ZNEA 1EW3A 1I06A 2G7BA 3TGAA 3VG3A 1NGLA 4I3CA 1IIUA 1KT6A 3G7XA 4QZTA 1LIBA 3WJDA 4I3BA 4ZR2A 1DV9A 2FR2A 4ZGUA 1T68X 1TW4A 1KT7A 2QO5A 5HTDA 3O22A 1IKJA 1KXOA 4DQ4A 1LF7A 2Q39A 1L6MA 2LKKA 4I9RA 1KOIA 4CK4A 4IB6A 3O2YA 4TQ2A 1QABE 1ICNA 4OMWA 1H91A 1JYJA 1BLRA 1DZPA 2HNXA 4Y0SA 1OPAA 5HZ9A 1VYGA 4NNSA 1GT5A 3WVMA 2MM3A 2K62A 4EXZA 1TOWA 4I3DA 1BSYA 1ERBA 4HPDA 1MDCA 2A2GA 4YFQA 5H9KA 2ANSA 1QFTA 5KICA 2CZUA 4YKMA 4OS8A 1PEEA 3UEXA 4ZHFA 2WEXA 1TXLA 2POAA 4YFPA 1ERXA 5L8OA 3RSWA 2JOZA 2CM4A 3MBTA 1A3YA 1MUPA 1OEKA 2AT8X 1LKEA 1EXSA 4ALOA 4MVIA 1YIVA 1EPAA 1X71A 3B2HA 3FELA 4K19A 1ACDA 1OEJA 3FEKA 1BEBA 5LJGA 3ZUIA 1UREA 3EBKA 4AZRA 2LB6A 5F1EA 1IKEA 5HA1A 3AKMA 1EIIA 2GJ5A 1O1VA 2A13A 4XMDA 5B27A 3VG5A 4ZHCA 3CMPA 4AZOA 1LIDA 3FR2A 1YWDA 4AYHA 1KQXA 5KIDA 1HMRA 5HWZA 5B29A 1CBSA 5JR8A 3BY0A 1BSQA 3NX1A 1ML7A 4IAXA 4IAWA 5FENA 2JU3A 1SXWA 3EBWA 4BOEA 1LPJA 4A60A 2HZQA 1SXXA 2HYSA 4ZFXA 1QY0A 5H9NA 3C76X 3ZUOA 1GT1A 3HWGA 3FEPA 2W2FA 5D4AA 4ZHDA 1GGLA 1YP7A 4MVLA 5HZ8A 2L9CA 4MVKA 1YWCA 1ZNDA 5EDCA 2DM5A 1IFBA 1VYFA 2NNDA 4YBUA 1I4UA 2Q9SA 4ARHA 4XMHA 3HWDA 4GKCA 2JN3A 5F58A 1U0XA 4YFRA 3L4RA 3JS1A 4GNYA 4EFGA 4IMNA 1AB0A 2RCQA 4TKHA 4AZNA 2CBRA 3TGBA 4QGWA 2QM9A 2BLGA 3HK1A 4ES7A 5AQ6A 3NADA 3FW4A 1A2DA 3FENA 3FIQA 3DSZA 4ODDA 2OFRX 3P6FA 4WFUA 4IB9A 3F8AA 3UEWA 1I05A 1PBOA 1R0UA 2N93A 3Q6LA 4M7MA 2OFMX 4NYRA 2AMMX 5F6ZA 2WEWA 3JSQA 5D47A 1GT3A 3APWA 2XSTA 1YP6A 1SY1A 3BDRA 2R56A 5IO7A 2OVDA 1AVGI 1EQDA 3CR6A 1PMPA 1ZNLA 3PEDA 4TKBA 3NX2A 3HWFA 4YKOA
chains in the Genus database with same CATH superfamily
1HMSA 1FENA 4MIRA 4NYQA 3RDSA 3VG2A 5AEOA 1B8EA 3S5XA 1VWKB 1GX9A 4QYPA 1PM1X 1ICMA 2IZBA 4Y0QA 1SA8A 2X55A 2W2BA 1HQQA 2L67A 2WSJA 5AJCA 2HLVA 2MF6A 5CYBA 3LV4A 4AW8A 2XKLA 3EM0A 4GETA 2IZFB 1SWGA 3EW2A 4ORWA 3VU1A 3T2XA 1N9YA 4RUUA 2MO5A 3B2LA 4GDAA 5CE4A 5H9LA 1U18A 2RTAA 5IRAA 3NR3A 2ASNX 1VWBB 2YMSA 4O4XA 1X8OA 1K24A 1MVGA 2MJIA 4EEJA 1FEMA 4GNWA 1VWFB 4KC8A 1WBIA 2BHVA 1X89A 5EEEA 2AT3X 3WJBA 4I9SA 5LKFA 4ID2A 2RTRB 2RTFB 4ORSA 2RCTA 1GXAA 1JJUA 4O9SA 2OY5O 1JBHA 3K3LA 4O3XB 4QZUA 1HMTA 3WZQA 1VYOA 5B3MO 2CZTA 1RSUB 1MM9A 4WFVA 2G78A 4N7DA 1SWRA 1GX3A 2IZDB 2WQAE 3D96A 4ML7B 5H9AA 4NNTA 1X8UA 3P6GA 1KT3A 3MM0A 3CQRA 3SAOA 1N9MA 2IZLB 4FQBB 1MX7A 1VWCB 5BVTA 1SY0A 1N7YA 2GC9A 2EU7X 4U8UO 4KT5A 4CPEA 2RTKA 1GM6A 2FT9A 2RTQB 3H3IA 2GTLO 5LJCA 5B5FA 2QCBA 3RY1A 4O49A 3VHMA 4HWMA 1SLGB 3FDCA 1OBUA 3SLTA 2DJFA 2LBAA 1UYNX 3FA9A 1LIFA 4L1NA 2CBSA 3PQUA 4GUZA 3WZPA 3FMZA 4HPCA 3RKGA 4YCEA 1UZ2X 4Z28A 4D6BA 2C1QA 2RA6A 3PH5A 1XCAA 1Y0GA 3IFBA 4ORRA 1FJ1E 2IZJA 1ZNGA 2O62A 4XMCA 4ALBA 1VPRA 2IZEB 2RTPB 4I60A 1OEEA 4YGZA 2AT5X 4Y59A 1EALA 5F2BA 3O19A 2IFBA 5EDBA 1IW2A 3MG5A 2BC3A 4BVMA 3UEVA 1JMXA 1LCWA 2VFBA 4YDAA 1RSTB 2QOSC 4KIIA 4OS3A 5KHPA 2QMIA 2LBVA 1KFFA 1O8VA 2L5PA 3BU1A 1RXKA 1SRGA 1FDQA 2C4IA 2OZQA 3F9DA 5FAZA 3VG4A 4ORUA 5LJBA 1KZWA 5B2AO 2PI3O 1JIWI 1X8QA 5HZQA 3JQOA 1VWPB 4I6SA 4IB7A 2X56A 4LZVA 1S44A 1SWTA 1Z24A 1B4MA 1DZKA 4DCBA 5L8NA 2JMBA 3VG7A 4BQUA 1NP1A 2R74A 2KTDA 1LNMA 2OY7A 1JJXA 3BSZE 4CPHB 1OBQA 1FE3A 2OVSA 3S5VA 1RXJA 1HQPA 1SWAA 4HPBA 1NQMA 3WJEA 5HCEC 1B56A 1BM5A 1SXUA 2AT0X 2VFCA 3FR4A 1SRFA 1QQSA 3ZW2A 3RE6A 5LJHA 1LFOA 4GZVA 1T0VA 2FR3A 3EMMA 5FQ6E 3SLOA 2MHDA 2IZIA 4IB8A 4QQ1A 1EIOA 4COTA 2JU8A 3RDOA 3CWKA 1MEPA 1VWGB 4YGHA 3UEUA 4DNEA 1T8VA 2FTBA 3TZSA 1SWPA 3STNA 1SWJA 1B0OA 1STPA 3APXA 1SLEB 2OVEA 3FA6A 4R0BA 5LJKA 3TGCA 4O4OA 2AH7X 1NQNA 1VWAB 2R73A 2X34A 3HTYA 4YCHA 5HCCC 1AELA 2P8GA 4UU3A 5BVSA 5LJDA 1CBIA 1QFVA 3LTWA 4IBAA 4A1HA 2CAMA 2GTFX 2LA7A 3D95A 3PK2A 1G7NA 1BBPA 3APVA 3BX8A 3U9PC 4BX6A 5K06A 3V8UA 4JNJA 1IFCA 1VWIB 2F01A 1S7DA 2NNQA 3FA8A 5IO5A 2BS6A 1N43A 1YWAA 1E00A 2RQ0A 1A18A 2DJGA 4XMGA 3KZAA 4BX5B 5C0NA 1HBPA 2X46A 1QG5A 4O4UA 1BRPA 3VE1A 2FS7A 3CBCA 4WHIA 5EPQA 2Q2MA 2FHLA 1YWBA 3OJYC 4Z2VA 3GAQA 2ACPX 3RBYA 1W4TA 2ACOA 2QOMA 2X4MA 2FHNX 3HPEA 2NP1A 4ZCBA 2Q2PA 1KT5A 1JYDA 3N91A 1G5WA 5B10O 1I04A 4Y0PA 2G8CO 2CM9A 4N7CA 1GKAA 3KFFA 3KVNA 3WJCA 2WR6A 4TJZA 4QGVA 4YH0A 4U3QA 1SWUA 3P6EA 1E5PA 4IMOA 1ADLA 4IABA 4AZQA 3ZW1A 5D8JA 5F7GA 1SY3A 2IZAA 2KT4B 1D3SA 1SWLA 2JGSA 1LIEA 1EPBA 1K3BA 2NNEA 3QKGA 5D48A 1A57A 1SWBA 1HBQA 3KFGA 4MISA 1Y9TA 1RLBE 3FW5A 2X8TA 5F6BA 3WJGA 1LDOA 4OMXA 1VWHB 1AQBA 1PTSA 4OS0A 1VWQB 1QWDA 2KW1A 3C78X 4GRJA 1G74A 1KGLA 1ZNKA 3FYFA 1UYOX 5CHKA 1ZRYA 2AKQA 1RAVA 5D45A 1KL4A 2AF5A 1STSB 3PH6A 4U46A 2HMBA 1BRQA 5IO6A 1RBPA 1YUPA 4NV8A 1BSOA 3FR5A 4TKJA 1KL5A 4XMEA 3BS2A 3NPOA 3SOTA 1JMZA 3GE2A 2FKJA 2FLJA 2LFOA 4BGFA 1LDQA 4YMYA 2ZSCA 2PY1A 1SWCA 4QGXA 3ELXA 1SXYA 1GX8A 3P6DA 1OBPA 5AJBA 3TF6A 1LICA 4GH7A 1GT4A 1HN2A 2KD2A 5HZ5A 5FQ8E 1DF3A 1I9HA 1SMPI 4A1YA 4FBRA 1CRBA 3WYQA 2Z4IA 1VWMB 5BYPA 4JHQA 1CJ5A 2X32A 5DPQA 4ZH9A 3RDXA 2A0AA 3VPJE 4AZPA 5IRWA 1ALBA 4DQ3A 1G85A 3BX7A 3STMX 1Y55X 3B2JA 3T6FA 4ZJ0A 1VWNB 3KFIA 4LKTA 3FIDA 3QQ2A 4YGGA 1KZXA 5HAEA 4YBPA 3B2IA 3CQNA 3FA7A 2E4JA 4A8ZA 3WXQA 4PSQA 2VDFA 5LJEA 2WUTA 3P24A 4IRWA 4O3WA 4TLJA 