3WJGA

Crystal structure of mutant nitrobindin m75l/h76l/q96c/m148w/h158l (nb10) from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPLLAESGYFRPRPDGSIEVVIACSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRWSTTTNPLQPLLKAILDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0678 fatty acid-binding protein-like protein At1g79260
publication title A Rhodium Complex-linked Hybrid Biocatalyst: Stereo-controlled Phenylacetylene Polymerization within an Engineered Protein Cavity
doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08768 DUF1794 Domain of unknown function (DUF1794)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3wjgA00
3EM0A 1BSQA 1GT1A 1ZNDA 4ZR2A 1HN2A 4A8ZA 5F1EA 5DPQA 1EPBA 3FA8A 4MVIA 4GNYA 4EFGA 1X89A 2AL0X 1YWCA 1X8PA 2MJIA 4XMCA 4DQ4A 1AELA 1E02A 1BRQA 5H9AA 2A2GA 5KICA 1CJ5A 1NP1A 1YIVA 1SY1A 1DZKA 3EBKA 1LICA 1QG5A 1BWYA 1O1VA 5HZ9A 1N0SA 3VG2A 1LF7A 2GJ5A 1VPRA 2FS6A 3B2KA 3F8AA 2L9CA 4TLJA 4WFUA 1KT6A 1ICNA 1IIUA 5H9LA 5LKEA 2RQ0A 1X8NA 1JYJA 2Q39A 3KFIA 3FR4A 4HFOA 3P6CA 1BM5A 1CBIA 1SXYA 3UEWA 1GM6A 1KT3A 2P8GA 5HZ6A 3FIQA 1LIBA 1YUPA 4IAWA 4A1YA 4ZHCA 1DF3A 1EW3A 5LJEA 4NNTA 3VG7A 2HZQA 2QM9A 3BRNA 3IFBA 3BS2A 1AB0A 3BX8A 4RUUA 2CM4A 4GE1A 1KT7A 3B2LA 4GKCA 4QAEA 1VYFA 3P6DA 3UEXA 1ALBA 4DQ3A 3TF6A 3WXQA 4IB8A 1A57A 3GAQA 5IO6A 1ADLA 1RLBE 2AH7X 5LJCA 4EXZA 1ZNGA 3K3LA 3WJEA 1ERXA 1KT4A 2QO5A 2L68A 3C78X 3ELZA 3NR3A 3DTQA 2FTBA 1QY2A 3C77X 1GGLA 1SXUA 4YGHA 3CBSA 2OFMX 1CBSA 3KFHA 5BVQA 3KFFA 5C0NA 1T68X 1EALA 2BLGA 2JU8A 2W2BA 2HLVA 5LJKA 4N7CA 2E4JA 5HTEA 4NYRA 1G85A 4TKHA 5EDBA 2FWVA 1B4MA 5F7GA 1AQBA 3PH5A 1IW2A 3WJFA 2W2AA 5HCDC 2OVAA 3TGAA 3FEPA 4WFVA 3P6HA 1G5WA 4YH0A 5FENA 2NNEA 1I05A 3CWKA 4UU2A 1BSOA 4IBAA 3PEDA 3PH6A 2FR2A 3JS1A 3L4RA 4HPCA 4I9SA 1SXWA 5KHPA 1GXAA 1YWDA 2MM3A 2AT8X 2FS7A 4LKPA 4ES7A 4NYQA 4YKOA 3JSQA 1JJXA 3T1DA 1I4UA 1X8OA 3NX2A 4QZTA 4CK4A 4IB9A 1LKEA 1MX8A 1B56A 4OMXA 5EDCA 1JBHA 1A3YA 2NP1A 1EIOA 4I3DA 4AZQA 2AT6X 2POAA 3O22A 1GT3A 5H9NA 2RA6A 4ALOA 2N93A 1DZPA 3G7XA 4YFPA 3BY0A 3TGCA 2QOSC 4YDAA 1DZMA 2MO5A 5KIDA 2CM9A 2G7BA 2HYSA 4LZVA 4IB7A 3NP1A 3FR2A 1E5PA 1TOWA 3D95A 3C76X 4OS0A 4I3CA 1GX8A 3B2HA 3CR6A 1ACDA 4ZHDA 4YCEA 3BSZE 3PP6A 4BQUA 4GNWA 3WJCA 2QO4A 4QGXA 3WVMA 1X8QA 1FEMA 3U9PC 1S44A 1L6MA 3STKA 4Y0SA 4NP1A 3MBTA 2LB6A 3NADA 4AZPA 4ZH6A 4GRJA 1O1UA 4MVKA 4R0BA 1GT4A 1GX9A 4I9RA 5HA1A 5HCCC 1XCAA 3Q6LA 1SXXA 2A0AA 1SY0A 1UREA 1EPAA 4NLJA 2RCQA 4ZGUA 4ZHFA 3PECA 3I17A 3I0AA 3NQ9A 4ORYA 1MDCA 1IKEA 2R73A 1KGLA 4K19A 3FW5A 4TNNA 2ALLX 4LZUA 3MVFA 2O62A 4YGZA 3ZQ3A 1U0XA 1YWBA 4YCHA 4WBKA 3WJBA 1KZWA 3CMPA 3BDRA 2OFRX 1NP4A 3HWEA 3KFGA 2DM5A 2G78A 4GETA 5BVSA 1OPAA 2W2FA 4O9SA 4N7DA 1QY1A 3QKGA 3EBWA 1MUPA 2NNDA 3KQ0A 4YBPA 3VG5A 5L8NA 2LBAA 4MVLA 2WR6A 3FR5A 1XKIA 3B2JA 3O19A 2LKKA 2RCTA 1ZNLA 1GKAA 3FELA 3VG4A 5CE4A 1MVGA 4OMWA 5L8IA 2JU7A 4ZJ0A 1ZNKA 4A60A 2LFOA 4TJZA 3CBCA 3D96A 4ODDA 1QWDA 5HBSA 1MX7A 2A3FX 3FW4A 3CQRA 1FDQA 1LIDA 1LNMA 3FLLA 1R0UA 1LIEA 3VG6A 1I06A 4D6BA 4ZHHA 2AT0X 1HBPA 3ELXA 3VG3A 1EIIA 1D2UA 3KZAA 1QABE 4TKJA 2G79A 4ARHA 3TGBA 4EEJA 4XMEA 3FEKA 4ORXA 4UU3A 4YFQA 5FAZA 1O8VA 5LJGA 4NNSA 1SY2A 5H9KA 2FR3A 4IMNA 1EQDA 3OJYC 2OVEA 1CBRA 2PY1A 1D3SA 3RZYA 4M7MA 3APWA 3P6EA 4YMYA 3P6GA 3FA6A 1PBOA 3FA9A 4PSQA 1I04A 5HTDA 2LBVA 4AZRA 3HK1A 1HMSA 5HZ5A 2HMBA 4A1HA 1FELA 1E06A 3NX1A 1KQWA 2NNQA 4TKBA 4ORUA 1NGLA 1A18A 4ZCBA 1JYDA 5FFHA 2A13A 3D97A 2WUTA 2GTFX 5HZQA 5B29A 1OBUA 2FRSA 3FENA 1BLRA 4XMDA 1U18A 3ZUOA 2ANSA 5L8OA 1CRBA 3AKNA 2JN3A 1HBQA 1B0OA 1IFCA 1H91A 4ORRA 3BLGA 1BBPA 4KIIA 4RUNA 4ZFXA 2WEXA 2CZTA 3WJDA 5LKFA 2HNXA 2FLJA 1TW4A 2CBRA 3APXA 5EPQA 4XMFA 4IB6A 2L5PA 3O2YA 1X71A 1DFVA 4OS3A 3EMMA 3TZSA 1ICMA 1S7DA 1JZUA 5HZ8A 3FA7A 4IAXA 3UEUA 2WSJA 4ZH9A 4YBUA 5EZ2A 3FMZA 1LIFA 5D48A 4TQ2A 2Q2MA 3WBGA 2YG2A 5HAEA 1EXSA 2K23A 2WQAE 2OVDA 2CZUA 1SY3A 2R56A 3APUA 2L67A 2Q4NA 3HWFA 5D4AA 5BVTA 4HPBA 1OEEA 1GKAB 1ZNEA 1PEEA 3STNA 3U0DA 1AVGI 5F6BA 5K06A 2AMMX 5F58A 1T0VA 3F9DA 1DZJA 1FTPA 1OBQA 1PM1X 4EDEA 1CBQA 4BVMA 1LFOA 4QZUA 5F6ZA 1TVQA 1GT5A 1ERBA 2WEWA 4XMGA 1HQPA 1JV4A 5HCEC 1EUOA 1BEBA 1LPJA 2Q2PA 5JR8A 4ORWA 4D6AA 2X45A 3APVA 5H8TA 5HA0A 4QGVA 1X8UA 1YP7A 1ML7A 1OEJA 1BJ7A 4YDBA 3B2IA 4M6SA 2A2UA 3STMX 4HPDA 1TOUA 2EU7X 1KOIA 4AZMA 2JOZA 5EEDA 4ALBA 5B27A 4QGWA 1KXOA 2XSTA 3EYCA 1U17A 4AW8A 3BU9A 2KTDA 3IA8A 1ZRYA 2AKQA 3CQNA 4I3BA 4QYNA 5D47A 3U03A 1E00A 1KZXA 3DSZA 1A2DA 4Y0QA 3PPTA 3NQ3A 1SA8A 1OBPA 4HPAA 3UEVA 1JJJA 1G74A 1BSYA 1FE3A 1KQXA 3NPOA 1HMRA 3S26A 4AZNA 1T8VA 4LKTA 2OZQA 1B8EA 2ASNX 4YGGA 5AQ6A 1BRPA 3BX7A 1G7NA 5LJDA 2ACOA 4AYHA 1ZNHA 4AZOA 1P6PA 5DG4A 1IFBA 2X46A 4GH7A 1OEKA 1UZ2X 1Z24A 2HZRA 4NLIA 1HMTA 3WJGA 3HWGA 5EEEA 3RSWA 3AKMA 2F73A 2R74A 2AT5X 1IKJA 4OS8A 2WQ9A 1OPBA 2AT3X 1PMPA 1YP6A 2FT9A 2JU3A 1QFTA 1S2PA 2ACPX 2Q9SA 4ZHGA 5D8JA 2IFBA 5LJHA 2KT4B 1VYGA 1YWAA 2QO6A 4YKMA 5D45A 2K62A 3HWDA 2RD7C 3P6FA 5HWZA 1QQSA 4QYPA 5IO7A 2WWPA 1QY0A 1FENA 4ORSA 2XKLA 3ZUIA 4Y0PA 4YFRA 1TXLA 2GC9A 5LJBA 5IO5A 1QFVA 1RBPA 4BOEA 1KT5A 3SAOA 1DC9A 4IMOA 2CBSA 1DV9A 3BU1A 4Y0RA 4XMHA
chains in the Genus database with same CATH superfamily
