3RKGA

Structural and functional characterization of the yeast mg2+ channel mrs2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
KQLLSLKPISASDSLFISCTVFNSKGNIISMSEKFPKWSFLTEHSLFPRDLRKIDNSSIDIIPTIMCKPNCIVINLLHIKALIERDKVYVFDTTNPSAAAKLSVLMYDLESKLSSTKNNSQFYEHRALESIFINVMSALETDFKLHSQICIQILNDLENEVNRLKLRHLLIKSKDLTLFYQKTLLIRDLLDELLENDDDLANMYLTVKKSPKDNFSDLEMLIETYYTQCDEYVQQSESLIQDIKSTEEIVNIILDANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transporter MRS2, mitochondrial
publication title Structural and functional characterization of the N-terminal domain of the yeast Mg(2+) channel Mrs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
total genus 89
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 3rkgA02
2.40.128.330 Mainly Beta Beta Barrel Lipocalin Lipocalin 3rkgA01
2IUBA 3CK6A 2HN2A 3NWIA 2BBHA 4EEDA 2HN1A 5JTGA 3NVOA 4EEBA 3RKGA 4EV6A 3JCFA 2BBJA 4I0UA 4EGWA
chains in the Genus database with same CATH superfamily
2A0AA 5FY0A 2DHRA 4LKPA 2KWIB 4QYPA 4CI1B 2V7JA 4UVBB 2CLYB 4GGTA 5AQOB 1GKAA 5JVDE 3LSVA 3TGCA 1SA8A 4BX5A 4H9PC 4ORUA 3ONJA 2CXFA 3ZZVA 2XPKA 4YGGA 4YCHA 4UEMA 2YDRA 4QH5A 5KX5E 3RDSA 2L9CA 1HXZA 5IRWA 3SFEA 5IRAA 3P8CD 1E00A 5B10O 4IGUA 3P50A 4HPDA 1YKEB 2YEVC 2XJ7A 3EABA 1E2AA 4I55E 1IJ8A 3D9WA 3KFWX 3AE1A 3HKEE 4BAYB 5B11O 5HA0A 4DUYT 1OEEA 2WAUA 3RE5A 2XQAA 3F31A 3SAOA 4JNJA 5L8OA 4B55A 2NW7A 1XCAA 4AZQA 3SFDA 2LM9A 5JRCB 5J2UE 3I0QA 2VASA 3N9PA 4MALA 4AXPA 1TW4A 1KGLA 2QGSA 4LMJA 3I9YA 2XAFB 2D9DA 4CXWA 5HZ6A 4HWFA 4DV3T 1N33T 1VWOB 1ZNDA 1JZUA 2MJIA 3PP6A 1JMZA 3KQ0A 2LHNA 1LIDA 5HEHA 3D0TA 2G0UA 4IB9A 4FBOA 4C5PA 3Q5EA 2ASNX 1SWJA 5LXTE 2LOPA 2RCQA 4I3CA 1FMVA 1VOMA 2XAQB 3CVRA 3FBLA 5BMVE 2CCQA 