1DC9A 1SLDB 2OYBO 3PQSA 1E06A 3P6CA 3SZHA 3U0DA 2FWVA 5L8IA 3VG6A 3WBGA 3BLGA 3VGWA 2K23A 3WJFA 1JJJA 4O4SA 1TVQA 4RUNA 3CKFA 3RZYA 4XMFA 2RTDB 4LZUA 4EDEA 2OF9A 3NQ3A 4ORXA 3D4RA 2RD7C 4Z2PA 1KQWA 3KQ0A 3RDUA 1FTPA 4GDZA 4GJVA 1KT4A 3PPTA 2RTMA 4ZHHA 4D6AA 1SWSA 2HKDA 3AKNA 2QO6A 4Y0RA 1OSPO 3CBSA 1U17A 3C77X 1XKIA 3IA8A 3NQ9A 4INNA 5FFHA 3VE2A 2FRSA 2A5CA 5BVQA 4CPIA 3X00A 1DFVA 5HCDC 2BT9A 2JU7A 3NP1A 1NDJA 3SZJA 2QO4A 3PECA 1JV4A 5HZ6A 5HBSA 1Y53X 1MX8A 4KCAA 4Z2OA 2RTLA 2ALLX 3APUA 4M6SA 4OKAA 5EZ2A 3ZQ3A 4CDEA 4YVBA 5HA0A 1CBQA 4QYNA 4FBOA 3STKA 2OVAA 1GKAB 3BU9A 1QY1A 3B2KA 2Q4NA 3EYCA 3FLLA 3ELZA 3PP6A 5HTEA 1N4JA 2WWPA 2IZKA 2F73A 2RTOB 1LCZA 1S2PA 5H8TA 4I95A 4OEMA 1E02A 5B11O 3T1DA 2I5VO 3ZW1B 4ZHGA 3P6HA 3S26A 4O3ZA 5B5GA 4BBOA 1BJ7A 2HZRA 1HXLA 1O1UA 2G5LA 4QAEA 1NP4A 3P02A 4YDBA 5FQ7E 1N0SA 2GH7A 3ZI8A 5DG4A 1X8NA 1SWDA 4NLIA 1D2UA 1DZMA 1SWOA 2I5ZO 2OY1O 3D97A 1PBYA 4ON1A 4TNNA 1EUOA 4LKPA 2OL7A 5L3YA 3U03A 3VHIA 3EC5A 2AL0X 4NLJA 3DTQA 3I17A 4HPAA 4WBKA 1SWQA 1P6PA 4NP1A 4HFOA 4O3YA 3AUMO 3RY2A 1SWHA 2YG2A 1FELA 2UZ2A 4GE1A 4UU2A 1MOYA 1ZNHA 2FGSA 1SWKA 1DZJA 2A3FX 2G79A 4JGLA 1SWEA 3BRNA 1Y9LA 2BS5A 4CSBA 4Z6JA 1STRB 1VWRB 1X8PA 2A2UA 3KFHA 4U8UN 3MVFA 1CBRA 4GGZA 2W2AA 2WQ9A 4KH8A 2FS6A 2GTLN 5EEDA 3EW1A 5K68A 5K67A 1BWYA 1I78A 1TOUA 1SRJA 2AT6X 2X45A 2Y3EA 4ORYA 4ZH6A 1NC9A 2L68A 1SY2A 3I0AA 1E2TA 1OPBA 3LHNA 3HWEA 1QY2A 1ZNEA 4MEEA 1EW3A 1I06A 1LCVA 2G7BA 2IZGB 3TGAA 3VG3A 1NGLA 1VWLB 1IIUA 1KT6A 3G7XA 4I3CA 4QZTA 5JD2A 1LIBA 3WJDA 3E3CA 4I3BA 4ZR2A 1DV9A 2FR2A 4FBVA 4BX7A 4ZGUA 1T68X 5CSEA 1TW4A 1KT7A 2OF8A 2QO5A 3O22A 1IKJA 2X8FA 1KXOA 5HTDA 4B55A 1LF7A 2Q39A 4DQ4A 1BLRA 1L6MA 1JQPA 1JZUA 2LKKA 4I9RA 3RDMA 1KOIA 2Y32A 2Y3FA 4IB6A 2RTHB 3MX7A 4GGTA 4CK4A 3O2YA 5IRUA 4TQ2A 4BCSA 4NV7A 4CDDA 1QABE 4QNIA 1ICNA 2OL6O 1H91A 1JYJA 4JO6A 4OMWA 3T2WA 4CPHA 1EI5A 1IJ8A 1DZPA 2HNXA 4Y0SA 1OPAA 5HZ9A 1KL3A 1SLFB 1AVEA 1VYGA 4NNSA 1GT5A 3CKGA 3WVMA 2MM3A 2K62A 4EXZA 1TOWA 1SWFA 2A8GA 4I3DA 1BSYA 1ERBA 4HPDA 1MDCA 2A2GA 3AEHA 3OD9A 4GJSA 4YFQA 5H9KA 3T6LA 2FKGA 2ANSA 2F09A 1QFTA 1SRHA 5KICA 1WUBA 2CZUA 4YKMA 4OS8A 1PEEA 3UEXA 3NQKA 4GK9A 4KC7A 2WEXA 4ZHFA 1TXLA 1W5RA 2POAA 4YFPA 1ERXA 5L8OA 3RSWA 2JOZA 2CM4A 3MBTA 3SZIA 1A3YA 1MUPA 1OEKA 2AT8X 1LKEA 1VWDB 1EXSA 2RTIB 4ALOA 4MVIA 3ZW0A 1YIVA 1EPAA 1X71A 3B2HA 3FELA 4K19A 1ACDA 1OEJA 3FEKA 1BEBA 5LJGA 1SWNA 1UREA 3ZUIA 3EBKA 2ZAIA 1AVDA 4AZRA 1SRIA 2LB6A 4BX5A 5F1EA 1IKEA 5HA1A 3AKMA 1EIIA 2GJ5A 3Q34A 1O1VA 2A13A 4XMDA 4Y5DA 5B27A 3VG5A 4ZHCA 3CMPA 3OBLA 4AZOA 2RN4A 4U8UM 1LIDA 2GTLM 2RTJA 4BX6B 5IXGA 2MWHA 3FR2A 1YWDA 4U9CA 3VHHA 4AYHA 1KQXA 5KIDA 1VWOB 1HMRA 5HWZA 3HOEA 5B29A 1CBSA 5JR8A 4ZGFA 3BY0A 1BSQA 3NX1A 4LQZA 1RXHA 3WZNA 1ML7A 3WYPA 2KTSA 3S60A 3ZZVA 1LUQA 4IAXA 4IAWA 5FENA 2JU3A 4CPFA 1SXWA 3EBWA 2BSZA 4BOEA 1HY2A 1LPJA 4A60A 2RTEB 2HZQA 1SXXA 4NW4A 2HYSA 4ZFXA 2M4LA 3SLJA 1QY0A 5H9NA 3C76X 2IZHB 4L3RA 2RTNB 1LELA 3ZUOA 1GT1A 3HWGA 3FEPA 2W2FA 2AVIA 2JW1A 3OE3A 5D4AA 4BX7B 1GGLA 1YP7A 4MVLA 4ZHDA 2Z4HA 5HZ8A 2RTCB 2L9CA 4OELA 2RTGB 2A5BA 4MVKA 4AZMA 1YWCA 1ZNDA 5EDCA 2DM5A 4EKVA 2ZAGA 1IFBA 1VYFA 2NNDA 3HOLA 4YBUA 1I4UA 2Q9SA 2OFBA 2OL8O 4ARHA 4XMHA 2RTBB 3F6ZB 3HWDA 4GKCA 2JN3A 5F58A 1U0XA 4YFRA 3L4RA 3JS1A 4EQAC 4GNYA 3ZWEA 4EFGA 4IMNA 1AB0A 4QRLA 2RCQA 3RWXA 3RE5A 4TKHA 4AZNA 2OY8A 4GGRA 1DF8A 1HXZA 3UAQA 2CBRA 3D9WA 3TGBA 4CDCA 4CV7A 3WOVA 4QGWA 4C5PA 1NBXA 2BLGA 2QM9A 3HK1A 2UYWA 3WZOA 4ES7A 1VWEB 5AQ6A 3NADA 3FW4A 1A2DA 3FENA 3FIQA 3DSZA 4ODDA 2OFRX 3P6FA 4WFUA 2IZCB 4FGIB 3F8AA 4IB9A 3UEWA 1I05A 1PBOA 1R0UA 2N93A 3Q6LA 4M7MA 5LKEA 2OFMX 4NYRA 2AMMX 2OFAA 3PDFA 5F6ZA 2WEWA 3JSQA 5D47A 4GD9A 3ZW0B 1GT3A 4Z27A 4MVEA 3RDQA 4CDFA 3APWA 4BJ8A 4PJ2A 1Y52X 2XSTA 1YP6A 1SY1A 2C1SA 2R56A 3BDRA 5IO7A 1W6FA 2OVDA 1AVGI 3NBXX 1EQDA 3CR6A 1PMPA 1SREA 1VWJB 1ZNLA 2X8SA 3PEDA 3NX2A 4GU8A 3HWFA 1MK5A 4TKBA 2WPUA 4YKOA
chains in the Genus database with same CATH topology
1HMSA 1FENA 4MIRA 4NYQA 5AEOA 3VG2A 1B8EA 3S5XA 1GX9A 4QYPA 1PM1X 1ICMA 4Y0QA 1SA8A 2W2BA 5AJCA 2L67A 2WSJA 2HLVA 5CYBA 3LV4A 4AW8A 2XKLA 3EM0A 4GETA 3VU1A 4ORWA 5CE4A 4RUUA 2MO5A 3B2LA 5H9LA 1U18A 3NR3A 2ASNX 4O4XA 2YMSA 1X8OA 1MVGA 2MJIA 4EEJA 1FEMA 4GNWA 4KC8A 2BHVA 1X89A 5EEEA 2AT3X 3WJBA 4I9SA 5LKFA 4ID2A 4ORSA 2RCTA 1GXAA 4O9SA 3K3LA 4O3XB 4QZUA 1HMTA 2CZTA 4WFVA 1JZUA 2G78A 4N7DA 3D96A 4ML7B 2WQAE 5H9AA 4NNTA 1X8UA 3P6GA 1KT3A 3CQRA 3SAOA 4FQBB 1MX7A 5BVTA 1SY0A 2GC9A 2EU7X 4U8UO 4KT5A 1GM6A 2FT9A 3H3IA 5LJCA 2GTLO 4O49A 4HWMA 1OBUA 2LBAA 3FA9A 1LIFA 4L1NA 2CBSA 3PQUA 3FMZA 4HPCA 3RKGA 4YCEA 1UZ2X 4D6BA 2RA6A 3PH5A 1XCAA 3IFBA 4ORRA 1ZNGA 2O62A 4XMCA 4ALBA 1VPRA 4YGZA 1OEEA 2AT5X 1EALA 3O19A 2IFBA 5EDBA 1IW2A 4BVMA 3UEVA 4YDAA 4OS3A 2QOSC 4KIIA 5KHPA 2QMIA 2LBVA 1O8VA 2L5PA 3BU1A 2OZQA 1FDQA 3F9DA 5FAZA 3VG4A 5LJBA 1KZWA 4ORUA 1JIWI 1X8QA 5HZQA 3JQOA 4I6SA 4IB7A 4LZVA 1S44A 1Z24A 1B4MA 1DZKA 5L8NA 2JMBA 3VG7A 4BQUA 1NP1A 2R74A 2KTDA 1LNMA 1JJXA 3BSZE 1OBQA 1FE3A 2OVSA 3S5VA 3WJEA 