3EM0A 1BSQA 1GT1A 3VHIA 1ZNDA 2UZ2A 4ZR2A 1HN2A 1K3BA 5AJBA 2A8GA 2I5ZO 4A8ZA 5F1EA 5DPQA 4CPHA 3GE2A 4O49A 1EPBA 3FA8A 4MVIA 4GNYA 4EFGA 1GX3A 1X89A 2AL0X 1YWCA 1X8PA 2MJIA 2I5VO 4XMCA 4DQ4A 1AELA 1E02A 5IRUA 1BRQA 5H9AA 4BGFA 2A2GA 3RDMA 2PI3O 1NP1A 1VWNB 1YIVA 1SY1A 3RDQA 4CDEA 5KICA 1DZKA 3EBKA 1LICA 1QG5A 4ZGFA 1BWYA 3ZW1A 1O1VA 3HPEA 1N0SA 5HZ9A 3VG2A 1LF7A 2GJ5A 3PDFA 3PK2A 1VPRA 1SWGA 2BS6A 2FS6A 1RSTB 3B2KA 2IZKA 2L9CA 3F8AA 4EKVA 4TLJA 4WFUA 1KT6A 1ICNA 1IIUA 5H9LA 5LKEA 2RQ0A 1X8NA 3FIDA 1JYJA 1VWBB 2Q39A 4ML7B 3KFIA 3FR4A 4HFOA 3VE1A 3P6CA 2VFBA 4EQAC 3MG5A 1BM5A 4O4XA 1CBIA 1RSUB 2VDFA 1SXYA 1N9MA 3UEWA 1LCZA 4BJ8A 3WOVA 1GM6A 1KT3A 1SMPI 1OSPO 2P8GA 2RTPB 2Y3EA 2F09A 1LIBA 1YUPA 1AVDA 3FIQA 4IAWA 3WZOA 4A1YA 1EW3A 4ZHCA 1SLFB 4NNTA 1Y52X 2HZQA 2QM9A 3VG7A 5LJEA 3BRNA 3IFBA 3BS2A 1AB0A 3BX8A 3P24A 2CM4A 4RUUA 4BX7A 4I6SA 4GE1A 1KT7A 3B2LA 4GKCA 4QAEA 1VYFA 3P6DA 1NQNA 3UEXA 2OYBO 4QNIA 1ALBA 4DQ3A 3TF6A 3WXQA 3ZI8A 4IB8A 3SLTA 3GAQA 5IO6A 4FGIB 1A57A 1ADLA 1RLBE 4CSBA 3JQOA 4U8UN 1SLGB 2AH7X 3SOTA 4O3XB 5LJCA 3VHHA 4EXZA 4U46A 1ZNGA 4U3QA 5IXGA 1SWNA 3K3LA 4U8UM 1SWKA 3WJEA 5IRWA 1ERXA 1KT4A 2QO5A 2L68A 3C78X 3ELZA 3NR3A 3DTQA 2FTBA 1QY2A 3C77X 1GGLA 2GH7A 1SXUA 4GDZA 4YGHA 2OL8O 1VWQB 3CBSA 3ZW2A 1IJ8A 1VWJB 2OFMX 1CBSA 3KFHA 5BVQA 1FJ1E 4CDCA 3KFFA 4GGTA 5C0NA 1T68X 1EALA 2RTFB 1W5RA 2BLGA 2JU8A 2W2BA 2HLVA 3ZZVA 1VWLB 5LJKA 4N7CA 2E4JA 1LDQA 4NYRA 5HTEA 1G85A 4TKHA 5EDBA 2FWVA 1DF8A 4GU8A 1AQBA 1UYOX 5F7GA 3S5VA 1B4MA 3ZW0B 3PH5A 1IW2A 2BHVA 3WJFA 2W2AA 2GTLN 2OVAA 5HCDC 3TGAA 2OY8A 1STPA 3EW1A 3FEPA 2ZSCA 3P6HA 4WFVA 2X8FA 3NQKA 2NNEA 4YH0A 5FENA 1I05A 1G5WA 1UYNX 3CWKA 3F6ZB 4UU2A 1BSOA 2GTLM 2Y3FA 2OY1O 3PEDA 3PH6A 2FR2A 3JS1A 2RN4A 1WBIA 1KFFA 4IBAA 3L4RA 4HPCA 4I9SA 4QRLA 4GK9A 1SXWA 5KHPA 3WZQA 1GXAA 1YWDA 2MM3A 4U8UO 4PJ2A 2AT8X 4BBOA 2FS7A 4LKPA 4HWMA 4ES7A 4NYQA 4MISA 4YKOA 1SWAA 3JSQA 3RWXA 1JJXA 3T1DA 1I4UA 1X8OA 3NX2A 4QZTA 4CK4A 4CPHB 4IB9A 1LKEA 2C4IA 1MX8A 1B56A 2X32A 5B5FA 4OMXA 5EDCA 1JBHA 1A3YA 2NP1A 1EIOA 3E3CA 4I3DA 4AZQA 4FBVA 2AT6X 2POAA 3O22A 1GT3A 2QMIA 2RA6A 5H9NA 4ALOA 2N93A 1DZPA 1NDJA 2KD2A 4Y5DA 3G7XA 3ZW1B 4YFPA 2A5BA 5B11O 3BY0A 1LUQA 3TGCA 2QOSC 4YDAA 1DZMA 2MO5A 5JD2A 2CM9A 5KIDA 2G7BA 2HYSA 4GGRA 4IB7A 3NP1A 3FR2A 1E5PA 1TOWA 4LZVA 3D95A 2IZIA 3C76X 3RY1A 1SWTA 1I78A 4OS0A 3D4RA 4I3CA 5B3MO 2GTLO 2RTCB 1GX8A 3B2HA 3CR6A 1ACDA 3RY2A 4YCEA 4ZHDA 1MM9A 3BSZE 3PP6A 4BQUA 3S60A 4GNWA 4COTA 3EC5A 3WJCA 2QO4A 4QGXA 3WVMA 1X8QA 4CDDA 1FEMA 1PTSA 4U9CA 3U9PC 1S44A 2OY5O 1L6MA 2RTEB 3STKA 5B2AO 1KL3A 3FDCA 3ZWEA 2OVSA 2BT9A 4BX7B 4Y0SA 4NP1A 3MBTA 2LB6A 3NADA 4AZPA 4MVEA 4ZH6A 4GRJA 4CPEA 4KCAA 2RTAA 1AVEA 1O1UA 4ON1A 2KTSA 4MVKA 4R0BA 4CPFA 1GT4A 1GX9A 4I9RA 2RTQB 5HA1A 5HCCC 2C1SA 1XCAA 1W4TA 3Q6LA 1SXXA 2A0AA 1SY0A 2RTBB 1UREA 1RAVA 1N4JA 1EPAA 1SWSA 4NLJA 1CJ5A 2RCQA 4ZGUA 4ZHFA 3NBXX 1EI5A 3I17A 3PECA 3MX7A 2HKDA 3RDXA 3I0AA 3PQUA 4BX5A 3NQ9A 1SRJA 1MDCA 4ORYA 1IKEA 2R73A 1N43A 1VWMB 5CE4A 2UYWA 4O3WA 1KL5A 1KGLA 4K19A 2MHDA 3FW5A 4TNNA 1W6FA 1LDOA 2ALLX 2RTMA 4LZUA 3MVFA 1VWKB 2O62A 4I95A 4YGZA 2AVIA 2OL6O 1I9HA 5FQ7E 3ZQ3A 1LELA 1U0XA 1YWBA 4YCHA 1VWGB 4OEMA 4WBKA 3WJBA 1KZWA 1VYOA 1HY2A 2YMSA 5FQ6E 3CMPA 1RXJA 3BDRA 2OFRX 1N7YA 1NP4A 3HWEA 3KFGA 3CKFA 2C1QA 2ZAGA 2DM5A 1K24A 2G78A 4Z27A 4GETA 5BVSA 1OPAA 2W2FA 4O9SA 4N7DA 1QY1A 3QKGA 3EBWA 1NBXA 3T2XA 4I60A 1MUPA 2NNDA 3KQ0A 4YBPA 3VG5A 5L8NA 4FQBB 2LBAA 4KH8A 4MVLA 1SWLA 2WR6A 3FR5A 5K67A 1XKIA 2A5CA 1SRIA 2LKKA 1VWEB 2RCTA 1SRGA 1ZNLA 2RTIB 3B2JA 1GKAA 3FELA 3VG4A 2X56A 1MVGA 5AEOA 1MK5A 1VWDB 2Y32A 4L3RA 4OMWA 5L8IA 2JU7A 4ZJ0A 1ZNKA 2MWHA 1RXHA 4A60A 2LFOA 4TJZA 1Y0GA 3CBCA 3D96A 4QQ1A 4ODDA 1QWDA 4O3YA 2IZDB 5HBSA 1MX7A 2A3FX 3FW4A 4OELA 3CQRA 4O4UA 1FDQA 1LIDA 1LNMA 2X34A 3FLLA 1R0UA 1LIEA 3SZJA 2OFAA 1NQMA 1I06A 3VG6A 4JHQA 2Z4IA 4D6BA 4ZHHA 2AT0X 1HBPA 3ELXA 3VG3A 1EIIA 1D2UA 3KZAA 3SZIA 1Y53X 1QABE 2IZJA 4JNJA 4TKJA 1MOYA 2G79A 4KC7A 4ARHA 3TGBA 4EEJA 1VWAB 4XMEA 3OBLA 3FEKA 4ORXA 4UU3A 4YFQA 5FAZA 1O8VA 5LJGA 1E2TA 3MM0A 4NNSA 1SY2A 1LCVA 2FR3A 5H9KA 4IMNA 3OE3A 4KT5A 1EQDA 3T2WA 3OJYC 2MF6A 2OVEA 2FHNX 1CBRA 2PY1A 5K68A 4ID2A 1D3SA 3RZYA 3LV4A 3APWA 3P6EA 1SWPA 2JW1A 4M7MA 3P6GA 4YMYA 3FA6A 1PBOA 3FA9A 4PSQA 4Y59A 3WZNA 1I04A 5HTDA 4IABA 2LBVA 3HK1A 1HMSA 4AZRA 2HMBA 2IZGB 4A1HA 1FELA 5HZ5A 1E06A 1SWCA 3NX1A 1SRFA 1KQWA 2NNQA 4BX6A 1VWCB 4TKBA 3OD9A 4ORUA 1NGLA 1A18A 1SWRA 4ZCBA 1JYDA 5FFHA 2A13A 1WUBA 2OY7A 3D97A 2WUTA 1VWOB 2GTFX 5HZQA 3RDSA 5B29A 1OBUA 2FRSA 3FENA 4CPIA 1BLRA 2QCBA 4XMDA 5IRAA 1U18A 3SLJA 3N91A 2ANSA 3ZUOA 5L8OA 1SLDB 1CRBA 2BS5A 3AKNA 2JN3A 1HBQA 1B0OA 2G8CO 1IFCA 1H91A 4ORRA 3BLGA 1BBPA 4O3ZA 4IRWA 5CHKA 4KIIA 4RUNA 4ZFXA 2WEXA 4O4OA 4BX5B 2CZTA 3WJDA 5LKFA 1STRB 2HNXA 2FLJA 1TW4A 4O4SA 2CBRA 3APXA 5EPQA 4XMFA 4Z28A 4IB6A 2L5PA 3O2YA 1X71A 1DFVA 3WYQA 2FKGA 4OS3A 5BYPA 3H3IA 3EMMA 3RKGA 2BC3A 3TZSA 1ICMA 5B10O 2X8TA 2RTHB 3LTWA 1S7DA 1JZUA 5HZ8A 3FA7A 4Z6JA 4IAXA 3T6FA 3UEUA 2WSJA 2OF8A 4ZH9A 4YBUA 5EZ2A 3FMZA 1SWQA 1LIFA 5D48A 4TQ2A 2Q2MA 3WBGA 2YG2A 5HAEA 1PBYA 1EXSA 2K23A 2WQAE 2OVDA 2WPUA 2CZUA 1SY3A 2OFBA 2R56A 3APUA 2L67A 3Q34A 2Q4NA 4BCSA 3HWFA 5D4AA 4GZVA 1HXLA 2OL7A 2AF5A 5BVTA 1SWJA 4HPBA 1OEEA 1GKAB 1ZNEA 3AEHA 1PEEA 4NV7A 3STNA 1LCWA 3U0DA 5FQ8E 1AVGI 5F6BA 2IZLB 3RE6A 5K06A 2AMMX 5F58A 1T0VA 1VWIB 3F9DA 1VWFB 1DZJA 1FTPA 1SWFA 3QQ2A 4NW4A 2RTKA 1OBQA 2X8SA 1PM1X 4GJSA 4EDEA 4L1NA 1CBQA 4FBRA 3FYFA 1LFOA 4BVMA 3S5XA 2VFCA 4QZUA 5F6ZA 1TVQA 2RTJA 3LHNA 4KC8A 1GT5A 1ERBA 2WEWA 4XMGA 1DF3A 2RTNB 1SWOA 1HQPA 1Y9LA 3KVNA 1JV4A 5HCEC 1EUOA 4LQZA 1BEBA 1LPJA 2Q2PA 3EW2A 3WZPA 4ORWA 5JR8A 4GGZA 1RXKA 3SLOA 4D6AA 2X45A 3SZHA 5L3YA 1SREA 3APVA 5H8TA 5HA0A 4QGVA 1KL4A 2QOMA 1X8UA 1SWHA 2M4LA 2JMBA 4JO6A 2FKJA 1YP7A 1ML7A 1OEJA 1BJ7A 4YDBA 3B2IA 1JMXA 3VU1A 2IZBA 4MEEA 4M6SA 5CSEA 3RDOA 2A2UA 3HOEA 3STMX 2RTOB 4HPDA 1TOUA 4DCBA 2IZHB 2IZAA 2EU7X 1KOIA 1VWHB 4AZMA 2JOZA 5EEDA 4ALBA 5B27A 4C5PA 4QGWA 1JQPA 1KXOA 4GJVA 2XSTA 4Z2OA 4NV8A 2JGSA 3EYCA 1U17A 4AW8A 3BU9A 2KTDA 3IA8A 1ZRYA 2AKQA 2IZCB 3CQNA 4I3BA 4QYNA 5D47A 4DNEA 2IZFB 2G5LA 3U03A 1E00A 4BX6B 1KZXA 3DSZA 1A2DA 4Y0QA 1SWUA 1SWEA 2DJFA 2X4MA 1MEPA 3NQ3A 3PPTA 1SA8A 2X55A 1OBPA 4HPAA 3UEVA 1JJJA 1G74A 1BSYA 1FE3A 1KQXA 3NPOA 1HMRA 3S26A 4AZNA 1T8VA 4LKTA 3VGWA 2OZQA 1B8EA 2CAMA 2ASNX 4MIRA 4YGGA 5AQ6A 1BRPA 3BX7A 4GD9A 3T6LA 1G7NA 3X00A 1SWBA 1N9YA 3RDUA 5LJDA 2ACOA 3UAQA 4AYHA 1ZNHA 2RTRB 4AZOA 1P6PA 4Z2VA 4CV7A 5DG4A 1IFBA 2X46A 1Y55X 2DJGA 1JJUA 1NC9A 4GH7A 4CDFA 1OEKA 1UZ2X 1Z24A 4OKAA 2HZRA 4NLIA 1HMTA 1VWPB 2FGSA 1HXZA 4Z2PA 3WJGA 3HWGA 3VPJE 1VWRB 3CKGA 1Y9TA 2KW1A 5EEEA 3WYPA 3RSWA 3AKMA 2F73A 2R74A 2AT5X 1IKJA 5B5GA 2RTDB 1SWDA 5F2BA 4OS8A 2WQ9A 3PQSA 1SRHA 1OPBA 2AT3X 2RTLA 2LA7A 2BSZA 1PMPA 1YP6A 2FT9A 2JU3A 3RE5A 2FHLA 1JMZA 4GDAA 3HTYA 3V8UA 2F01A 1QFTA 1S2PA 2ACPX 2Q9SA 2RTGB 4ZHGA 2OF9A 5D8JA 2IFBA 5LJHA 2KT4B 3VHMA 4WHIA 1VYGA 1JIWI 1YWAA 5AJCA 2QO6A 4YKMA 3AUMO 5D45A 2K62A 3HOLA 3HWDA 2IZEB 1SLEB 5CYBA 3VE2A 4JGLA 5HZ6A 4INNA 2RD7C 4GUZA 4YVBA 3ZW0A 3P6FA 5HWZA 1QQSA 4QYPA 5IO7A 2WWPA 3P02A 1QY0A 1FENA 4ORSA 2XKLA 3ZUIA 4Y0PA 3D9WA 3RBYA 4YFRA 1TXLA 2GC9A 5LJBA 4B55A 5IO5A 2Z4HA 1QFVA 1RBPA 4BOEA 1KT5A 2ZAIA 4FBOA 3SAOA 1DC9A 3O19A 1HQQA 4IMOA 1STSB 2CBSA 1DV9A 3BU1A 4Y0RA 4XMHA
chains in the Genus database with same CATH topology
3EM0A 1BSQA 1GT1A 1ZNDA 4ZR2A 1HN2A 5AJBA 4A8ZA 5F1EA 5DPQA 3GE2A 4O49A 1EPBA 3FA8A 4MVIA 4GNYA 4EFGA 1X89A 2AL0X 1YWCA 1X8PA 2MJIA 4XMCA 4DQ4A 1AELA 1E02A 1BRQA 5H9AA 2A2GA 5KICA 1CJ5A 1NP1A 1YIVA 1SY1A 1DZKA 3EBKA 1LICA 1QG5A 4ZGFA 1BWYA 3ZW1A 1O1VA 5HZ9A 1N0SA 3VG2A 1LF7A 2GJ5A 1VPRA 2BS6A 2FS6A 3B2KA 3F8AA 2L9CA 4TLJA 4WFUA 1KT6A 1ICNA 1IIUA 5H9LA 5LKEA 2RQ0A 1X8NA 1JYJA 2Q39A 4ML7B 3KFIA 3FR4A 4HFOA 3VE1A 3P6CA 4EQAC 1BM5A 4O4XA 1CBIA 1SXYA 3UEWA 3WOVA 1GM6A 1KT3A 1SMPI 2P8GA 5HZ6A 2F09A 1LIBA 1YUPA 3FIQA 4IAWA 4A1YA 4ZHCA 1DF3A 1EW3A 5LJEA 4NNTA 3VG7A 2HZQA 2QM9A 3BRNA 3IFBA 3BS2A 1AB0A 3BX8A 3P24A 2CM4A 4RUUA 4I6SA 4GE1A 1KT7A 3B2LA 4GKCA 4QAEA 1VYFA 3P6DA 3UEXA 4QNIA 1ALBA 4DQ3A 3TF6A 3WXQA 3ZI8A 4IB8A 1A57A 3GAQA 5IO6A 4FGIB 1ADLA 1RLBE 4CSBA 3JQOA 4U8UN 2AH7X 3SOTA 4O3XB 5LJCA 4EXZA 1ZNGA 4U3QA 3K3LA 4U8UM 3WJEA 1ERXA 1KT4A 2QO5A 2L68A 3C78X 3ELZA 3NR3A 3DTQA 2FTBA 1QY2A 3C77X 1GGLA 4GDZA 1SXUA 4YGHA 3CBSA 3ZW2A 2OFMX 1CBSA 3KFHA 5BVQA 3KFFA 5C0NA 1T68X 1EALA 2BLGA 2JU8A 2W2BA 2HLVA 3ZZVA 5LJKA 4N7CA 2E4JA 5HTEA 4NYRA 1G85A 4TKHA 5EDBA 2FWVA 3S5VA 4GU8A 1AQBA 5F7GA 1B4MA 3ZW0B 3PH5A 1IW2A 2BHVA 3WJFA 2W2AA 2GTLN 2OVAA 5HCDC 3TGAA 3FEPA 4WFVA 3P6HA 1G5WA 2X8FA 3NQKA 2NNEA 4YH0A 5FENA 1I05A 3CWKA 3F6ZB 4UU2A 1BSOA 2GTLM 4IBAA 3PEDA 3PH6A 2FR2A 3JS1A 2RN4A 3L4RA 4HPCA 4I9SA 4QRLA 4GK9A 1SXWA 5KHPA 1GXAA 1YWDA 2MM3A 4U8UO 4PJ2A 2AT8X 2FS7A 4LKPA 4HWMA 4ES7A 4NYQA 4MISA 4YKOA 3JSQA 3RWXA 1JJXA 3T1DA 1I4UA 1X8OA 3NX2A 4QZTA 4CK4A 4IB9A 1LKEA 1MX8A 1B56A 4OMXA 5EDCA 1JBHA 1A3YA 2NP1A 1EIOA 3E3CA 4I3DA 4AZQA 4FBVA 2AT6X 2POAA 3O22A 1GT3A 2QMIA 2RA6A 5H9NA 4ALOA 2N93A 1DZPA 2KD2A 3G7XA 3ZW1B 4YFPA 3BY0A 3TGCA 2QOSC 4YDAA 1DZMA 2MO5A 5KIDA 2CM9A 2G7BA 2HYSA 4LZVA 4IB7A 3NP1A 3FR2A 1E5PA 1TOWA 3D95A 3C76X 4OS0A 3D4RA 4I3CA 2GTLO 1GX8A 3B2HA 3CR6A 1ACDA 4ZHDA 4YCEA 3BSZE 3PP6A 4BQUA 3S60A 4GNWA 4COTA 3WJCA 2QO4A 4QGXA 3WVMA 1X8QA 1FEMA 4U9CA 3U9PC 1S44A 1L6MA 3STKA 3ZWEA 2OVSA 2BT9A 4Y0SA 4NP1A 3MBTA 2LB6A 3NADA 4AZPA 4MVEA 4ZH6A 4GRJA 4KCAA 1O1UA 4ON1A 2KTSA 4MVKA 4R0BA 1GT4A 1GX9A 4I9RA 5HA1A 5HCCC 1XCAA 3Q6LA 1SXXA 2A0AA 1SY0A 1UREA 1EPAA 4NLJA 2RCQA 4ZGUA 4ZHFA 3NBXX 1EI5A 3I17A 3PECA 3MX7A 3I0AA 3PQUA 3NQ9A 4ORYA 1MDCA 1IKEA 2R73A 4O3WA 1KGLA 4K19A 2MHDA 3FW5A 4TNNA 2ALLX 4LZUA 3MVFA 2O62A 4I95A 4YGZA 5FQ7E 3ZQ3A 1U0XA 1YWBA 4YCHA 4WBKA 3WJBA 1KZWA 2YMSA 5FQ6E 3CMPA 3BDRA 2OFRX 1NP4A 3HWEA 3KFGA 2ZAGA 2DM5A 2G78A 4GETA 5BVSA 1OPAA 2W2FA 4O9SA 4N7DA 1QY1A 3QKGA 3EBWA 1MUPA 2NNDA 3KQ0A 4YBPA 3VG5A 5L8NA 4FQBB 2LBAA 4KH8A 4MVLA 2WR6A 3FR5A 1XKIA 3B2JA 3O19A 2LKKA 2RCTA 1ZNLA 1GKAA 3FELA 3VG4A 5AEOA 1MVGA 5CE4A 4L3RA 4OMWA 5L8IA 2JU7A 4ZJ0A 1ZNKA 2MWHA 4A60A 2LFOA 4TJZA 3CBCA 3D96A 4QQ1A 4ODDA 1QWDA 4O3YA 5HBSA 1MX7A 2A3FX 3FW4A 3CQRA 4O4UA 1FDQA 1LIDA 1LNMA 3FLLA 1R0UA 1LIEA 3VG6A 1I06A 2Z4IA 4D6BA 4ZHHA 2AT0X 1HBPA 3ELXA 3VG3A 1EIIA 1D2UA 3KZAA 1QABE 4TKJA 2G79A 4KC7A 4ARHA 3TGBA 4EEJA 4XMEA 3OBLA 3FEKA 4ORXA 4UU3A 4YFQA 5FAZA 1O8VA 5LJGA 4NNSA 1SY2A 5H9KA 2FR3A 4IMNA 3OE3A 4KT5A 1EQDA 3OJYC 2OVEA 1CBRA 2PY1A 4ID2A 1D3SA 3RZYA 3LV4A 3APWA 3P6EA 4M7MA 2JW1A 4YMYA 3P6GA 3FA6A 1PBOA 3FA9A 4PSQA 1I04A 5HTDA 4IABA 2LBVA 3HK1A 1HMSA 4AZRA 2HMBA 4A1HA 5HZ5A 1FELA 1E06A 3NX1A 1KQWA 2NNQA 4TKBA 3OD9A 4ORUA 1NGLA 1A18A 4ZCBA 1JYDA 5FFHA 2A13A 3D97A 2WUTA 2GTFX 5HZQA 5B29A 1OBUA 2FRSA 3FENA 1BLRA 4XMDA 1U18A 3N91A 2ANSA 3ZUOA 5L8OA 1CRBA 2BS5A 3AKNA 2JN3A 1HBQA 1B0OA 1IFCA 1H91A 4ORRA 3BLGA 1BBPA 4O3ZA 4KIIA 4RUNA 4ZFXA 2WEXA 4O4OA 2CZTA 3WJDA 5LKFA 2HNXA 2FLJA 1TW4A 4O4SA 2CBRA 3APXA 5EPQA 4XMFA 4IB6A 2L5PA 3O2YA 1X71A 1DFVA 4OS3A 5BYPA 3H3IA 3EMMA 3RKGA 3TZSA 1ICMA 2X8TA 1S7DA 1JZUA 5HZ8A 3FA7A 4IAXA 3UEUA 2WSJA 4ZH9A 4YBUA 5EZ2A 3FMZA 1LIFA 5D48A 4TQ2A 2Q2MA 3WBGA 2YG2A 5HAEA 1EXSA 2K23A 2WQAE 2OVDA 2CZUA 1SY3A 2R56A 3APUA 2L67A 2Q4NA 3HWFA 5D4AA 4GZVA 5BVTA 4HPBA 1OEEA 1GKAB 1ZNEA 1PEEA 3STNA 3U0DA 5FQ8E 1AVGI 5F6BA 5K06A 2AMMX 5F58A 1T0VA 3F9DA 1DZJA 1FTPA 4NW4A 2X8SA 1OBQA 1PM1X 4EDEA 4L1NA 1CBQA 4FBRA 3FYFA 1LFOA 4BVMA 3S5XA 4QZUA 5F6ZA 1TVQA 3LHNA 4KC8A 1GT5A 1ERBA 2WEWA 4XMGA 1HQPA 1Y9LA 1JV4A 5HCEC 1EUOA 4LQZA 1BEBA 1LPJA 2Q2PA 5JR8A 4ORWA 4D6AA 2X45A 3APVA 5H8TA 5HA0A 4QGVA 1X8UA 2M4LA 2JMBA 1YP7A 1ML7A 1OEJA 1BJ7A 4YDBA 3B2IA 3VU1A 4M6SA 2A2UA 3HOEA 3STMX 4HPDA 1TOUA 2EU7X 1KOIA 4AZMA 2JOZA 5EEDA 4ALBA 5B27A 4QGWA 1KXOA 2XSTA 3EYCA 1U17A 4AW8A 3BU9A 2KTDA 3IA8A 1ZRYA 2AKQA 3CQNA 4I3BA 4QYNA 5D47A 3U03A 1E00A 1KZXA 3DSZA 1A2DA 4Y0QA 3PPTA 3NQ3A 1SA8A 1OBPA 4HPAA 3UEVA 1JJJA 1G74A 1BSYA 1FE3A 1KQXA 3NPOA 1HMRA 3S26A 4AZNA 1T8VA 4LKTA 2OZQA 1B8EA 2ASNX 4MIRA 4YGGA 5AQ6A 1BRPA 3BX7A 1G7NA 5LJDA 2ACOA 3UAQA 4AYHA 1ZNHA 4CV7A 4AZOA 1P6PA 5DG4A 1IFBA 2X46A 4GH7A 1OEKA 1UZ2X 1Z24A 2HZRA 4NLIA 1HMTA 3WJGA 3HWGA 3VPJE 1Y9TA 2KW1A 5EEEA 3RSWA 3AKMA 2F73A 2R74A 2AT5X 1IKJA 4OS8A 2WQ9A 3PQSA 1OPBA 2AT3X 2LA7A 1PMPA 1YP6A 2FT9A 2JU3A 3HTYA 3V8UA 1QFTA 1S2PA 2ACPX 2Q9SA 4ZHGA 5D8JA 2IFBA 5LJHA 2KT4B 4WHIA 1VYGA 1JIWI 1YWAA 5AJCA 2QO6A 4YKMA 5D45A 2K62A 3HOLA 3HWDA 5CYBA 3VE2A 4JGLA 4INNA 2RD7C 3ZW0A 3P6FA 5HWZA 1QQSA 4QYPA 5IO7A 2WWPA 3P02A 1QY0A 1FENA 4ORSA 2XKLA 3ZUIA 4Y0PA 3RBYA 4YFRA 1TXLA 2GC9A 5LJBA 5IO5A 2Z4HA 1QFVA 1RBPA 4BOEA 1KT5A 2ZAIA 4FBOA 3SAOA 1DC9A 4IMOA 2CBSA 1DV9A 3BU1A 4Y0RA 4XMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EM0 A;  1BSQ A;  1GT1 A;  1ZND A;  4ZR2 A;  1HN2 A;  4A8Z A;  5F1E A;  5DPQ A;  1EPB A;  3FA8 A;  4MVI A;  4GNY A;  4EFG A;  1X89 A;  2AL0 X;  1YWC A;  1X8P A;  2MJI A;  4XMC A;  4DQ4 A;  1AEL A;  1E02 A;  1BRQ A;  5H9A A;  2A2G A;  5KIC A;  1CJ5 A;  1NP1 A;  1YIV A;  1SY1 A;  1DZK A;  3EBK A;  1LIC A;  1QG5 A;  1BWY A;  1O1V A;  5HZ9 A;  1N0S A;  3VG2 A;  1LF7 A;  2GJ5 A;  1VPR A;  2FS6 A;  3B2K A;  3F8A A;  2L9C A;  4TLJ A;  4WFU A;  1KT6 A;  1ICN A;  1IIU A;  5H9L A;  5LKE A;  2RQ0 A;  1X8N A;  1JYJ A;  2Q39 A;  3KFI A;  3FR4 A;  4HFO A;  3P6C A;  1BM5 A;  1CBI A;  1SXY A;  3UEW A;  1GM6 A;  1KT3 A;  2P8G A;  5HZ6 A;  3FIQ A;  1LIB A;  1YUP A;  4IAW A;  4A1Y A;  4ZHC A;  1DF3 A;  1EW3 A;  5LJE A;  4NNT A;  3VG7 A;  2HZQ A;  2QM9 A;  3BRN A;  3IFB A;  3BS2 A;  1AB0 A;  3BX8 A;  4RUU A;  2CM4 A;  4GE1 A;  1KT7 A;  3B2L A;  4GKC A;  4QAE A;  1VYF A;  3P6D A;  3UEX A;  1ALB A;  4DQ3 A;  3TF6 A;  3WXQ A;  4IB8 A;  1A57 A;  3GAQ A;  5IO6 A;  1ADL A;  1RLB E;  2AH7 X;  5LJC A;  4EXZ A;  1ZNG A;  3K3L A;  3WJE A;  1ERX A;  1KT4 A;  2QO5 A;  2L68 A;  3C78 X;  3ELZ A;  3NR3 A;  3DTQ A;  2FTB A;  1QY2 A;  3C77 X;  1GGL A;  1SXU A;  4YGH A;  3CBS A;  2OFM X;  1CBS A;  3KFH A;  5BVQ A;  3KFF A;  5C0N A;  1T68 X;  1EAL A;  2BLG A;  2JU8 A;  2W2B A;  2HLV A;  5LJK A;  4N7C A;  2E4J A;  5HTE A;  4NYR A;  1G85 A;  4TKH A;  5EDB A;  2FWV A;  1B4M A;  5F7G A;  1AQB A;  3PH5 A;  1IW2 A;  3WJF A;  2W2A A;  5HCD C;  2OVA A;  3TGA A;  3FEP A;  4WFV A;  3P6H A;  1G5W A;  4YH0 A;  5FEN A;  2NNE A;  1I05 A;  3CWK A;  4UU2 A;  1BSO A;  4IBA A;  3PED A;  3PH6 A;  2FR2 A;  3JS1 A;  3L4R A;  4HPC A;  4I9S A;  1SXW A;  5KHP A;  1GXA A;  1YWD A;  2MM3 A;  2AT8 X;  2FS7 A;  4LKP A;  4ES7 A;  4NYQ A;  4YKO A;  3JSQ A;  1JJX A;  3T1D A;  1I4U A;  1X8O A;  3NX2 A;  4QZT A;  4CK4 A;  4IB9 A;  1LKE A;  1MX8 A;  1B56 A;  4OMX A;  5EDC A;  1JBH A;  1A3Y A;  2NP1 A;  1EIO A;  4I3D A;  4AZQ A;  2AT6 X;  2POA A;  3O22 A;  1GT3 A;  5H9N A;  2RA6 A;  4ALO A;  2N93 A;  1DZP A;  3G7X A;  4YFP A;  3BY0 A;  3TGC A;  2QOS C;  4YDA A;  1DZM A;  2MO5 A;  5KID A;  2CM9 A;  2G7B A;  2HYS A;  4LZV A;  4IB7 A;  3NP1 A;  3FR2 A;  1E5P A;  1TOW A;  3D95 A;  3C76 X;  4OS0 A;  4I3C A;  1GX8 A;  3B2H A;  3CR6 A;  1ACD A;  4ZHD A;  4YCE A;  3BSZ E;  3PP6 A;  4BQU A;  4GNW A;  3WJC A;  2QO4 A;  4QGX A;  3WVM A;  1X8Q A;  1FEM A;  3U9P C;  1S44 A;  1L6M A;  3STK A;  4Y0S A;  4NP1 A;  3MBT A;  2LB6 A;  3NAD A;  4AZP A;  4ZH6 A;  4GRJ A;  1O1U A;  4MVK A;  4R0B A;  1GT4 A;  1GX9 A;  4I9R A;  5HA1 A;  5HCC C;  1XCA A;  3Q6L A;  1SXX A;  2A0A A;  1SY0 A;  1URE A;  1EPA A;  4NLJ A;  2RCQ A;  4ZGU A;  4ZHF A;  3PEC A;  3I17 A;  3I0A A;  3NQ9 A;  4ORY A;  1MDC A;  1IKE A;  2R73 A;  1KGL A;  4K19 A;  3FW5 A;  4TNN A;  2ALL X;  4LZU A;  3MVF A;  2O62 A;  4YGZ A;  3ZQ3 A;  1U0X A;  1YWB A;  4YCH A;  4WBK A;  3WJB A;  1KZW A;  3CMP A;  3BDR A;  2OFR X;  1NP4 A;  3HWE A;  3KFG A;  2DM5 A;  2G78 A;  4GET A;  5BVS A;  1OPA A;  2W2F A;  4O9S A;  4N7D A;  1QY1 A;  3QKG A;  3EBW A;  1MUP A;  2NND A;  3KQ0 A;  4YBP A;  3VG5 A;  5L8N A;  2LBA A;  4MVL A;  2WR6 A;  3FR5 A;  1XKI A;  3B2J A;  3O19 A;  2LKK A;  2RCT A;  1ZNL A;  1GKA A;  3FEL A;  3VG4 A;  5CE4 A;  1MVG A;  4OMW A;  5L8I A;  2JU7 A;  4ZJ0 A;  1ZNK A;  4A60 A;  2LFO A;  4TJZ A;  3CBC A;  3D96 A;  4ODD A;  1QWD A;  5HBS A;  1MX7 A;  2A3F X;  3FW4 A;  3CQR A;  1FDQ A;  1LID A;  1LNM A;  3FLL A;  1R0U A;  1LIE A;  3VG6 A;  1I06 A;  4D6B A;  4ZHH A;  2AT0 X;  1HBP A;  3ELX A;  3VG3 A;  1EII A;  1D2U A;  3KZA A;  1QAB E;  4TKJ A;  2G79 A;  4ARH A;  3TGB A;  4EEJ A;  4XME A;  3FEK A;  4ORX A;  4UU3 A;  4YFQ A;  5FAZ A;  1O8V A;  5LJG A;  4NNS A;  1SY2 A;  5H9K A;  2FR3 A;  4IMN A;  1EQD A;  3OJY C;  2OVE A;  1CBR A;  2PY1 A;  1D3S A;  3RZY A;  4M7M A;  3APW A;  3P6E A;  4YMY A;  3P6G A;  3FA6 A;  1PBO A;  3FA9 