1OWAA 5CHKA 4GIWA 1LKEA 1BSQA 1YD8G 3ZEFB 2JN3A 1N0SA 2WQYA 5JREA 1XNRT 2C5KT 4EYUA 3P6FA 1SHZC 1IBLT 3HKCE 4DV5T 3C76X 4H9NC 2KXPB 3OD9A 3PUZF 2DCFA 5L47A 5LJKA 4JEHB 4DO0A 4NYRA 4CDCA 3CR6A 2K23A 1IFBA 4PFPA 4WFVA 3G7XA 4BX7A 3ZJ2A 2RTIB 3BDRA 4MEEA 1YXRA 4JEUB 4QHOA 3QUJA 5GONE 1IJ5A 1P6PA 1STSB 1UX5A 1ZP0A 2AH7X 1VWLB 1CBRA 5TAOA 1HFAA 2DWKA 3MG5A 4CPHB 3KFFA 3AE8A 4DMVA 2AT5X 4PNIA 3CKFA 1LCWA 4C91A 1GT4A 5EDBA 1VYGA 3K3LA 3CQNA 4FBVA 1X89A 3RDXA 1NP4A 4JO6A 2W62A 3ZMZB 4LF4T 3TLTA 1FDQA 3RC8A 3BX8A 1MNDA 3FA9A 4JI4T 4KH8A 3UEXA 4JI6T 2UXBT 1US7B 1WUBA 5L2LA 3EAMA 3OE3A 1ML7A 3CIRA 2QMIA 4U3CA 1GT1A 4YFSA 1KL3A 2WP9A 2XKLA 4MVIA 5KDMC 2LSYA 1G7NA 3B2KA 3VE1A 1IW2A 2MF6A 5H6QB 4TNWA 2QO6A 5IO6A 4BBOA 4DV2T 3ZSTA 4HFVA 5C2TA 1U18A 2XM1A 1MMNA 2X0HA 1EALA 3SS1A 2I5VO 4ZI2C 1WYBA 3WJDA 4YT0A 3FLLA 4Y0PA 3APXA 1UURA 1ZOYA 3TF6A 3BQLA 4NXNT 4TNNA 4FQBB 4CN1A 1OBQA 2EHOC 3AKMA 4HFEA 1U0XA 3VG6A 2M4LA 1FENA 5H6RB 2Y3EA 1UREA 2L5PA 2YOEA 5M4YA 4IE7A 5E0OA 1NQMA 4TV8E 3NR3A 4XMCA 2BZBA 3PURA 2WSJA 3BK9A 5AFUL 2CWOA 4QGWA 1S94A 3EHZA 3Q5DA 5HWYA 3WYQA 1X79A 4EB6E 4WBOA 4L1NA 1SLDB 5IWAT 3T1YT 1EI5A 1VWPB 1MMGA 2AT3X 1MUPA 3K3OA 4YLHA 2NW9A 5AJCA 2A2GA 4TN7B 4O3XB 2NR4A 5AQJB 1DU2A 3RY2A 5AQVB 4QNIA 3G06A 4O9SA 4BJNA 4HFIA 1QFTA 3AA0B 2W61A 5C0NA 4HPCA 3CQGB 1X8PA 2HNXA 1OEKA 1HN2A 5JDGA 2HZQA 2KINB 2V7IA 1ZNGA 3UT5E 3PU3A 2E5LT 1KT6A 1SLGB 4LFBT 4YSYA 2XY8B 2OY8A 4IMOA 2QCBA 3C77X 3DP7A 3OTOT 3TLWA 2QO4A 1EIIA 3FZMB 5FNVE 5HCCC 3NP1A 3FB2A 4TJZA 3VHLA 3V5UA 3OBVE 4HPAA 4IAWA 2EHOA 3HOLA 1UX4A 3V8UA 3BQIA 5L8NA 5IUXA 2C0SA 3O2YA 3PUVF 1VWAB 1NAFA 4EV6A 4L0RA 4ORRA 2BS2A 5LHIB 3J7Yq 2JGSA 2RTOB 2UZ2A 4QAEA 1SY0A 4O4SA 1W0AA 3OJAA 