1HQPA 1BM5A 4HPBA 5HCEC 1B56A 1SXUA 2AT0X 3FR4A 1QQSA 3ZW2A 5LJHA 1LFOA 4GZVA 1T0VA 2FR3A 3EMMA 5FQ6E 1EIOA 2MHDA 4IB8A 4QQ1A 4COTA 2JU8A 3CWKA 3UEUA 4YGHA 3TZSA 2FTBA 1T8VA 3STNA 1B0OA 3APXA 3FA6A 4R0BA 2OVEA 5LJKA 3TGCA 4O4OA 2AH7X 5HCCC 2R73A 4YCHA 3HTYA 1AELA 2P8GA 4UU3A 5BVSA 5LJDA 1CBIA 1QFVA 4IBAA 4A1HA 2GTFX 2LA7A 3D95A 3U9PC 1G7NA 1BBPA 3APVA 3BX8A 5K06A 3V8UA 1IFCA 1S7DA 2NNQA 3FA8A 5IO5A 2BS6A 1YWAA 1E00A 2RQ0A 1A18A 4XMGA 3KZAA 5C0NA 1HBPA 2X46A 1QG5A 4O4UA 1BRPA 3VE1A 2FS7A 3CBCA 4WHIA 5EPQA 2Q2MA 1YWBA 3OJYC 3GAQA 2ACPX 3RBYA 2ACOA 4ZCBA 2NP1A 2Q2PA 1KT5A 1JYDA 3N91A 1G5WA 1I04A 4Y0PA 2CM9A 4N7CA 1GKAA 3KFFA 3WJCA 2WR6A 4TJZA 4QGVA 4YH0A 4U3QA 3P6EA 1E5PA 4IMOA 1ADLA 4IABA 4AZQA 3ZW1A 5D8JA 5F7GA 1SY3A 2KT4B 1D3SA 2NNEA 1LIEA 1EPBA 3QKGA 5D48A 1A57A 1HBQA 3KFGA 4MISA 1Y9TA 1RLBE 3FW5A 2X8TA 5F6BA 3WJGA 4OMXA 1AQBA 4OS0A 3C78X 1QWDA 2KW1A 4GRJA 1G74A 1KGLA 1ZNKA 3FYFA 1ZRYA 2AKQA 5D45A 3PH6A 2HMBA 1BRQA 5IO6A 1RBPA 1YUPA 4TKJA 1BSOA 3FR5A 4XMEA 3BS2A 3NPOA 3SOTA 3GE2A 2FLJA 2LFOA 4YMYA 2PY1A 4QGXA 3ELXA 1SXYA 1GX8A 3P6DA 1OBPA 5AJBA 3TF6A 1LICA 4GH7A 1GT4A 1HN2A 2KD2A 5HZ5A 5FQ8E 1DF3A 4A1YA 1SMPI 4FBRA 1CRBA 2Z4IA 5BYPA 1CJ5A 5DPQA 4ZH9A 2A0AA 3VPJE 4AZPA 1ALBA 4DQ3A 1G85A 3BX7A 3STMX 3B2JA 4ZJ0A 3KFIA 4LKTA 1KZXA 4YGGA 5HAEA 4YBPA 3B2IA 3CQNA 3FA7A 2E4JA 4A8ZA 3WXQA 4PSQA 5LJEA 2WUTA 3P24A 4O3WA 4TLJA 1DC9A 3PQSA 1E06A 3P6CA 3U0DA 2FWVA 5L8IA 3VG6A 3WBGA 3BLGA 2K23A 3WJFA 1JJJA 4O4SA 1TVQA 4RUNA 3RZYA 4XMFA 4LZUA 4EDEA 3NQ3A 4ORXA 3D4RA 2RD7C 1KQWA 3KQ0A 1FTPA 4GDZA 1KT4A 3PPTA 4ZHHA 4D6AA 3AKNA 2QO6A 4Y0RA 5LKEA 3CBSA 1U17A 3C77X 1XKIA 3IA8A 3NQ9A 4INNA 5FFHA 3VE2A 2FRSA 5BVQA 1DFVA 5HCDC 2BT9A 2JU7A 3NP1A 2QO4A 3PECA 1JV4A 5HZ6A 5HBSA 1MX8A 4KCAA 3ZQ3A 2ALLX 3APUA 4M6SA 5EZ2A 5HA0A 1CBQA 4QYNA 4FBOA 3STKA 2OVAA 1GKAB 3BU9A 1QY1A 3B2KA 2Q4NA 3EYCA 3FLLA 3ELZA 3PP6A 5HTEA 2WWPA 2F73A 1S2PA 5H8TA 3ZW1B 4I95A 4ZHGA 1E02A 3T1DA 3P6HA 3S26A 4O3ZA 1BJ7A 2HZRA 1O1UA 3ZI8A 4QAEA 4YDBA 1NP4A 3P02A 5FQ7E 1N0SA 5DG4A 1X8NA 4NLIA 1D2UA 1DZMA 4TNNA 4AZMA 4ON1A 3D97A 1EUOA 4LKPA 3U03A 4NLJA 2AL0X 3DTQA 3I17A 4HPAA 4WBKA 1P6PA 4NP1A 4HFOA 4O3YA 2YG2A 1FELA 4GE1A 4UU2A 1ZNHA 2G79A 4JGLA 1DZJA 2A3FX 3BRNA 1Y9LA 2BS5A 4CSBA 2A2UA 1X8PA 3KFHA 4U8UN 3MVFA 1CBRA 4KH8A 2W2AA 2WQ9A 5EEDA 2FS6A 2GTLN 1JBHA 1BWYA 1TOUA 2AT6X 2X45A 4ORYA 4ZH6A 2L68A 1SY2A 3I0AA 1OPBA 3LHNA 3HWEA 1QY2A 1ZNEA 1EW3A 1I06A 2G7BA 3TGAA 3VG3A 1NGLA 4I3CA 1IIUA 1KT6A 3G7XA 4QZTA 1LIBA 3WJDA 3E3CA 4I3BA 4ZR2A 1DV9A 2FR2A 4FBVA 4ZGUA 1T68X 1TW4A 1KT7A 2QO5A 5HTDA 3O22A 1IKJA 2X8FA 1KXOA 4DQ4A 1LF7A 2Q39A 1L6MA 2LKKA 4I9RA 1KOIA 4CK4A 4IB6A 3MX7A 3O2YA 4TQ2A 1QABE 4QNIA 1ICNA 4OMWA 1H91A 1JYJA 1BLRA 1EI5A 1DZPA 2HNXA 4Y0SA 1OPAA 5HZ9A 1VYGA 4NNSA 1GT5A 3WVMA 2MM3A 2K62A 4EXZA 1TOWA 4I3DA 1BSYA 1ERBA 4HPDA 1MDCA 2A2GA 3OD9A 4YFQA 5H9KA 2ANSA 2F09A 1QFTA 5KICA 2CZUA 4YKMA 4OS8A 1PEEA 3UEXA 3NQKA 4GK9A 4KC7A 2WEXA 4ZHFA 1TXLA 2POAA 4YFPA 1ERXA 5L8OA 3RSWA 2JOZA 2CM4A 3MBTA 1A3YA 1MUPA 1OEKA 2AT8X 1LKEA 1EXSA 4ALOA 4MVIA 3ZW0A 1YIVA 1EPAA 1X71A 3B2HA 3FELA 4K19A 1ACDA 1OEJA 3FEKA 1BEBA 5LJGA 3ZUIA 1UREA 3EBKA 2ZAIA 4AZRA 2LB6A 5F1EA 1IKEA 5HA1A 3AKMA 1EIIA 2GJ5A 1O1VA 2A13A 4XMDA 5B27A 3VG5A 4ZHCA 3CMPA 3OBLA 4AZOA 2RN4A 4U8UM 1LIDA 2GTLM 2MWHA 3FR2A 1YWDA 4U9CA 4AYHA 1KQXA 5KIDA 1HMRA 5HWZA 3HOEA 5B29A 1CBSA 5JR8A 4ZGFA 3BY0A 1BSQA 3NX1A 4LQZA 1ML7A 3ZZVA 2KTSA 3S60A 4IAXA 4IAWA 5FENA 2JU3A 1SXWA 3EBWA 4BOEA 1LPJA 4A60A 2HZQA 1SXXA 4NW4A 2HYSA 4ZFXA 2M4LA 1QY0A 5H9NA 3C76X 4L3RA 3ZUOA 1GT1A 3HWGA 3FEPA 2W2FA 3OE3A 2JW1A 5D4AA 4ZHDA 1GGLA 1YP7A 4MVLA 2Z4HA 5HZ8A 2L9CA 4MVKA 1YWCA 1ZNDA 5EDCA 2DM5A 2ZAGA 1IFBA 1VYFA 2NNDA 3HOLA 4YBUA 1I4UA 2Q9SA 4ARHA 4XMHA 3F6ZB 3HWDA 4GKCA 2JN3A 5F58A 1U0XA 4YFRA 3L4RA 3JS1A 4EQAC 4GNYA 3ZWEA 4EFGA 4IMNA 1AB0A 4QRLA 2RCQA 3RWXA 4TKHA 4AZNA 3UAQA 2CBRA 3TGBA 4CV7A 3WOVA 4QGWA 2QM9A 2BLGA 3HK1A 4ES7A 5AQ6A 3NADA 3FW4A 1A2DA 3FENA 3FIQA 3DSZA 4ODDA 2OFRX 3P6FA 4WFUA 4FGIB 3F8AA 4IB9A 3UEWA 1I05A 1PBOA 1R0UA 2N93A 3Q6LA 4M7MA 2OFMX 4NYRA 2AMMX 5F6ZA 2WEWA 3JSQA 5D47A 3ZW0B 1GT3A 4MVEA 3APWA 4PJ2A 2XSTA 1YP6A 1SY1A 3BDRA 2R56A 5IO7A 2OVDA 1AVGI 3NBXX 1EQDA 3CR6A 1PMPA 1ZNLA 2X8SA 3PEDA 4TKBA 4GU8A 3NX2A 3HWFA 4YKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMS A;  1FEN A;  4NYQ A;  3VG2 A;  1B8E A;  1GX9 A;  4QYP A;  1PM1 X;  1ICM A;  4Y0Q A;  1SA8 A;  2W2B A;  2L67 A;  2WSJ A;  2HLV A;  4AW8 A;  2XKL A;  3EM0 A;  4GET A;  4ORW A;  5CE4 A;  4RUU A;  2MO5 A;  3B2L A;  5H9L A;  1U18 A;  3NR3 A;  2ASN X;  1X8O A;  1MVG A;  2MJI A;  4EEJ A;  1FEM A;  4GNW A;  1X89 A;  5EEE A;  2AT3 X;  3WJB A;  4I9S A;  5LKF A;  4ORS A;  2RCT A;  1GXA A;  4O9S A;  3K3L A;  4QZU A;  1HMT A;  2CZT A;  4WFV A;  1JZU A;  2G78 A;  4N7D A;  3D96 A;  2WQA E;  5H9A A;  4NNT A;  1X8U A;  3P6G A;  1KT3 A;  3CQR A;  3SAO A;  1MX7 A;  5BVT A;  1SY0 A;  2GC9 A;  2EU7 X;  1GM6 A;  2FT9 A;  5LJC A;  1OBU A;  2LBA A;  3FA9 A;  1LIF A;  2CBS A;  3FMZ A;  4HPC A;  4YCE A;  1UZ2 X;  4D6B A;  2RA6 A;  3PH5 A;  1XCA A;  3IFB A;  4ORR A;  1ZNG A;  2O62 A;  4XMC A;  4ALB A;  1VPR A;  4YGZ A;  1OEE A;  2AT5 X;  1EAL A;  3O19 A;  2IFB A;  5EDB A;  1IW2 A;  4BVM A;  3UEV A;  4YDA A;  4OS3 A;  2QOS C;  4KII A;  5KHP A;  2LBV A;  1O8V A;  2L5P A;  3BU1 A;  2OZQ A;  1FDQ A;  3F9D A;  5FAZ A;  3VG4 A;  5LJB A;  1KZW A;  4ORU A;  1X8Q A;  5HZQ A;  4IB7 A;  4LZV A;  1S44 A;  1Z24 A;  1B4M A;  1DZK A;  5L8N A;  3VG7 A;  4BQU A;  1NP1 A;  2R74 A;  2KTD A;  1LNM A;  1JJX A;  3BSZ E;  1OBQ A;  1FE3 A;  3WJE A;  1BM5 A;  1HQP A;  4HPB A;  5HCE C;  1B56 A;  1SXU A;  2AT0 X;  3FR4 A;  1QQS A;  5LJH A;  1LFO A;  1T0V A;  2FR3 A;  3EMM A;  1EIO A;  4IB8 A;  2JU8 A;  3CWK A;  3UEU A;  4YGH A;  3TZS A;  2FTB A;  1T8V A;  3STN A;  1B0O A;  3APX A;  3FA6 A;  4R0B A;  2OVE A;  5LJK A;  3TGC A;  2AH7 X;  5HCC C;  2R73 A;  4YCH A;  1AEL A;  2P8G A;  4UU3 A;  5BVS A;  5LJD A;  1CBI A;  1QFV A;  4IBA A;  4A1H A;  2GTF X;  3U9P C;  3D95 A;  1G7N A;  1BBP A;  3APV A;  3BX8 A;  5K06 A;  1IFC A;  1S7D A;  2NNQ A;  3FA8 A;  5IO5 A;  1YWA A;  1E00 A;  2RQ0 A;  1A18 A;  4XMG A;  3KZA A;  5C0N A;  1HBP A;  2X46 A;  1QG5 A;  1BRP A;  2FS7 A;  3CBC A;  5EPQ A;  2Q2M A;  1YWB A;  3OJY C;  3GAQ A;  2ACP X;  2ACO A;  4ZCB A;  2NP1 A;  2Q2P A;  1KT5 A;  1JYD A;  1G5W A;  1I04 A;  4Y0P A;  2CM9 A;  4N7C A;  1GKA A;  3KFF A;  3WJC A;  2WR6 A;  4TJZ A;  4QGV A;  4YH0 A;  3P6E A;  1E5P A;  4IMO A;  1ADL A;  4AZQ A;  5D8J A;  5F7G A;  1SY3 A;  2KT4 B;  1D3S A;  2NNE A;  1LIE A;  1EPB A;  3QKG A;  5D48 A;  1A57 A;  1HBQ A;  3KFG A;  1RLB E;  3FW5 A;  5F6B A;  3WJG A;  4OMX A;  1AQB A;  4OS0 A;  3C78 X;  1QWD A;  4GRJ A;  1G74 A;  1KGL A;  1ZNK A;  1ZRY A;  2AKQ A;  5D45 A;  3PH6 A;  2HMB A;  1BRQ A;  5IO6 A;  1RBP A;  1YUP A;  4TKJ A;  1BSO A;  3FR5 A;  4XME A;  3BS2 A;  3NPO A;  2FLJ A;  2LFO A;  4YMY A;  2PY1 A;  4QGX A;  3ELX A;  1SXY A;  1GX8 A;  3P6D A;  1OBP A;  3TF6 A;  1LIC A;  4GH7 A;  1GT4 A;  1HN2 A;  5HZ5 A;  1DF3 A;  4A1Y A;  1CRB A;  1CJ5 A;  5DPQ A;  4ZH9 A;  2A0A A;  4AZP A;  1ALB A;  4DQ3 A;  1G85 A;  3BX7 A;  3STM X;  3B2J A;  4ZJ0 A;  3KFI A;  4LKT A;  1KZX A;  4YGG A;  5HAE A;  4YBP A;  3B2I A;  3CQN A;  3FA7 A;  2E4J A;  4A8Z A;  3WXQ A;  4PSQ A;  5LJE A;  2WUT A;  4TLJ A;  1DC9 A;  1E06 A;  3P6C A;  3U0D A;  2FWV A;  5L8I A;  3VG6 A;  3WBG A;  3BLG A;  2K23 A;  3WJF A;  1JJJ A;  3RZY A;  1TVQ A;  4RUN A;  4XMF A;  4LZU A;  4EDE A;  3NQ3 A;  4ORX A;  2RD7 C;  1KQW A;  3KQ0 A;  1FTP A;  1KT4 A;  3PPT A;  4ZHH A;  4D6A A;  3AKN A;  2QO6 A;  4Y0R A;  5LKE A;  3CBS A;  1U17 A;  3C77 X;  1XKI A;  3IA8 A;  3NQ9 A;  5FFH A;  2FRS A;  5BVQ A;  1DFV A;  5HCD C;  2JU7 A;  3NP1 A;  2QO4 A;  3PEC A;  1JV4 A;  5HZ6 A;  5HBS A;  1MX8 A;  3ZQ3 A;  2ALL X;  3APU A;  4M6S A;  5EZ2 A;  5HA0 A;  1CBQ A;  4QYN A;  3STK A;  2OVA A;  1GKA B;  3BU9 A;  1QY1 A;  3B2K A;  2Q4N A;  3EYC A;  3FLL A;  3ELZ A;  3PP6 A;  5HTE A;  2WWP A;  2F73 A;  1S2P A;  5H8T A;  4ZHG A;  1E02 A;  3T1D A;  3P6H A;  3S26 A;  1BJ7 A;  2HZR A;  1O1U A;  4QAE A;  4YDB A;  1NP4 A;  1N0S A;  5DG4 A;  1X8N A;  4NLI A;  1D2U A;  1DZM A;  4TNN A;  4AZM A;  3D97 A;  1EUO A;  4LKP A;  3U03 A;  4NLJ A;  2AL0 X;  3DTQ A;  3I17 A;  4HPA A;  4WBK A;  1P6P A;  4NP1 A;  4HFO A;  2YG2 A;  1FEL A;  4GE1 A;  4UU2 A;  1ZNH A;  2G79 A;  1DZJ A;  2A3F X;  3BRN A;  2A2U A;  1X8P A;  3KFH A;  3MVF A;  1CBR A;  2W2A A;  2WQ9 A;  5EED A;  2FS6 A;  1JBH A;  1BWY A;  1TOU A;  2AT6 X;  2X45 A;  4ORY A;  4ZH6 A;  2L68 A;  1SY2 A;  3I0A A;  1OPB A;  3HWE A;  1QY2 A;  1ZNE A;  1EW3 A;  1I06 A;  2G7B A;  3TGA A;  3VG3 A;  1NGL A;  4I3C A;  1IIU A;  1KT6 A;  3G7X A;  4QZT A;  1LIB A;  3WJD A;  4I3B A;  4ZR2 A;  1DV9 A;  2FR2 A;  4ZGU A;  1T68 X;  1TW4 A;  1KT7 A;  2QO5 A;  5HTD A;  3O22 A;  1IKJ A;  1KXO A;  4DQ4 A;  1LF7 A;  2Q39 A;  1L6M A;  2LKK A;  4I9R A;  1KOI A;  4CK4 A;  4IB6 A;  3O2Y A;  4TQ2 A;  1QAB E;  1ICN A;  4OMW A;  1H91 A;  1JYJ A;  1BLR A;  1DZP A;  2HNX A;  4Y0S A;  1OPA A;  5HZ9 A;  1VYG A;  4NNS A;  1GT5 A;  3WVM A;  2MM3 A;  2K62 A;  4EXZ A;  1TOW A;  4I3D A;  1BSY A;  1ERB A;  4HPD A;  1MDC A;  2A2G A;  4YFQ A;  5H9K A;  2ANS A;  1QFT A;  5KIC A;  2CZU A;  4YKM A;  4OS8 A;  1PEE A;  3UEX A;  4ZHF A;  2WEX A;  1TXL A;  2POA A;  4YFP A;  1ERX A;  5L8O A;  3RSW A;  2JOZ A;  2CM4 A;  3MBT A;  1A3Y A;  1MUP A;  1OEK A;  2AT8 X;  1LKE A;  1EXS A;  4ALO A;  4MVI A;  1YIV A;  1EPA A;  1X71 A;  3B2H A;  3FEL A;  4K19 A;  1ACD A;  1OEJ A;  3FEK A;  1BEB A;  5LJG A;  3ZUI A;  1URE A;  3EBK A;  4AZR A;  2LB6 A;  5F1E A;  1IKE A;  5HA1 A;  3AKM A;  1EII A;  2GJ5 A;  1O1V A;  2A13 A;  4XMD A;  5B27 A;  3VG5 A;  4ZHC A;  3CMP A;  4AZO A;  1LID A;  3FR2 A;  1YWD A;  4AYH A;  1KQX A;  5KID A;  1HMR A;  5HWZ A;  5B29 A;  1CBS A;  5JR8 A;  3BY0 A;  1BSQ A;  3NX1 A;  1ML7 A;  4IAX A;  4IAW A;  5FEN A;  2JU3 A;  1SXW A;  3EBW A;  4BOE A;  1LPJ A;  4A60 A;  2HZQ A;  1SXX A;  2HYS A;  4ZFX A;  1QY0 A;  5H9N A;  3C76 X;  3ZUO A;  1GT1 A;  3HWG A;  3FEP A;  2W2F A;  5D4A A;  4ZHD A;  1GGL A;  1YP7 A;  4MVL A;  5HZ8 A;  2L9C A;  4MVK A;  1YWC A;  1ZND A;  5EDC A;  2DM5 A;  1IFB A;  1VYF A;  2NND A;  4YBU A;  1I4U A;  2Q9S A;  4ARH A;  4XMH A;  3HWD A;  4GKC A;  2JN3 A;  5F58 A;  1U0X A;  4YFR A;  3L4R A;  3JS1 A;  4GNY A;  4EFG A;  4IMN A;  1AB0 A;  2RCQ A;  4TKH A;  4AZN A;  2CBR A;  3TGB A;  4QGW A;  2QM9 A;  2BLG A;  3HK1 A;  4ES7 A;  5AQ6 A;  3NAD A;  3FW4 A;  1A2D A;  3FEN A;  3FIQ A;  3DSZ A;  4ODD A;  2OFR X;  3P6F A;  4WFU A;  4IB9 A;  3F8A A;  3UEW A;  1I05 A;  1PBO A;  1R0U A;  2N93 A;  3Q6L A;  4M7M A;  2OFM X;  4NYR A;  2AMM X;  5F6Z A;  2WEW A;  3JSQ A;  5D47 A;  1GT3 A;  3APW A;  2XST A;  1YP6 A;  1SY1 A;  3BDR A;  2R56 A;  5IO7 A;  2OVD A;  1AVG I;  1EQD A;  3CR6 A;  1PMP A;  1ZNL A;  3PED A;  4TKB A;  3NX2 A;  3HWF A;  4YKO A; 
#chains in the Genus database with same CATH topology
 1HMS A;  1FEN A;  4MIR A;  4NYQ A;  3RDS A;  3VG2 A;  5AEO A;  1B8E A;  3S5X A;  1VWK B;  1GX9 A;  4QYP A;  1PM1 X;  1ICM A;  2IZB A;  4Y0Q A;  1SA8 A;  2X55 A;  2W2B A;  1HQQ A;  2L67 A;  2WSJ A;  5AJC A;  2HLV A;  2MF6 A;  5CYB A;  3LV4 A;  4AW8 A;  2XKL A;  3EM0 A;  4GET A;  2IZF B;  1SWG A;  3EW2 A;  4ORW A;  3VU1 A;  3T2X A;  1N9Y A;  4RUU A;  2MO5 A;  3B2L A;  4GDA A;  5CE4 A;  5H9L A;  1U18 A;  2RTA A;  5IRA A;  3NR3 A;  2ASN X;  1VWB B;  2YMS A;  4O4X A;  1X8O A;  1K24 A;  1MVG A;  2MJI A;  4EEJ A;  1FEM A;  4GNW A;  1VWF B;  4KC8 A;  1WBI A;  2BHV A;  1X89 A;  5EEE A;  2AT3 X;  3WJB A;  4I9S A;  5LKF A;  4ID2 A;  2RTR B;  2RTF B;  4ORS A;  2RCT A;  1GXA A;  1JJU A;  4O9S A;  2OY5 O;  1JBH A;  3K3L A;  4O3X B;  4QZU A;  1HMT A;  3WZQ A;  1VYO A;  5B3M O;  2CZT A;  1RSU B;  1MM9 A;  4WFV A;  2G78 A;  4N7D A;  1SWR A;  1GX3 A;  2IZD B;  2WQA E;  3D96 A;  4ML7 B;  5H9A A;  4NNT A;  1X8U A;  3P6G A;  1KT3 A;  3MM0 A;  3CQR A;  3SAO A;  1N9M A;  2IZL B;  4FQB B;  1MX7 A;  1VWC B;  5BVT A;  1SY0 A;  1N7Y A;  2GC9 A;  2EU7 X;  4U8U O;  4KT5 A;  4CPE A;  2RTK A;  1GM6 A;  2FT9 A;  2RTQ B;  3H3I A;  2GTL O;  5LJC A;  5B5F A;  2QCB A;  3RY1 A;  4O49 A;  3VHM A;  4HWM A;  1SLG B;  3FDC A;  1OBU A;  3SLT A;  2DJF A;  2LBA A;  1UYN X;  3FA9 A;  1LIF A;  4L1N A;  2CBS A;  3PQU A;  4GUZ A;  3WZP A;  3FMZ A;  4HPC A;  3RKG A;  4YCE A;  1UZ2 X;  4Z28 A;  4D6B A;  2C1Q A;  2RA6 A;  3PH5 A;  1XCA A;  1Y0G A;  3IFB A;  4ORR A;  1FJ1 E;  2IZJ A;  1ZNG A;  2O62 A;  4XMC A;  4ALB A;  1VPR A;  2IZE B;  2RTP B;  4I60 A;  1OEE A;  4YGZ A;  2AT5 X;  4Y59 A;  1EAL A;  5F2B A;  3O19 A;  2IFB A;  5EDB A;  1IW2 A;  3MG5 A;  2BC3 A;  4BVM A;  3UEV A;  1JMX A;  1LCW A;  2VFB A;  4YDA A;  1RST B;  2QOS C;  4KII A;  4OS3 A;  5KHP A;  2QMI A;  2LBV A;  1KFF A;  1O8V A;  2L5P A;  3BU1 A;  1RXK A;  1SRG A;  1FDQ A;  2C4I A;  2OZQ A;  3F9D A;  5FAZ A;  3VG4 A;  4ORU A;  5LJB A;  1KZW A;  5B2A O;  2PI3 O;  1JIW I;  1X8Q A;  5HZQ A;  3JQO A;  1VWP B;  4I6S A;  4IB7 A;  2X56 A;  4LZV A;  1S44 A;  1SWT A;  1Z24 A;  1B4M A;  1DZK A;  4DCB A;  5L8N A;  2JMB A;  3VG7 A;  4BQU A;  1NP1 A;  2R74 A;  2KTD A;  1LNM A;  2OY7 A;  1JJX A;  3BSZ E;  4CPH B;  1OBQ A;  1FE3 A;  2OVS A;  3S5V A;  1RXJ A;  1HQP A;  1SWA A;  4HPB A;  1NQM A;  3WJE A;  5HCE C;  1B56 A;  1BM5 A;  1SXU A;  2AT0 X;  2VFC A;  3FR4 A;  1SRF A;  1QQS A;  3ZW2 A;  3RE6 A;  5LJH A;  1LFO A;  4GZV A;  1T0V A;  2FR3 A;  3EMM A;  5FQ6 E;  3SLO A;  2MHD A;  2IZI A;  4IB8 A;  4QQ1 A;  1EIO A;  4COT A;  2JU8 A;  3RDO A;  3CWK A;  1MEP A;  1VWG B;  4YGH A;  3UEU A;  4DNE A;  1T8V A;  2FTB A;  3TZS A;  1SWP A;  3STN A;  1SWJ A;  1B0O A;  1STP A;  3APX A;  1SLE B;  2OVE A;  3FA6 A;  4R0B A;  5LJK A;  3TGC A;  4O4O A;  2AH7 X;  1NQN A;  1VWA B;  2R73 A;  2X34 A;  3HTY A;  4YCH A;  5HCC C;  1AEL A;  2P8G A;  4UU3 A;  5BVS A;  5LJD A;  1CBI A;  1QFV A;  3LTW A;  4IBA A;  4A1H A;  2CAM A;  2GTF X;  2LA7 A;  3D95 A;  3PK2 A;  1G7N A;  1BBP A;  3APV A;  3BX8 A;  3U9P C;  4BX6 A;  5K06 A;  3V8U A;  4JNJ A;  1IFC A;  1VWI B;  2F01 A;  1S7D A;  2NNQ A;  3FA8 A;  5IO5 A;  2BS6 A;  1N43 A;  1YWA A;  1E00 A;  2RQ0 A;  1A18 A;  2DJG A;  4XMG A;  3KZA A;  4BX5 B;  5C0N A;  1HBP A;  2X46 A;  1QG5 A;  4O4U A;  1BRP A;  3VE1 A;  2FS7 A;  3CBC A;  4WHI A;  5EPQ A;  2Q2M A;  2FHL A;  1YWB A;  3OJY C;  4Z2V A;  3GAQ A;  2ACP X;  3RBY A;  1W4T A;  2ACO A;  2QOM A;  2X4M A;  2FHN X;  3HPE A;  2NP1 A;  4ZCB A;  2Q2P A;  1KT5 A;  1JYD A;  3N91 A;  1G5W A;  5B10 O;  1I04 A;  4Y0P A;  2G8C O;  2CM9 A;  4N7C A;  1GKA A;  3KFF A;  3KVN A;  3WJC A;  2WR6 A;  4TJZ A;  4QGV A;  4YH0 A;  4U3Q A;  1SWU A;  3P6E A;  1E5P A;  4IMO A;  1ADL A;  4IAB A;  4AZQ A;  3ZW1 A;  5D8J A;  5F7G A;  1SY3 A;  2IZA A;  2KT4 B;  1D3S A;  1SWL A;  2JGS A;  1LIE A;  1EPB A;  1K3B A;  2NNE A;  3QKG A;  5D48 A;  1A57 A;  1SWB A;  1HBQ A;  3KFG A;  4MIS A;  1Y9T A;  1RLB E;  3FW5 A;  2X8T A;  5F6B A;  3WJG A;  1LDO A;  