A;  4PSQ A;  1I04 A;  5HTD A;  2LBV A;  4AZR A;  3HK1 A;  1HMS A;  5HZ5 A;  2HMB A;  4A1H A;  1FEL A;  1E06 A;  3NX1 A;  1KQW A;  2NNQ A;  4TKB A;  4ORU A;  1NGL A;  1A18 A;  4ZCB A;  1JYD A;  5FFH A;  2A13 A;  3D97 A;  2WUT A;  2GTF X;  5HZQ A;  5B29 A;  1OBU A;  2FRS A;  3FEN A;  1BLR A;  4XMD A;  1U18 A;  3ZUO A;  2ANS A;  5L8O A;  1CRB A;  3AKN A;  2JN3 A;  1HBQ A;  1B0O A;  1IFC A;  1H91 A;  4ORR A;  3BLG A;  1BBP A;  4KII A;  4RUN A;  4ZFX A;  2WEX A;  2CZT A;  3WJD A;  5LKF A;  2HNX A;  2FLJ A;  1TW4 A;  2CBR A;  3APX A;  5EPQ A;  4XMF A;  4IB6 A;  2L5P A;  3O2Y A;  1X71 A;  1DFV A;  4OS3 A;  3EMM A;  3TZS A;  1ICM A;  1S7D A;  1JZU A;  5HZ8 A;  3FA7 A;  4IAX A;  3UEU A;  2WSJ A;  4ZH9 A;  4YBU A;  5EZ2 A;  3FMZ A;  1LIF A;  5D48 A;  4TQ2 A;  2Q2M A;  3WBG A;  2YG2 A;  5HAE A;  1EXS A;  2K23 A;  2WQA E;  2OVD A;  2CZU A;  1SY3 A;  2R56 A;  3APU A;  2L67 A;  2Q4N A;  3HWF A;  5D4A A;  5BVT A;  4HPB A;  1OEE A;  1GKA B;  1ZNE A;  1PEE A;  3STN A;  3U0D A;  1AVG I;  5F6B A;  5K06 A;  2AMM X;  5F58 A;  1T0V A;  3F9D A;  1DZJ A;  1FTP A;  1OBQ A;  1PM1 X;  4EDE A;  1CBQ A;  4BVM A;  1LFO A;  4QZU A;  5F6Z A;  1TVQ A;  1GT5 A;  1ERB A;  2WEW A;  4XMG A;  1HQP A;  1JV4 A;  5HCE C;  1EUO A;  1BEB A;  1LPJ A;  2Q2P A;  5JR8 A;  4ORW A;  4D6A A;  2X45 A;  3APV A;  5H8T A;  5HA0 A;  4QGV A;  1X8U A;  1YP7 A;  1ML7 A;  1OEJ A;  1BJ7 A;  4YDB A;  3B2I A;  4M6S A;  2A2U A;  3STM X;  4HPD A;  1TOU A;  2EU7 X;  1KOI A;  4AZM A;  2JOZ A;  5EED A;  4ALB A;  5B27 A;  4QGW A;  1KXO A;  2XST A;  3EYC A;  1U17 A;  4AW8 A;  3BU9 A;  2KTD A;  3IA8 A;  1ZRY A;  2AKQ A;  3CQN A;  4I3B A;  4QYN A;  5D47 A;  3U03 A;  1E00 A;  1KZX A;  3DSZ A;  1A2D A;  4Y0Q A;  3PPT A;  3NQ3 A;  1SA8 A;  1OBP A;  4HPA A;  3UEV A;  1JJJ A;  1G74 A;  1BSY A;  1FE3 A;  1KQX A;  3NPO A;  1HMR A;  3S26 A;  4AZN A;  1T8V A;  4LKT A;  2OZQ A;  1B8E A;  2ASN X;  4YGG A;  5AQ6 A;  1BRP A;  3BX7 A;  1G7N A;  5LJD A;  2ACO A;  4AYH A;  1ZNH A;  4AZO A;  1P6P A;  5DG4 A;  1IFB A;  2X46 A;  4GH7 A;  1OEK A;  1UZ2 X;  1Z24 A;  2HZR A;  4NLI A;  1HMT A;  3WJG A;  3HWG A;  5EEE A;  3RSW A;  3AKM A;  2F73 A;  2R74 A;  2AT5 X;  1IKJ A;  4OS8 A;  2WQ9 A;  1OPB A;  2AT3 X;  1PMP A;  1YP6 A;  2FT9 A;  2JU3 A;  1QFT A;  1S2P A;  2ACP X;  2Q9S A;  4ZHG A;  5D8J A;  2IFB A;  5LJH A;  2KT4 B;  1VYG A;  1YWA A;  2QO6 A;  4YKM A;  5D45 A;  2K62 A;  3HWD A;  2RD7 C;  3P6F A;  5HWZ A;  1QQS A;  4QYP A;  5IO7 A;  2WWP A;  1QY0 A;  1FEN A;  4ORS A;  2XKL A;  3ZUI A;  4Y0P A;  4YFR A;  1TXL A;  2GC9 A;  5LJB A;  5IO5 A;  1QFV A;  1RBP A;  4BOE A;  1KT5 A;  3SAO A;  1DC9 A;  4IMO A;  2CBS A;  1DV9 A;  3BU1 A;  4Y0R A;  4XMH A; 
#chains in the Genus database with same CATH topology
 3EM0 A;  1BSQ A;  1GT1 A;  3VHI A;  1ZND A;  2UZ2 A;  4ZR2 A;  1HN2 A;  1K3B A;  5AJB A;  2A8G A;  2I5Z O;  4A8Z A;  5F1E A;  5DPQ A;  4CPH A;  3GE2 A;  4O49 A;  1EPB A;  3FA8 A;  4MVI A;  4GNY A;  4EFG A;  1GX3 A;  1X89 A;  2AL0 X;  1YWC A;  1X8P A;  2MJI A;  2I5V O;  4XMC A;  4DQ4 A;  1AEL A;  1E02 A;  5IRU A;  1BRQ A;  5H9A A;  4BGF A;  2A2G A;  3RDM A;  2PI3 O;  1NP1 A;  1VWN B;  1YIV A;  1SY1 A;  3RDQ A;  4CDE A;  5KIC A;  1DZK A;  3EBK A;  1LIC A;  1QG5 A;  4ZGF A;  1BWY A;  3ZW1 A;  1O1V A;  3HPE A;  1N0S A;  5HZ9 A;  3VG2 A;  1LF7 A;  2GJ5 A;  3PDF A;  3PK2 A;  1VPR A;  1SWG A;  2BS6 A;  2FS6 A;  1RST B;  3B2K A;  2IZK A;  2L9C A;  3F8A A;  4EKV A;  4TLJ A;  4WFU A;  1KT6 A;  1ICN A;  1IIU A;  5H9L A;  5LKE A;  2RQ0 A;  1X8N A;  3FID A;  1JYJ A;  1VWB B;  2Q39 A;  4ML7 B;  3KFI A;  3FR4 A;  4HFO A;  3VE1 A;  3P6C A;  2VFB A;  4EQA C;  3MG5 A;  1BM5 A;  4O4X A;  1CBI A;  1RSU B;  2VDF A;  1SXY A;  1N9M A;  3UEW A;  1LCZ A;  4BJ8 A;  3WOV A;  1GM6 A;  1KT3 A;  1SMP I;  1OSP O;  2P8G A;  2RTP B;  2Y3E A;  2F09 A;  1LIB A;  1YUP A;  1AVD A;  3FIQ A;  4IAW A;  3WZO A;  4A1Y A;  1EW3 A;  4ZHC A;  1SLF B;  4NNT A;  1Y52 X;  2HZQ A;  2QM9 A;  3VG7 A;  5LJE A;  3BRN A;  3IFB A;  3BS2 A;  1AB0 A;  3BX8 A;  3P24 A;  2CM4 A;  4RUU A;  4BX7 A;  4I6S A;  4GE1 A;  1KT7 A;  3B2L A;  4GKC A;  4QAE A;  1VYF A;  3P6D A;  1NQN A;  3UEX A;  2OYB O;  4QNI A;  1ALB A;  4DQ3 A;  3TF6 A;  3WXQ A;  3ZI8 A;  4IB8 A;  3SLT A;  3GAQ A;  5IO6 A;  4FGI B;  1A57 A;  1ADL A;  1RLB E;  4CSB A;  3JQO A;  4U8U N;  1SLG B;  2AH7 X;  3SOT A;  4O3X B;  5LJC A;  3VHH A;  4EXZ A;  4U46 A;  1ZNG A;  4U3Q A;  5IXG A;  1SWN A;  3K3L A;  4U8U M;  1SWK A;  3WJE A;  5IRW A;  1ERX A;  1KT4 A;  2QO5 A;  2L68 A;  3C78 X;  3ELZ A;  3NR3 A;  3DTQ A;  2FTB A;  1QY2 A;  3C77 X;  1GGL A;  2GH7 A;  1SXU A;  4GDZ A;  4YGH A;  2OL8 O;  1VWQ B;  3CBS A;  3ZW2 A;  1IJ8 A;  1VWJ B;  2OFM X;  1CBS A;  3KFH A;  5BVQ A;  1FJ1 E;  4CDC A;  3KFF A;  4GGT A;  5C0N A;  1T68 X;  1EAL A;  2RTF B;  1W5R A;  2BLG A;  2JU8 A;  2W2B A;  2HLV A;  3ZZV A;  1VWL B;  5LJK A;  4N7C A;  2E4J A;  1LDQ A;  4NYR A;  5HTE A;  1G85 A;  4TKH A;  5EDB A;  2FWV A;  1DF8 A;  4GU8 A;  1AQB A;  1UYO X;  5F7G A;  3S5V A;  1B4M A;  3ZW0 B;  3PH5 A;  1IW2 A;  2BHV A;  3WJF A;  2W2A A;  2GTL N;  2OVA A;  5HCD C;  3TGA A;  2OY8 A;  1STP A;  3EW1 A;  3FEP A;  2ZSC A;  3P6H A;  4WFV A;  2X8F A;  3NQK A;  2NNE A;  4YH0 A;  5FEN A;  1I05 A;  1G5W A;  1UYN X;  3CWK A;  3F6Z B;  4UU2 A;  1BSO A;  2GTL M;  2Y3F A;  2OY1 O;  3PED A;  3PH6 A;  2FR2 A;  3JS1 A;  2RN4 A;  1WBI A;  1KFF A;  4IBA A;  3L4R A;  4HPC A;  