1PBYA 3KINB 2RA1A 4HGAA 2IZIA 4X66T 3A7MA 5BR8T 3VKGA 5L4EA 5FQ6E 4GKKT 3MA9A 3VE2A 4GD9A 2CHNA 3UFEA 1G85A 3KV9A 1SWNA 2OVEA 2N1GA 2FTBA 2JU3A 3FZLB 3JC6C 2JW1A 1I04A 5AQNB 4YDBA 3IA8A 2MTQA 5IHYA 4O4OA 2OV9A 1TVQA 2W2FA 5FXWA 4DIDB 4ZHDA 4WZXA 1ZNLA 2WU2A 3NZPA 3EC5A 2A9UA 3ZKRA 2O62A 1OEDE 1RSUB 2X9WA 3VR8A 1D0XA 4O4HE 1RLBE 5F3JA 5ETWA 3ZYLA 5J2TE 3BX7A 1LPJA 2C1SA 2OFAA 3AEAA 3ONLC 3FIQA 4YH0A 1O1UA 1VWRB 4OK0A 4U8UN 1EXSA 4CSBA 1UCUA 5EK2A 5CSEA 2PTFA 2AVIA 3ZW0B 4PJLA 2OVAA 2WB5A 2EHOD 3L3PA 1N9MA 3LK3B 1SY2A 4ZHHA 3PPTA 2LB6A 1SLEB 4ZHQE 5LJMA 4HWMA 1SE7A 4HWCA 5HYAA 4AZOA 1IBKT 3FZKB 2A2UA 3ZUIA 3JQOA 1YWBA 4U74A 2WDRA 2QYWA 2VKJA 1WFDA 2J62A 2V6XA 3WVMA 5L3GB 2Z6EA 1HG2A 4YMYA 2MAWA 5CFBA 1VWMB 3VG5A 3E08A 5AQLB 2X9HA 3HWEA 3ZC1A 1GXAA 2XQ9A 3WXQA 1BRQA 1KT4A 1D1CA 2LSKA 4UIGA 5AJBA 2LJLA 3K3NA 2F09A 3AXJA 4LMKA 5AQIB 3FHNA 2CE7A 1AVEA 2N93A 5B27A 4YKOA 2YU1A 2VQFT 4IDQA 5HEGA 4ZI7E 3RC3A 2OL6O 2KMFA 3GE2A 3PDFA 1WBIA 4HTEA 4ERRA 2ZMAA 1YP7A 5AQQB 1OEDB 4CXYA 1X8QA 2NTXA 1FELA 3SOLA 4ZZCA 4D6BA 1SXYA 1VWKB 4I3DA 5HZ9A 2JQKA 4CI3B 4ORXA 3IEEA 1MMAA 3J9X1 4DR1T 4QXCB 1PBOA 4GK0E 2LBAA 5LNKA 4IABA 5HCEC 4ON1A 4ALBA 1X8UA 2WDVA 2BS4A 4IE4A 2C4IA 2HPLA 5D4AA 3RZYA 3LBXB 4CXXA 2XZEA 3WZQA 1QSDA 4IB8A 2OY1O 4LFCT 1UGOA 1LDOA 2XSTA 3Q5WA 3O22A 3DTQA 4G63A 1DZJA 5F2BA 2IC6A 1U17A 2QOSC 2K48A 3ABVA 4PK5A 3AE2A 4R0BA 3O1JA 3V5SA 2CLYC 4ZJ0A 2C5JA 2X8SA 1BWYA 1LIEA 4ZCBA 4P0AA 3O9XA 1HS7A 2A8GA 4GDAA 2Q9QA 2Q2MA 3JC6D 5JDHA 3ZT7A 5HXSA 2WWUA 5F5WA 4FBRA 3UQ4A 4OYJA 2KTDA 2OFBA 3PK2A 3M65A 3VRAA 5FXVA 2JQQA 1JYJA 4AQGA 4IBAA 1HG5A 4GRJA 2RTBB 1SWUA 2WWVA 4YKMA 3WJGA 4I9SA 1IFCA 3KV4A 3P6EA 1Y01A 4PJMA 3KBTA 2AXDS 3F2EA 2KSRA 2RP4A 