4OMX A;  1VWH B;  1AQB A;  1PTS A;  4OS0 A;  1VWQ B;  1QWD A;  2KW1 A;  3C78 X;  4GRJ A;  1G74 A;  1KGL A;  1ZNK A;  3FYF A;  1UYO X;  5CHK A;  1ZRY A;  2AKQ A;  1RAV A;  5D45 A;  1KL4 A;  2AF5 A;  1STS B;  3PH6 A;  4U46 A;  2HMB A;  1BRQ A;  5IO6 A;  1RBP A;  1YUP A;  4NV8 A;  1BSO A;  3FR5 A;  4TKJ A;  1KL5 A;  4XME A;  3BS2 A;  3NPO A;  3SOT A;  1JMZ A;  3GE2 A;  2FKJ A;  2FLJ A;  2LFO A;  4BGF A;  1LDQ A;  4YMY A;  2ZSC A;  2PY1 A;  1SWC A;  4QGX A;  3ELX A;  1SXY A;  1GX8 A;  3P6D A;  1OBP A;  5AJB A;  3TF6 A;  1LIC A;  4GH7 A;  1GT4 A;  1HN2 A;  2KD2 A;  5HZ5 A;  5FQ8 E;  1DF3 A;  1I9H A;  1SMP I;  4A1Y A;  4FBR A;  1CRB A;  3WYQ A;  2Z4I A;  1VWM B;  5BYP A;  4JHQ A;  1CJ5 A;  2X32 A;  5DPQ A;  4ZH9 A;  3RDX A;  2A0A A;  3VPJ E;  4AZP A;  5IRW A;  1ALB A;  4DQ3 A;  1G85 A;  3BX7 A;  3STM X;  1Y55 X;  3B2J A;  3T6F A;  4ZJ0 A;  1VWN B;  3KFI A;  4LKT A;  3FID A;  3QQ2 A;  4YGG A;  1KZX A;  5HAE A;  4YBP A;  3B2I A;  3CQN A;  3FA7 A;  2E4J A;  4A8Z A;  3WXQ A;  4PSQ A;  2VDF A;  5LJE A;  2WUT A;  3P24 A;  4IRW A;  4O3W A;  4TLJ A;  1DC9 A;  1SLD B;  2OYB O;  3PQS A;  1E06 A;  3P6C A;  3SZH A;  3U0D A;  2FWV A;  5L8I A;  3VG6 A;  3WBG A;  3BLG A;  3VGW A;  2K23 A;  3WJF A;  1JJJ A;  4O4S A;  1TVQ A;  4RUN A;  3CKF A;  3RZY A;  4XMF A;  2RTD B;  4LZU A;  4EDE A;  2OF9 A;  3NQ3 A;  4ORX A;  3D4R A;  2RD7 C;  4Z2P A;  1KQW A;  3KQ0 A;  3RDU A;  1FTP A;  4GDZ A;  4GJV A;  1KT4 A;  3PPT A;  2RTM A;  4ZHH A;  4D6A A;  1SWS A;  2HKD A;  3AKN A;  2QO6 A;  4Y0R A;  1OSP O;  3CBS A;  1U17 A;  3C77 X;  1XKI A;  3IA8 A;  3NQ9 A;  4INN A;  5FFH A;  3VE2 A;  2FRS A;  2A5C A;  5BVQ A;  4CPI A;  3X00 A;  1DFV A;  5HCD C;  2BT9 A;  2JU7 A;  3NP1 A;  1NDJ A;  3SZJ A;  2QO4 A;  3PEC A;  1JV4 A;  5HZ6 A;  5HBS A;  1Y53 X;  1MX8 A;  4KCA A;  4Z2O A;  2RTL A;  2ALL X;  3APU A;  4M6S A;  4OKA A;  5EZ2 A;  3ZQ3 A;  4CDE A;  4YVB A;  5HA0 A;  1CBQ A;  4QYN A;  4FBO A;  3STK A;  2OVA A;  1GKA B;  3BU9 A;  1QY1 A;  3B2K A;  2Q4N A;  3EYC A;  3FLL A;  3ELZ A;  3PP6 A;  5HTE A;  1N4J A;  2WWP A;  2IZK A;  2F73 A;  2RTO B;  1LCZ A;  1S2P A;  5H8T A;  4I95 A;  4OEM A;  1E02 A;  5B11 O;  3T1D A;  2I5V O;  3ZW1 B;  4ZHG A;  3P6H A;  3S26 A;  4O3Z A;  5B5G A;  4BBO A;  1BJ7 A;  2HZR A;  1HXL A;  1O1U A;  2G5L A;  4QAE A;  1NP4 A;  3P02 A;  4YDB A;  5FQ7 E;  1N0S A;  2GH7 A;  3ZI8 A;  5DG4 A;  1X8N A;  1SWD A;  4NLI A;  1D2U A;  1DZM A;  1SWO A;  2I5Z O;  2OY1 O;  3D97 A;  1PBY A;  4ON1 A;  4TNN A;  1EUO A;  4LKP A;  2OL7 A;  5L3Y A;  3U03 A;  3VHI A;  3EC5 A;  2AL0 X;  4NLJ A;  3DTQ A;  3I17 A;  4HPA A;  4WBK A;  1SWQ A;  1P6P A;  4NP1 A;  4HFO A;  4O3Y A;  3AUM O;  3RY2 A;  1SWH A;  2YG2 A;  1FEL A;  2UZ2 A;  4GE1 A;  4UU2 A;  1MOY A;  1ZNH A;  2FGS A;  1SWK A;  1DZJ A;  2A3F X;  2G79 A;  4JGL A;  1SWE A;  3BRN A;  1Y9L A;  2BS5 A;  4CSB A;  4Z6J A;  1STR B;  1VWR B;  1X8P A;  2A2U A;  3KFH A;  4U8U N;  3MVF A;  1CBR A;  4GGZ A;  2W2A A;  2WQ9 A;  4KH8 A;  2FS6 A;  2GTL N;  5EED A;  3EW1 A;  5K68 A;  5K67 A;  1BWY A;  1I78 A;  1TOU A;  1SRJ A;  2AT6 X;  2X45 A;  2Y3E A;  4ORY A;  4ZH6 A;  1NC9 A;  2L68 A;  1SY2 A;  3I0A A;  1E2T A;  1OPB A;  3LHN A;  3HWE A;  1QY2 A;  1ZNE A;  4MEE A;  1EW3 A;  1I06 A;  1LCV A;  2G7B A;  2IZG B;  3TGA A;  3VG3 A;  1NGL A;  1VWL B;  1IIU A;  1KT6 A;  3G7X A;  4I3C A;  4QZT A;  5JD2 A;  1LIB A;  3WJD A;  3E3C A;  4I3B A;  4ZR2 A;  1DV9 A;  2FR2 A;  4FBV A;  4BX7 A;  4ZGU A;  1T68 X;  5CSE A;  1TW4 A;  1KT7 A;  2OF8 A;  2QO5 A;  3O22 A;  1IKJ A;  2X8F A;  1KXO A;  5HTD A;  4B55 A;  1LF7 A;  2Q39 A;  4DQ4 A;  1BLR A;  1L6M A;  1JQP A;  1JZU A;  2LKK A;  4I9R A;  3RDM A;  1KOI A;  2Y32 A;  2Y3F A;  4IB6 A;  2RTH B;  3MX7 A;  4GGT A;  4CK4 A;  3O2Y A;  5IRU A;  4TQ2 A;  4BCS A;  4NV7 A;  4CDD A;  1QAB E;  4QNI A;  1ICN A;  2OL6 O;  1H91 A;  1JYJ A;  4JO6 A;  4OMW A;  3T2W A;  4CPH A;  1EI5 A;  1IJ8 A;  1DZP A;  2HNX A;  4Y0S A;  1OPA A;  5HZ9 A;  1KL3 A;  1SLF B;  1AVE A;  1VYG A;  4NNS A;  1GT5 A;  3CKG A;  3WVM A;  2MM3 A;  2K62 A;  4EXZ A;  1TOW A;  1SWF A;  2A8G A;  4I3D A;  1BSY A;  1ERB A;  4HPD A;  1MDC A;  2A2G A;  3AEH A;  3OD9 A;  4GJS A;  4YFQ A;  5H9K A;  3T6L A;  2FKG A;  2ANS A;  2F09 A;  1QFT A;  1SRH A;  5KIC A;  1WUB A;  2CZU A;  4YKM A;  4OS8 A;  1PEE A;  3UEX A;  3NQK A;  4GK9 A;  4KC7 A;  2WEX A;  4ZHF A;  1TXL A;  1W5R A;  2POA A;  4YFP A;  1ERX A;  5L8O A;  3RSW A;  2JOZ A;  2CM4 A;  3MBT A;  3SZI A;  1A3Y A;  1MUP A;  1OEK A;  2AT8 X;  1LKE A;  1VWD B;  1EXS A;  2RTI B;  4ALO A;  4MVI A;  3ZW0 A;  1YIV A;  1EPA A;  1X71 A;  3B2H A;  3FEL A;  4K19 A;  1ACD A;  1OEJ A;  3FEK A;  1BEB A;  5LJG A;  1SWN A;  1URE A;  3ZUI A;  3EBK A;  2ZAI A;  1AVD A;  4AZR A;  1SRI A;  2LB6 A;  4BX5 A;  5F1E A;  1IKE A;  5HA1 A;  3AKM A;  1EII A;  2GJ5 A;  3Q34 A;  1O1V A;  2A13 A;  4XMD A;  4Y5D A;  5B27 A;  3VG5 A;  4ZHC A;  3CMP A;  3OBL A;  4AZO A;  2RN4 A;  4U8U M;  1LID A;  2GTL M;  2RTJ A;  4BX6 B;  