4I9S A;  4QRL A;  4GK9 A;  1SXW A;  5KHP A;  3WZQ A;  1GXA A;  1YWD A;  2MM3 A;  4U8U O;  4PJ2 A;  2AT8 X;  4BBO A;  2FS7 A;  4LKP A;  4HWM A;  4ES7 A;  4NYQ A;  4MIS A;  4YKO A;  1SWA A;  3JSQ A;  3RWX A;  1JJX A;  3T1D A;  1I4U A;  1X8O A;  3NX2 A;  4QZT A;  4CK4 A;  4CPH B;  4IB9 A;  1LKE A;  2C4I A;  1MX8 A;  1B56 A;  2X32 A;  5B5F A;  4OMX A;  5EDC A;  1JBH A;  1A3Y A;  2NP1 A;  1EIO A;  3E3C A;  4I3D A;  4AZQ A;  4FBV A;  2AT6 X;  2POA A;  3O22 A;  1GT3 A;  2QMI A;  2RA6 A;  5H9N A;  4ALO A;  2N93 A;  1DZP A;  1NDJ A;  2KD2 A;  4Y5D A;  3G7X A;  3ZW1 B;  4YFP A;  2A5B A;  5B11 O;  3BY0 A;  1LUQ A;  3TGC A;  2QOS C;  4YDA A;  1DZM A;  2MO5 A;  5JD2 A;  2CM9 A;  5KID A;  2G7B A;  2HYS A;  4GGR A;  4IB7 A;  3NP1 A;  3FR2 A;  1E5P A;  1TOW A;  4LZV A;  3D95 A;  2IZI A;  3C76 X;  3RY1 A;  1SWT A;  1I78 A;  4OS0 A;  3D4R A;  4I3C A;  5B3M O;  2GTL O;  2RTC B;  1GX8 A;  3B2H A;  3CR6 A;  1ACD A;  3RY2 A;  4YCE A;  4ZHD A;  1MM9 A;  3BSZ E;  3PP6 A;  4BQU A;  3S60 A;  4GNW A;  4COT A;  3EC5 A;  3WJC A;  2QO4 A;  4QGX A;  3WVM A;  1X8Q A;  4CDD A;  1FEM A;  1PTS A;  4U9C A;  3U9P C;  1S44 A;  2OY5 O;  1L6M A;  2RTE B;  3STK A;  5B2A O;  1KL3 A;  3FDC A;  3ZWE A;  2OVS A;  2BT9 A;  4BX7 B;  4Y0S A;  4NP1 A;  3MBT A;  2LB6 A;  3NAD A;  4AZP A;  4MVE A;  4ZH6 A;  4GRJ A;  4CPE A;  4KCA A;  2RTA A;  1AVE A;  1O1U A;  4ON1 A;  2KTS A;  4MVK A;  4R0B A;  4CPF A;  1GT4 A;  1GX9 A;  4I9R A;  2RTQ B;  5HA1 A;  5HCC C;  2C1S A;  1XCA A;  1W4T A;  3Q6L A;  1SXX A;  2A0A A;  1SY0 A;  2RTB B;  1URE A;  1RAV A;  1N4J A;  1EPA A;  1SWS A;  4NLJ A;  1CJ5 A;  2RCQ A;  4ZGU A;  4ZHF A;  3NBX X;  1EI5 A;  3I17 A;  3PEC A;  3MX7 A;  2HKD A;  3RDX A;  3I0A A;  3PQU A;  4BX5 A;  3NQ9 A;  1SRJ A;  1MDC A;  4ORY A;  1IKE A;  2R73 A;  1N43 A;  1VWM B;  5CE4 A;  2UYW A;  4O3W A;  1KL5 A;  1KGL A;  4K19 A;  2MHD A;  3FW5 A;  4TNN A;  1W6F A;  1LDO A;  2ALL X;  2RTM A;  4LZU A;  3MVF A;  1VWK B;  2O62 A;  4I95 A;  4YGZ A;  2AVI A;  2OL6 O;  1I9H A;  5FQ7 E;  3ZQ3 A;  1LEL A;  1U0X A;  1YWB A;  4YCH A;  1VWG B;  4OEM A;  4WBK A;  3WJB A;  1KZW A;  1VYO A;  1HY2 A;  2YMS A;  5FQ6 E;  3CMP A;  1RXJ A;  3BDR A;  2OFR X;  1N7Y A;  1NP4 A;  3HWE A;  3KFG A;  3CKF A;  2C1Q A;  2ZAG A;  2DM5 A;  1K24 A;  2G78 A;  4Z27 A;  4GET A;  5BVS A;  1OPA A;  2W2F A;  4O9S A;  4N7D A;  1QY1 A;  3QKG A;  3EBW A;  1NBX A;  3T2X A;  4I60 A;  1MUP A;  2NND A;  3KQ0 A;  4YBP A;  3VG5 A;  5L8N A;  4FQB B;  2LBA A;  4KH8 A;  4MVL A;  1SWL A;  2WR6 A;  3FR5 A;  5K67 A;  1XKI A;  2A5C A;  1SRI A;  2LKK A;  1VWE B;  2RCT A;  1SRG A;  1ZNL A;  2RTI B;  3B2J A;  1GKA A;  3FEL A;  3VG4 A;  2X56 A;  1MVG A;  5AEO A;  1MK5 A;  1VWD B;  2Y32 A;  4L3R A;  4OMW A;  5L8I A;  2JU7 A;  4ZJ0 A;  1ZNK A;  2MWH A;  1RXH A;  4A60 A;  2LFO A;  4TJZ A;  1Y0G A;  3CBC A;  3D96 A;  4QQ1 A;  4ODD A;  1QWD A;  4O3Y A;  2IZD B;  5HBS A;  1MX7 A;  2A3F X;  3FW4 A;  4OEL A;  3CQR A;  4O4U A;  1FDQ A;  1LID A;  1LNM A;  2X34 A;  3FLL A;  1R0U A;  1LIE A;  3SZJ A;  2OFA A;  1NQM A;  1I06 A;  3VG6 A;  4JHQ A;  2Z4I A;  4D6B A;  4ZHH A;  2AT0 X;  1HBP A;  3ELX A;  3VG3 A;  1EII A;  1D2U A;  3KZA A;  3SZI A;  1Y53 X;  1QAB E;  2IZJ A;  4JNJ A;  4TKJ A;  1MOY A;  2G79 A;  4KC7 A;  4ARH A;  3TGB A;  4EEJ A;  1VWA B;  4XME A;  3OBL A;  3FEK A;  4ORX A;  4UU3 A;  4YFQ A;  5FAZ A;  1O8V A;  5LJG A;  1E2T A;  3MM0 A;  4NNS A;  1SY2 A;  1LCV A;  2FR3 A;  5H9K A;  4IMN A;  3OE3 A;  4KT5 A;  1EQD A;  3T2W A;  3OJY C;  2MF6 A;  2OVE A;  2FHN X;  1CBR A;  2PY1 A;  5K68 A;  4ID2 A;  1D3S A;  3RZY A;  3LV4 A;  3APW A;  3P6E A;  1SWP A;  2JW1 A;  4M7M A;  3P6G A;  4YMY A;  3FA6 A;  1PBO A;  3FA9 A;  4PSQ A;  4Y59 A;  3WZN A;  1I04 A;  5HTD A;  4IAB A;  2LBV A;  3HK1 A;  1HMS A;  4AZR A;  2HMB A;  2IZG B;  4A1H A;  1FEL A;  5HZ5 A;  1E06 A;  1SWC A;  3NX1 A;  1SRF A;  1KQW A;  2NNQ A;  4BX6 A;  1VWC B;  4TKB A;  3OD9 A;  4ORU A;  1NGL A;  1A18 A;  1SWR A;  4ZCB A;  1JYD A;  5FFH A;  2A13 A;  1WUB A;  2OY7 A;  3D97 A;  2WUT A;  1VWO B;  2GTF X;  5HZQ A;  3RDS A;  5B29 A;  1OBU A;  2FRS A;  3FEN A;  4CPI A;  1BLR A;  2QCB A;  4XMD A;  5IRA A;  1U18 A;  3SLJ A;  3N91 A;  2ANS A;  3ZUO A;  5L8O A;  1SLD B;  1CRB A;  2BS5 A;  3AKN A;  2JN3 A;  1HBQ A;  1B0O A;  2G8C O;  1IFC A;  1H91 A;  4ORR A;  3BLG A;  1BBP A;  4O3Z A;  4IRW A;  5CHK A;  4KII A;  4RUN A;  4ZFX A;  2WEX A;  4O4O A;  4BX5 B;  2CZT A;  3WJD A;  5LKF A;  1STR B;  2HNX A;  2FLJ A;  1TW4 A;  4O4S A;  2CBR A;  3APX A;  5EPQ A;  4XMF A;  4Z28 A;  4IB6 A;  2L5P A;  3O2Y A;  1X71 A;  1DFV A;  3WYQ A;  2FKG A;  4OS3 A;  5BYP A;  3H3I A;  3EMM A;  3RKG A;  2BC3 A;  3TZS A;  1ICM A;  5B10 O;  2X8T A;  2RTH B;  3LTW A;  1S7D A;  1JZU A;  5HZ8 A;  3FA7 A;  4Z6J A;  4IAX A;  3T6F A;  3UEU A;  2WSJ A;  2OF8 A;  4ZH9 A;  4YBU A;  5EZ2 A;  3FMZ A;  1SWQ A;  1LIF A;  5D48 A;  4TQ2 A;  2Q2M A;  3WBG A;  2YG2 A;  5HAE A;  1PBY A;  1EXS A;  2K23 A;  2WQA E;  2OVD A;  2WPU A;  2CZU A;  1SY3 A;  2OFB A;  2R56 A;  3APU A;  2L67 A;  3Q34 A;  2Q4N A;  4BCS A;  3HWF A;  5D4A A;  4GZV A;  1HXL A;  2OL7 A;  2AF5 A;  5BVT A;  1SWJ A;  4HPB A;  1OEE A;  1GKA B;  1ZNE A;  3AEH A;  1PEE A;  4NV7 A;  3STN A;  1LCW A;  3U0D A;  5FQ8 E;  1AVG I;  5F6B A;  2IZL B;  3RE6 A;  5K06 A;  2AMM X;  5F58 A;  1T0V A;  1VWI B;  3F9D A;  1VWF B;  1DZJ A;  1FTP A;  1SWF A;  3QQ2 A;  4NW4 A;  2RTK A;  1OBQ A;  2X8S A;  1PM1 X;  4GJS A;  4EDE A;  4L1N A;  1CBQ A;  4FBR A;  3FYF A;  1LFO A;  4BVM A;  3S5X A;  2VFC A;  4QZU A;  5F6Z A;  1TVQ A;  2RTJ A;  3LHN A;  4KC8 A;  1GT5 A;  1ERB A;  2WEW A;  4XMG A;  1DF3 A;  2RTN B;  1SWO A;  1HQP A;  1Y9L A;  3KVN A;  1JV4 A;  5HCE C;  1EUO A;  4LQZ A;  1BEB A;  1LPJ A;  2Q2P A;  3EW2 A;  3WZP A;  4ORW A;  5JR8 A;  4GGZ A;  1RXK A;  3SLO A;  4D6A A;  2X45 A;  3SZH A;  5L3Y A;  1SRE A;  3APV A;  5H8T A;  5HA0 A;  4QGV A;  1KL4 A;  2QOM A;  1X8U A;  1SWH A;  2M4L A;  2JMB A;  4JO6 A;  2FKJ A;  1YP7 A;  1ML7 A;  1OEJ A;  1BJ7 A;  4YDB A;  3B2I A;  1JMX A;  3VU1 A;  2IZB A;  4MEE A;  4M6S A;  5CSE A;  3RDO A;  2A2U A;  3HOE A;  3STM X;  2RTO B;  4HPD A;  1TOU A;  4DCB A;  2IZH B;  2IZA A;  2EU7 X;  1KOI A;  1VWH B;  4AZM A;  2JOZ A;  5EED A;  4ALB A;  5B27 A;  4C5P A;  4QGW A;  1JQP A;  1KXO A;  4GJV A;  2XST A;  4Z2O A;  4NV8 A;  2JGS A;  3EYC A;  1U17 A;  4AW8 A;  3BU9 A;  2KTD A;  3IA8 A;  1ZRY A;  2AKQ A;  2IZC B;  3CQN A;  4I3B A;  4QYN A;  5D47 A;  4DNE A;  2IZF B;  2G5L A;  3U03 A;  1E00 A;  4BX6 B;  1KZX A;  3DSZ A;  1A2D A;  4Y0Q A;  1SWU A;  1SWE A;  2DJF A;  2X4M A;  1MEP A;  3NQ3 A;  3PPT A;  1SA8 A;  2X55 A;  1OBP A;  4HPA A;  3UEV A;  1JJJ A;  1G74 A;  1BSY A;  1FE3 A;  1KQX A;  3NPO A;  1HMR A;  3S26 A;  4AZN A;  1T8V A;  4LKT A;  3VGW A;  2OZQ A;  1B8E A;  2CAM A;  2ASN X;  4MIR A;  4YGG A;  5AQ6 A;  1BRP A;  3BX7 A;  4GD9 A;  3T6L A;  1G7N A;  3X00 A;  1SWB A;  1N9Y A;  3RDU A;  5LJD A;  2ACO A;  3UAQ A;  4AYH A;  1ZNH A;  2RTR B;  4AZO A;  1P6P A;  4Z2V A;  4CV7 A;  5DG4 A;  1IFB A;  2X46 A;  1Y55 X;  2DJG A;  1JJU A;  1NC9 A;  4GH7 A;  4CDF A;  1OEK A;  1UZ2 X;  1Z24 A;  4OKA A;  2HZR A;  4NLI A;  1HMT A;  1VWP B;  2FGS A;  1HXZ A;  4Z2P A;  3WJG A;  3HWG A;  3VPJ E;  1VWR B;  3CKG A;  1Y9T A;  2KW1 A;  5EEE A;  3WYP A;  3RSW A;  3AKM A;  2F73 A;  2R74 A;  2AT5 X;  1IKJ A;  5B5G A;  2RTD B;  1SWD A;  5F2B A;  4OS8 A;  2WQ9 A;  3PQS A;  1SRH A;  1OPB A;  2AT3 X;  2RTL A;  2LA7 A;  2BSZ A;  1PMP A;  1YP6 A;  2FT9 A;  2JU3 A;  3RE5 A;  2FHL A;  1JMZ A;  4GDA A;  3HTY A;  3V8U A;  2F01 A;  1QFT A;  1S2P A;  2ACP X;  2Q9S A;  2RTG B;  4ZHG A;  2OF9 A;  5D8J A;  2IFB A;  5LJH A;  2KT4 B;  3VHM A;  4WHI A;  1VYG A;  1JIW I;  1YWA A;  5AJC A;  2QO6 A;  4YKM A;  3AUM O;  5D45 A;  2K62 A;  3HOL A;  3HWD A;  2IZE B;  1SLE B;  5CYB A;  3VE2 A;  4JGL A;  5HZ6 A;  4INN A;  2RD7 C;  4GUZ A;  4YVB A;  3ZW0 A;  3P6F A;  5HWZ A;  1QQS A;  4QYP A;  5IO7 A;  2WWP A;  3P02 A;  1QY0 A;  1FEN A;  4ORS A;  2XKL A;  3ZUI A;  4Y0P A;  3D9W A;  3RBY A;  4YFR A;  1TXL A;  2GC9 A;  5LJB A;  4B55 A;  5IO5 A;  2Z4H A;  1QFV A;  1RBP A;  4BOE A;  1KT5 A;  2ZAI A;  4FBO A;  3SAO A;  1DC9 A;  3O19 A;  1HQQ A;  4IMO A;  1STS B;  2CBS A;  1DV9 A;  3BU1 A;  4Y0R A;  4XMH A; 
#chains in the Genus database with same CATH homology
 3EM0 A;  1BSQ A;  1GT1 A;  1ZND A;  4ZR2 A;  1HN2 A;  5AJB A;  4A8Z A;  5F1E A;  5DPQ A;  3GE2 A;  4O49 A;  1EPB A;  3FA8 A;  4MVI A;  4GNY A;  4EFG A;  1X89 A;  2AL0 X;  1YWC A;  1X8P A;  2MJI A;  4XMC A;  4DQ4 A;  1AEL A;  1E02 A;  1BRQ A;  5H9A A;  2A2G A;  5KIC A;  1CJ5 A;  1NP1 A;  1YIV A;  1SY1 A;  1DZK A;  3EBK A;  1LIC A;  1QG5 A;  4ZGF A;  1BWY A;  3ZW1 A;  1O1V A;  5HZ9 A;  1N0S A;  3VG2 A;  1LF7 A;  2GJ5 A;  1VPR A;  2BS6 A;  2FS6 A;  3B2K A;  3F8A A;  2L9C A;  4TLJ A;  4WFU A;  1KT6 A;  1ICN A;  1IIU A;  5H9L A;  5LKE A;  2RQ0 A;  1X8N A;  1JYJ A;  2Q39 A;  4ML7 B;  3KFI A;  3FR4 A;  4HFO A;  3VE1 A;  3P6C A;  4EQA C;  1BM5 A;  4O4X A;  1CBI A;  1SXY A;  3UEW A;  3WOV A;  1GM6 A;  1KT3 A;  1SMP I;  2P8G A;  5HZ6 A;  2F09 A;  1LIB A;  1YUP A;  3FIQ A;  4IAW A;  4A1Y A;  4ZHC A;  1DF3 A;  1EW3 A;  5LJE A;  4NNT A;  3VG7 A;  2HZQ A;  2QM9 A;  3BRN A;  3IFB A;  3BS2 A;  1AB0 A;  3BX8 A;  3P24 A;  2CM4 A;  4RUU A;  4I6S A;  4GE1 A;  1KT7 A;  3B2L A;  4GKC A;  4QAE A;  1VYF A;  3P6D A;  3UEX A;  4QNI A;  1ALB A;  4DQ3 A;  3TF6 A;  3WXQ A;  3ZI8 A;  4IB8 A;  1A57 A;  3GAQ A;  5IO6 A;  4FGI B;  1ADL A;  1RLB E;  4CSB A;  3JQO A;  4U8U N;  2AH7 X;  3SOT A;  4O3X B;  5LJC A;  4EXZ A;  1ZNG A;  4U3Q A;  3K3L A;  4U8U M;  3WJE A;  1ERX A;  1KT4 A;  2QO5 A;  2L68 A;  3C78 X;  3ELZ A;  3NR3 A;  3DTQ A;  2FTB A;  1QY2 A;  3C77 X;  1GGL A;  4GDZ A;  1SXU A;  4YGH A;  3CBS A;  3ZW2 A;  2OFM X;  1CBS A;  3KFH A;  5BVQ A;  3KFF A;  5C0N A;  1T68 X;  1EAL A;  2BLG A;  2JU8 A;  2W2B A;  2HLV A;  3ZZV A;  5LJK A;  4N7C A;  2E4J A;  5HTE A;  4NYR A;  1G85 A;  4TKH A;  5EDB A;  2FWV A;  3S5V A;  4GU8 A;  1AQB A;  5F7G A;  1B4M A;  3ZW0 B;  3PH5 A;  1IW2 A;  2BHV A;  3WJF A;  2W2A A;  2GTL N;  2OVA A;  5HCD C;  3TGA A;  3FEP A;  4WFV A;  3P6H A;  1G5W A;  2X8F A;  3NQK A;  2NNE A;  4YH0 A;  5FEN A;  1I05 A;  3CWK A;  3F6Z B;  4UU2 A;  1BSO A;  2GTL M;  4IBA A;  3PED A;  3PH6 A;  2FR2 A;  3JS1 A;  2RN4 A;  3L4R A;  4HPC A;  4I9S A;  4QRL A;  4GK9 A;  1SXW A;  5KHP A;  1GXA A;  1YWD A;  2MM3 A;  4U8U O;  4PJ2 A;  2AT8 X;  2FS7 A;  4LKP A;  4HWM A;  4ES7 A;  4NYQ A;  4MIS A;  4YKO A;  3JSQ A;  3RWX A;  1JJX A;  3T1D A;  1I4U A;  1X8O A;  3NX2 A;  4QZT A;  4CK4 A;  4IB9 A;  1LKE A;  1MX8 A;  1B56 A;  4OMX A;  5EDC A;  1JBH A;  1A3Y A;  2NP1 A;  1EIO A;  3E3C A;  4I3D A;  4AZQ A;  4FBV A;  2AT6 X;  2POA A;  3O22 A;  1GT3 A;  2QMI A;  2RA6 A;  5H9N A;  4ALO A;  2N93 A;  1DZP A;  2KD2 A;  3G7X A;  3ZW1 B;  4YFP A;  3BY0 