5IXG A;  2MWH A;  3FR2 A;  1YWD A;  4U9C A;  3VHH A;  4AYH A;  1KQX A;  5KID A;  1VWO B;  1HMR A;  5HWZ A;  3HOE A;  5B29 A;  1CBS A;  5JR8 A;  4ZGF A;  3BY0 A;  1BSQ A;  3NX1 A;  4LQZ A;  1RXH A;  3WZN A;  1ML7 A;  3WYP A;  2KTS A;  3S60 A;  3ZZV A;  1LUQ A;  4IAX A;  4IAW A;  5FEN A;  2JU3 A;  4CPF A;  1SXW A;  3EBW A;  2BSZ A;  4BOE A;  1HY2 A;  1LPJ A;  4A60 A;  2RTE B;  2HZQ A;  1SXX A;  4NW4 A;  2HYS A;  4ZFX A;  2M4L A;  3SLJ A;  1QY0 A;  5H9N A;  3C76 X;  2IZH B;  4L3R A;  2RTN B;  1LEL A;  3ZUO A;  1GT1 A;  3HWG A;  3FEP A;  2W2F A;  2AVI A;  2JW1 A;  3OE3 A;  5D4A A;  4BX7 B;  1GGL A;  1YP7 A;  4MVL A;  4ZHD A;  2Z4H A;  5HZ8 A;  2RTC B;  2L9C A;  4OEL A;  2RTG B;  2A5B A;  4MVK A;  4AZM A;  1YWC A;  1ZND A;  5EDC A;  2DM5 A;  4EKV A;  2ZAG A;  1IFB A;  1VYF A;  2NND A;  3HOL A;  4YBU A;  1I4U A;  2Q9S A;  2OFB A;  2OL8 O;  4ARH A;  4XMH A;  2RTB B;  3F6Z B;  3HWD A;  4GKC A;  2JN3 A;  5F58 A;  1U0X A;  4YFR A;  3L4R A;  3JS1 A;  4EQA C;  4GNY A;  3ZWE A;  4EFG A;  4IMN A;  1AB0 A;  4QRL A;  2RCQ A;  3RWX A;  3RE5 A;  4TKH A;  4AZN A;  2OY8 A;  4GGR A;  1DF8 A;  1HXZ A;  3UAQ A;  2CBR A;  3D9W A;  3TGB A;  4CDC A;  4CV7 A;  3WOV A;  4QGW A;  4C5P A;  1NBX A;  2BLG A;  2QM9 A;  3HK1 A;  2UYW A;  3WZO A;  4ES7 A;  1VWE B;  5AQ6 A;  3NAD A;  3FW4 A;  1A2D A;  3FEN A;  3FIQ A;  3DSZ A;  4ODD A;  2OFR X;  3P6F A;  4WFU A;  2IZC B;  4FGI B;  3F8A A;  4IB9 A;  3UEW A;  1I05 A;  1PBO A;  1R0U A;  2N93 A;  3Q6L A;  4M7M A;  5LKE A;  2OFM X;  4NYR A;  2AMM X;  2OFA A;  3PDF A;  5F6Z A;  2WEW A;  3JSQ A;  5D47 A;  4GD9 A;  3ZW0 B;  1GT3 A;  4Z27 A;  4MVE A;  3RDQ A;  4CDF A;  3APW A;  4BJ8 A;  4PJ2 A;  1Y52 X;  2XST A;  1YP6 A;  1SY1 A;  2C1S A;  2R56 A;  3BDR A;  5IO7 A;  1W6F A;  2OVD A;  1AVG I;  3NBX X;  1EQD A;  3CR6 A;  1PMP A;  1SRE A;  1VWJ B;  1ZNL A;  2X8S A;  3PED A;  3NX2 A;  4GU8 A;  3HWF A;  1MK5 A;  4TKB A;  2WPU A;  4YKO A; 
#chains in the Genus database with same CATH homology
 1HMS A;  1FEN A;  4MIR A;  4NYQ A;  5AEO A;  3VG2 A;  1B8E A;  3S5X A;  1GX9 A;  4QYP A;  1PM1 X;  1ICM A;  4Y0Q A;  1SA8 A;  2W2B A;  5AJC A;  2L67 A;  2WSJ A;  2HLV A;  5CYB A;  3LV4 A;  4AW8 A;  2XKL A;  3EM0 A;  4GET A;  3VU1 A;  4ORW A;  5CE4 A;  4RUU A;  2MO5 A;  3B2L A;  5H9L A;  1U18 A;  3NR3 A;  2ASN X;  4O4X A;  2YMS A;  1X8O A;  1MVG A;  2MJI A;  4EEJ A;  1FEM A;  4GNW A;  4KC8 A;  2BHV A;  1X89 A;  5EEE A;  2AT3 X;  3WJB A;  4I9S A;  5LKF A;  4ID2 A;  4ORS A;  2RCT A;  1GXA A;  4O9S A;  3K3L A;  4O3X B;  4QZU A;  1HMT A;  2CZT A;  4WFV A;  1JZU A;  2G78 A;  4N7D A;  3D96 A;  4ML7 B;  2WQA E;  5H9A A;  4NNT A;  1X8U A;  3P6G A;  1KT3 A;  3CQR A;  3SAO A;  4FQB B;  1MX7 A;  5BVT A;  1SY0 A;  2GC9 A;  2EU7 X;  4U8U O;  4KT5 A;  1GM6 A;  2FT9 A;  3H3I A;  5LJC A;  2GTL O;  4O49 A;  4HWM A;  1OBU A;  2LBA A;  3FA9 A;  1LIF A;  4L1N A;  2CBS A;  3PQU A;  3FMZ A;  4HPC A;  3RKG A;  4YCE A;  1UZ2 X;  4D6B A;  2RA6 A;  3PH5 A;  1XCA A;  3IFB A;  4ORR A;  1ZNG A;  2O62 A;  4XMC A;  4ALB A;  1VPR A;  4YGZ A;  1OEE A;  2AT5 X;  1EAL A;  3O19 A;  2IFB A;  5EDB A;  1IW2 A;  4BVM A;  3UEV A;  4YDA A;  4OS3 A;  2QOS C;  4KII A;  5KHP A;  2QMI A;  2LBV A;  1O8V A;  2L5P A;  3BU1 A;  2OZQ A;  1FDQ A;  3F9D A;  5FAZ A;  3VG4 A;  5LJB A;  1KZW A;  4ORU A;  1JIW I;  1X8Q A;  5HZQ A;  3JQO A;  4I6S A;  4IB7 A;  4LZV A;  1S44 A;  1Z24 A;  1B4M A;  1DZK A;  5L8N A;  2JMB A;  3VG7 A;  4BQU A;  1NP1 A;  2R74 A;  2KTD A;  1LNM A;  1JJX A;  3BSZ E;  1OBQ A;  1FE3 A;  2OVS A;  3S5V A;  3WJE A;  1HQP A;  1BM5 A;  4HPB A;  5HCE C;  1B56 A;  1SXU A;  2AT0 X;  3FR4 A;  1QQS A;  3ZW2 A;  5LJH A;  1LFO A;  4GZV A;  1T0V A;  2FR3 A;  3EMM A;  5FQ6 E;  1EIO A;  2MHD A;  4IB8 A;  4QQ1 A;  4COT A;  2JU8 A;  3CWK A;  3UEU A;  4YGH A;  3TZS A;  2FTB A;  1T8V A;  3STN A;  1B0O A;  3APX A;  3FA6 A;  4R0B A;  2OVE A;  5LJK A;  3TGC A;  4O4O A;  2AH7 X;  5HCC C;  2R73 A;  4YCH A;  3HTY A;  1AEL A;  2P8G A;  4UU3 A;  5BVS A;  5LJD A;  1CBI A;  1QFV A;  4IBA A;  4A1H A;  2GTF X;  2LA7 A;  3D95 A;  3U9P C;  1G7N A;  1BBP A;  3APV A;  3BX8 A;  5K06 A;  3V8U A;  1IFC A;  1S7D A;  2NNQ A;  3FA8 A;  5IO5 A;  2BS6 A;  1YWA A;  1E00 A;  2RQ0 A;  1A18 A;  4XMG A;  3KZA A;  5C0N A;  1HBP A;  2X46 A;  1QG5 A;  4O4U A;  1BRP A;  3VE1 A;  2FS7 A;  3CBC A;  4WHI A;  5EPQ A;  2Q2M A;  1YWB A;  3OJY C;  3GAQ A;  2ACP X;  3RBY A;  2ACO A;  4ZCB A;  2NP1 A;  2Q2P A;  1KT5 A;  1JYD A;  3N91 A;  1G5W A;  1I04 A;  4Y0P A;  2CM9 A;  4N7C A;  1GKA A;  3KFF A;  3WJC A;  2WR6 A;  4TJZ A;  4QGV A;  4YH0 A;  4U3Q A;  3P6E A;  1E5P A;  4IMO A;  1ADL A;  4IAB A;  4AZQ A;  3ZW1 A;  5D8J A;  5F7G A;  1SY3 A;  2KT4 B;  1D3S A;  2NNE A;  1LIE A;  1EPB A;  3QKG A;  5D48 A;  1A57 A;  1HBQ A;  3KFG A;  4MIS A;  1Y9T A;  1RLB E;  3FW5 A;  2X8T A;  5F6B A;  3WJG A;  4OMX A;  1AQB A;  4OS0 A;  3C78 X;  1QWD A;  2KW1 A;  4GRJ A;  1G74 A;  1KGL A;  1ZNK A;  3FYF A;  1ZRY A;  2AKQ A;  5D45 A;  3PH6 A;  2HMB A;  1BRQ A;  5IO6 A;  1RBP A;  1YUP A;  4TKJ A;  1BSO A;  3FR5 A;  4XME A;  3BS2 A;  3NPO A;  3SOT A;  3GE2 A;  2FLJ A;  2LFO A;  4YMY A;  2PY1 A;  4QGX A;  3ELX A;  1SXY A;  1GX8 A;  3P6D A;  1OBP A;  5AJB A;  3TF6 A;  1LIC A;  4GH7 A;  1GT4 A;  1HN2 A;  2KD2 A;  5HZ5 A;  5FQ8 E;  1DF3 A;  4A1Y A;  1SMP I;  4FBR A;  1CRB A;  2Z4I A;  5BYP A;  1CJ5 A;  5DPQ A;  4ZH9 A;  2A0A A;  3VPJ E;  4AZP A;  1ALB A;  4DQ3 A;  1G85 A;  3BX7 A;  3STM X;  3B2J A;  4ZJ0 A;  3KFI A;  4LKT A;  1KZX A;  4YGG A;  5HAE A;  4YBP A;  3B2I A;  3CQN A;  3FA7 A;  2E4J A;  4A8Z A;  3WXQ A;  4PSQ A;  5LJE A;  2WUT A;  3P24 A;  4O3W A;  4TLJ A;  1DC9 A;  3PQS A;  1E06 A;  3P6C A;  3U0D A;  2FWV A;  5L8I A;  3VG6 A;  3WBG A;  3BLG A;  2K23 A;  3WJF A;  1JJJ A;  4O4S A;  1TVQ A;  4RUN A;  3RZY A;  4XMF A;  4LZU A;  4EDE A;  3NQ3 A;  4ORX A;  3D4R A;  2RD7 C;  1KQW A;  3KQ0 A;  1FTP A;  4GDZ A;  1KT4 A;  3PPT A;  4ZHH A;  4D6A A;  3AKN A;  2QO6 A;  4Y0R A;  5LKE A;  3CBS A;  1U17 A;  3C77 X;  1XKI A;  3IA8 A;  3NQ9 A;  4INN A;  5FFH A;  3VE2 A;  2FRS A;  5BVQ A;  1DFV A;  5HCD C;  2BT9 A;  2JU7 A;  3NP1 A;  2QO4 A;  3PEC A;  1JV4 A;  5HZ6 A;  5HBS A;  1MX8 A;  4KCA A;  3ZQ3 A;  2ALL X;  3APU A;  4M6S A;  5EZ2 A;  5HA0 A;  1CBQ A;  4QYN A;  4FBO A;  3STK A;  2OVA A;  1GKA B;  3BU9 A;  1QY1 A;  3B2K A;  2Q4N A;  3EYC A;  3FLL A;  3ELZ A;  3PP6 A;  5HTE A;  2WWP A;  2F73 A;  1S2P A;  5H8T A;  3ZW1 B;  4I95 A;  4ZHG A;  1E02 A;  3T1D A;  3P6H A;  3S26 A;  4O3Z A;  1BJ7 A;  2HZR A;  1O1U A;  3ZI8 A;  4QAE A;  4YDB A;  1NP4 A;  3P02 A;  5FQ7 E;  1N0S A;  5DG4 A;  1X8N A;  4NLI A;  1D2U A;  1DZM A;  4TNN A;  4AZM A;  4ON1 A;  3D97 A;  1EUO A;  4LKP A;  3U03 A;  4NLJ A;  2AL0 X;  3DTQ A;  3I17 A;  4HPA A;  4WBK A;  1P6P A;  4NP1 A;  4HFO A;  4O3Y A;  2YG2 A;  1FEL A;  4GE1 A;  4UU2 A;  1ZNH A;  2G79 A;  4JGL A;  1DZJ A;  2A3F X;  3BRN A;  1Y9L A;  2BS5 A;  4CSB A;  2A2U A;  1X8P A;  3KFH A;  4U8U N;  3MVF A;  1CBR A;  4KH8 A;  2W2A A;  2WQ9 A;  5EED A;  2FS6 A;  2GTL N;  1JBH A;  1BWY A;  1TOU A;  2AT6 X;  2X45 A;  4ORY A;  4ZH6 A;  2L68 A;  1SY2 A;  3I0A A;  1OPB A;  3LHN A;  3HWE A;  1QY2 A;  1ZNE A;  1EW3 A;  1I06 A;  2G7B A;  3TGA A;  3VG3 A;  1NGL A;  4I3C A;  1IIU A;  1KT6 A;  3G7X A;  4QZT A;  1LIB A;  3WJD A;  3E3C A;  4I3B A;  4ZR2 A;  1DV9 A;  2FR2 A;  4FBV A;  4ZGU A;  1T68 X;  1TW4 A;  1KT7 A;  2QO5 A;  5HTD A;  3O22 A;  1IKJ A;  2X8F A;  1KXO A;  4DQ4 A;  1LF7 A;  2Q39 A;  1L6M A;  2LKK A;  4I9R A;  1KOI A;  4CK4 A;  4IB6 A;  3MX7 A;  3O2Y A;  4TQ2 A;  1QAB E;  4QNI A;  1ICN A;  4OMW A;  1H91 A;  1JYJ A;  1BLR A;  1EI5 A;  1DZP A;  2HNX A;  4Y0S A;  1OPA A;  5HZ9 A;  1VYG A;  4NNS A;  1GT5 A;  3WVM A;  2MM3 A;  2K62 A;  4EXZ A;  1TOW A;  4I3D A;  1BSY A;  1ERB A;  4HPD A;  1MDC A;  2A2G A;  3OD9 A;  4YFQ A;  5H9K A;  2ANS A;  2F09 A;  1QFT A;  5KIC A;  2CZU A;  4YKM A;  4OS8 A;  1PEE A;  3UEX A;  3NQK A;  4GK9 A;  4KC7 A;  2WEX A;  4ZHF A;  1TXL A;  2POA A;  4YFP A;  1ERX A;  5L8O A;  3RSW A;  2JOZ A;  2CM4 A;  3MBT A;  1A3Y A;  1MUP A;  1OEK A;  2AT8 X;  1LKE A;  1EXS A;  4ALO A;  4MVI A;  3ZW0 A;  1YIV A;  1EPA A;  1X71 A;  3B2H A;  3FEL A;  4K19 A;  1ACD A;  1OEJ A;  3FEK A;  1BEB A;  5LJG A;  3ZUI A;  1URE A;  3EBK A;  2ZAI A;  4AZR A;  2LB6 A;  5F1E A;  1IKE A;  5HA1 A;  3AKM A;  1EII A;  2GJ5 A;  1O1V A;  2A13 A;  4XMD A;  5B27 A;  3VG5 A;  4ZHC A;  3CMP A;  3OBL A;  4AZO A;  2RN4 A;  4U8U M;  1LID A;  2GTL M;  2MWH A;  3FR2 A;  1YWD A;  4U9C A;  4AYH A;  1KQX A;  5KID A;  1HMR A;  5HWZ A;  3HOE A;  5B29 A;  1CBS A;  5JR8 A;  4ZGF A;  3BY0 A;  1BSQ A;  3NX1 A;  4LQZ A;  1ML7 A;  3ZZV A;  2KTS A;  3S60 A;  4IAX A;  4IAW A;  5FEN A;  2JU3 A;  1SXW A;  3EBW A;  4BOE A;  1LPJ A;  4A60 A;  2HZQ A;  1SXX A;  4NW4 A;  2HYS A;  4ZFX A;  2M4L A;  1QY0 A;  5H9N A;  3C76 X;  4L3R A;  3ZUO A;  1GT1 A;  3HWG A;  3FEP A;  2W2F A;  3OE3 A;  2JW1 A;  5D4A A;  4ZHD A;  1GGL A;  1YP7 A;  4MVL A;  2Z4H A;  5HZ8 A;  2L9C A;  4MVK A;  1YWC A;  1ZND A;  5EDC A;  2DM5 A;  2ZAG A;  1IFB A;  1VYF A;  2NND A;  3HOL A;  4YBU A;  1I4U A;  2Q9S A;  4ARH A;  4XMH A;  3F6Z B;  3HWD A;  4GKC A;  2JN3 A;  5F58 A;  1U0X A;  4YFR A;  3L4R A;  3JS1 A;  4EQA C;  4GNY A;  3ZWE A;  4EFG A;  4IMN A;  1AB0 A;  4QRL A;  2RCQ A;  3RWX A;  4TKH A;  4AZN A;  3UAQ A;  2CBR A;  3TGB A;  4CV7 A;  3WOV A;  4QGW A;  2QM9 A;  2BLG A;  3HK1 A;  4ES7 A;  5AQ6 A;  3NAD A;  3FW4 A;  1A2D A;  3FEN A;  3FIQ A;  3DSZ A;  4ODD A;  2OFR X;  3P6F A;  4WFU A;  4FGI B;  3F8A A;  4IB9 A;  3UEW A;  1I05 A;  1PBO A;  1R0U A;  2N93 A;  3Q6L A;  4M7M A;  2OFM X;  4NYR A;  2AMM X;  5F6Z A;  2WEW A;  3JSQ A;  5D47 A;  3ZW0 B;  1GT3 A;  4MVE A;  3APW A;  4PJ2 A;  2XST A;  1YP6 A;  1SY1 A;  3BDR A;  2R56 A;  5IO7 A;  2OVD A;  1AVG I;  3NBX X;  1EQD A;  3CR6 A;  1PMP A;  1ZNL A;  2X8S A;  3PED A;  4TKB A;  4GU8 A;  3NX2 A;  3HWF A;  4YKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...