A;  3TGC A;  2QOS C;  4YDA A;  1DZM A;  2MO5 A;  5KID A;  2CM9 A;  2G7B A;  2HYS A;  4LZV A;  4IB7 A;  3NP1 A;  3FR2 A;  1E5P A;  1TOW A;  3D95 A;  3C76 X;  4OS0 A;  3D4R A;  4I3C A;  2GTL O;  1GX8 A;  3B2H A;  3CR6 A;  1ACD A;  4ZHD A;  4YCE A;  3BSZ E;  3PP6 A;  4BQU A;  3S60 A;  4GNW A;  4COT A;  3WJC A;  2QO4 A;  4QGX A;  3WVM A;  1X8Q A;  1FEM A;  4U9C A;  3U9P C;  1S44 A;  1L6M A;  3STK A;  3ZWE A;  2OVS A;  2BT9 A;  4Y0S A;  4NP1 A;  3MBT A;  2LB6 A;  3NAD A;  4AZP A;  4MVE A;  4ZH6 A;  4GRJ A;  4KCA A;  1O1U A;  4ON1 A;  2KTS A;  4MVK A;  4R0B A;  1GT4 A;  1GX9 A;  4I9R A;  5HA1 A;  5HCC C;  1XCA A;  3Q6L A;  1SXX A;  2A0A A;  1SY0 A;  1URE A;  1EPA A;  4NLJ A;  2RCQ A;  4ZGU A;  4ZHF A;  3NBX X;  1EI5 A;  3I17 A;  3PEC A;  3MX7 A;  3I0A A;  3PQU A;  3NQ9 A;  4ORY A;  1MDC A;  1IKE A;  2R73 A;  4O3W A;  1KGL A;  4K19 A;  2MHD A;  3FW5 A;  4TNN A;  2ALL X;  4LZU A;  3MVF A;  2O62 A;  4I95 A;  4YGZ A;  5FQ7 E;  3ZQ3 A;  1U0X A;  1YWB A;  4YCH A;  4WBK A;  3WJB A;  1KZW A;  2YMS A;  5FQ6 E;  3CMP A;  3BDR A;  2OFR X;  1NP4 A;  3HWE A;  3KFG A;  2ZAG A;  2DM5 A;  2G78 A;  4GET A;  5BVS A;  1OPA A;  2W2F A;  4O9S A;  4N7D A;  1QY1 A;  3QKG A;  3EBW A;  1MUP A;  2NND A;  3KQ0 A;  4YBP A;  3VG5 A;  5L8N A;  4FQB B;  2LBA A;  4KH8 A;  4MVL A;  2WR6 A;  3FR5 A;  1XKI A;  3B2J A;  3O19 A;  2LKK A;  2RCT A;  1ZNL A;  1GKA A;  3FEL A;  3VG4 A;  5AEO A;  1MVG A;  5CE4 A;  4L3R A;  4OMW A;  5L8I A;  2JU7 A;  4ZJ0 A;  1ZNK A;  2MWH A;  4A60 A;  2LFO A;  4TJZ A;  3CBC A;  3D96 A;  4QQ1 A;  4ODD A;  1QWD A;  4O3Y A;  5HBS A;  1MX7 A;  2A3F X;  3FW4 A;  3CQR A;  4O4U A;  1FDQ A;  1LID A;  1LNM A;  3FLL A;  1R0U A;  1LIE A;  3VG6 A;  1I06 A;  2Z4I A;  4D6B A;  4ZHH A;  2AT0 X;  1HBP A;  3ELX A;  3VG3 A;  1EII A;  1D2U A;  3KZA A;  1QAB E;  4TKJ A;  2G79 A;  4KC7 A;  4ARH A;  3TGB A;  4EEJ A;  4XME A;  3OBL A;  3FEK A;  4ORX A;  4UU3 A;  4YFQ A;  5FAZ A;  1O8V A;  5LJG A;  4NNS A;  1SY2 A;  5H9K A;  2FR3 A;  4IMN A;  3OE3 A;  4KT5 A;  1EQD A;  3OJY C;  2OVE A;  1CBR A;  2PY1 A;  4ID2 A;  1D3S A;  3RZY A;  3LV4 A;  3APW A;  3P6E A;  4M7M A;  2JW1 A;  4YMY A;  3P6G A;  3FA6 A;  1PBO A;  3FA9 A;  4PSQ A;  1I04 A;  5HTD A;  4IAB A;  2LBV A;  3HK1 A;  1HMS A;  4AZR A;  2HMB A;  4A1H A;  5HZ5 A;  1FEL A;  1E06 A;  3NX1 A;  1KQW A;  2NNQ A;  4TKB A;  3OD9 A;  4ORU A;  1NGL A;  1A18 A;  4ZCB A;  1JYD A;  5FFH A;  2A13 A;  3D97 A;  2WUT A;  2GTF X;  5HZQ A;  5B29 A;  1OBU A;  2FRS A;  3FEN A;  1BLR A;  4XMD A;  1U18 A;  3N91 A;  2ANS A;  3ZUO A;  5L8O A;  1CRB A;  2BS5 A;  3AKN A;  2JN3 A;  1HBQ A;  1B0O A;  1IFC A;  1H91 A;  4ORR A;  3BLG A;  1BBP A;  4O3Z A;  4KII A;  4RUN A;  4ZFX A;  2WEX A;  4O4O A;  2CZT A;  3WJD A;  5LKF A;  2HNX A;  2FLJ A;  1TW4 A;  4O4S A;  2CBR A;  3APX A;  5EPQ A;  4XMF A;  4IB6 A;  2L5P A;  3O2Y A;  1X71 A;  1DFV A;  4OS3 A;  5BYP A;  3H3I A;  3EMM A;  3RKG A;  3TZS A;  1ICM A;  2X8T A;  1S7D A;  1JZU A;  5HZ8 A;  3FA7 A;  4IAX A;  3UEU A;  2WSJ A;  4ZH9 A;  4YBU A;  5EZ2 A;  3FMZ A;  1LIF A;  5D48 A;  4TQ2 A;  2Q2M A;  3WBG A;  2YG2 A;  5HAE A;  1EXS A;  2K23 A;  2WQA E;  2OVD A;  2CZU A;  1SY3 A;  2R56 A;  3APU A;  2L67 A;  2Q4N A;  3HWF A;  5D4A A;  4GZV A;  5BVT A;  4HPB A;  1OEE A;  1GKA B;  1ZNE A;  1PEE A;  3STN A;  3U0D A;  5FQ8 E;  1AVG I;  5F6B A;  5K06 A;  2AMM X;  5F58 A;  1T0V A;  3F9D A;  1DZJ A;  1FTP A;  4NW4 A;  2X8S A;  1OBQ A;  1PM1 X;  4EDE A;  4L1N A;  1CBQ A;  4FBR A;  3FYF A;  1LFO A;  4BVM A;  3S5X A;  4QZU A;  5F6Z A;  1TVQ A;  3LHN A;  4KC8 A;  1GT5 A;  1ERB A;  2WEW A;  4XMG A;  1HQP A;  1Y9L A;  1JV4 A;  5HCE C;  1EUO A;  4LQZ A;  1BEB A;  1LPJ A;  2Q2P A;  5JR8 A;  4ORW A;  4D6A A;  2X45 A;  3APV A;  5H8T A;  5HA0 A;  4QGV A;  1X8U A;  2M4L A;  2JMB A;  1YP7 A;  1ML7 A;  1OEJ A;  1BJ7 A;  4YDB A;  3B2I A;  3VU1 A;  4M6S A;  2A2U A;  3HOE A;  3STM X;  4HPD A;  1TOU A;  2EU7 X;  1KOI A;  4AZM A;  2JOZ A;  5EED A;  4ALB A;  5B27 A;  4QGW A;  1KXO A;  2XST A;  3EYC A;  1U17 A;  4AW8 A;  3BU9 A;  2KTD A;  3IA8 A;  1ZRY A;  2AKQ A;  3CQN A;  4I3B A;  4QYN A;  5D47 A;  3U03 A;  1E00 A;  1KZX A;  3DSZ A;  1A2D A;  4Y0Q A;  3PPT A;  3NQ3 A;  1SA8 A;  1OBP A;  4HPA A;  3UEV A;  1JJJ A;  1G74 A;  1BSY A;  1FE3 A;  1KQX A;  3NPO A;  1HMR A;  3S26 A;  4AZN A;  1T8V A;  4LKT A;  2OZQ A;  1B8E A;  2ASN X;  4MIR A;  4YGG A;  5AQ6 A;  1BRP A;  3BX7 A;  1G7N A;  5LJD A;  2ACO A;  3UAQ A;  4AYH A;  1ZNH A;  4CV7 A;  4AZO A;  1P6P A;  5DG4 A;  1IFB A;  2X46 A;  4GH7 A;  1OEK A;  1UZ2 X;  1Z24 A;  2HZR A;  4NLI A;  1HMT A;  3WJG A;  3HWG A;  3VPJ E;  1Y9T A;  2KW1 A;  5EEE A;  3RSW A;  3AKM A;  2F73 A;  2R74 A;  2AT5 X;  1IKJ A;  4OS8 A;  2WQ9 A;  3PQS A;  1OPB A;  2AT3 X;  2LA7 A;  1PMP A;  1YP6 A;  2FT9 A;  2JU3 A;  3HTY A;  3V8U A;  1QFT A;  1S2P A;  2ACP X;  2Q9S A;  4ZHG A;  5D8J A;  2IFB A;  5LJH A;  2KT4 B;  4WHI A;  1VYG A;  1JIW I;  1YWA A;  5AJC A;  2QO6 A;  4YKM A;  5D45 A;  2K62 A;  3HOL A;  3HWD A;  5CYB A;  3VE2 A;  4JGL A;  4INN A;  2RD7 C;  3ZW0 A;  3P6F A;  5HWZ A;  1QQS A;  4QYP A;  5IO7 A;  2WWP A;  3P02 A;  1QY0 A;  1FEN A;  4ORS A;  2XKL A;  3ZUI A;  4Y0P A;  3RBY A;  4YFR A;  1TXL A;  2GC9 A;  5LJB A;  5IO5 A;  2Z4H A;  1QFV A;  1RBP A;  4BOE A;  1KT5 A;  2ZAI A;  4FBO A;  3SAO A;  1DC9 A;  4IMO A;  2CBS A;  1DV9 A;  3BU1 A;  4Y0R A;  4XMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...