5KXJA 2WU5A 2R74A 5K68A 4N7CA 4DBRA 2HHHT 2UYWA 5LB7B 3MBTA 4OKAA 4A60A 4NUUA 1XDPA 2Z4HA 3BLGA 2CRBA 4HFCA 5AQUB 2WEXA 4KP3C 4U8UM 1M62A 3NBXX 1FEWA 2E9XB 5LHHB 2CM0A 2KNDA 4HWIB 2KWHA 3PUYF 1LIFA 1BSYA 2DWGA 3B13A 3U3IA 4IT4A 4TV9E 5L3EB 3C78X 5FYMA 2X8TA 1SWOA 1JYDA 2IZGB 1JNRA 3PDYA 2UXCT 3LDQB 2GTFX 3B57A 3MK7C 2NP1A 2R56A 4TUYE 4TWFA 1UK5A 2OVSA 4I50E 5F7GA 3P6CA 2UXNB 2FHLA 4YBPA 3LG7A 2M67A 2Q9QD 5BVQA 2XQ6A 1CHUA 2V7MA 1NBXA 3SZJA 2PG8A 4Z2PA 4ISSA 4EZ4A 3VHHA 4PJNA 1IIUA 3PQSA 1N9YA 5JDMA 2G7BA 2GTLM 4IAXA 3N9QA 2Y32A 3EW2A 1WRDA 3FENA 5CA0E 4DQ3A 3P6HA 3GN5B 3CKGA 2RTQB 5CYBA 2AT6X 3C50A 3QOFA 3JSQA 3UUXB 1J5ET 1N4JA 5JRCA 1EIOA 3N5LA 3AA1B 2ODUA 4EQAC 4KX6A 2B1EA 2MYSA 2WMNA 2P9BA 3C4XA 4Y5DA 4ZFXA 2H3RA 4A1HA 1DZPA 1ICNA 1BBPA 2CPTA 4ZS2A 1BM5A 3FXEB 2NTYA 4AYHA 1XMQT 3FZFB 2LOSA 2VFCA 1T8BA 1Y0GA 4OHFA 3UU4A 2ZAIA 3UULA 4JI2T 4DR2T 1EPBA 4H9QC 4I0UA 1J1JA 1LVKA 4QKNA 3NWIA 1HQPA 3KVAA 4DV4T 4O4IE 1T68X 2J47A 2BSZA 4UR9A 2RTCB 3PQUA 2Y6XA 3AB3B 1SWTA 1SWPA 2LSGA 4LZVA 2GTLO 4O4UA 3HL6A 3AVSA 5IRUA 1KNPA 2CBIA 2YDSA 1ZNHA 2IZKA 3TGBA 2IIUA 1IZNB 4QWNB 4O4XA 4IMNA 1NENA 2UUAT 4U46A 2YG2A 5JD2A 4MIRA 2OY5O 3FYFA 2FJAA 4X1IE 4QZUA 1T72A 3VU1A 1HMTA 2XQ8A 1RXJA 2CZUA 2CEAA 1UYNX 3AE9A 1S2PA 4I4TE 3RDMA 4ILAA 4IDPA 4IDNA 4QXHB 4GU8A 4CPHA 1KNRA 2E8IA 5HAXA 2X8FA 3PJAJ 3WAKA 4GJSA 2OYBO 3H3AA 4ILUA 4WW0A 1N36T 3BRNA 3IF8B 1AVDA 4L3RA 2VURA 3DJBA 4HFHA 1W09A 3PUGA 1Y55X 2OF9A 1U4QA 2X56A 2BHVA 2CA5A 1XZYA 2WDQA 3ZC0A 1E06A 2RA6A 3SRZA 1VWHB 4PSQA 1KL4A 2WR6A 2HMBA 3UFGA 4U9CA 3JADA 4DCBA 1KOIA 1B4MA 3PUSA 3AKNA 1SUMB 3VR9A 3ZCIA 4LKTA 4F6RC 3CMLA 2OA5A 3UEVA 3AE4A 5JH7E 5EEDA 4ZEYA 4GNYA 3C64A 3ZJ1A 3ZT5A 2NOXA 3NZQA 4EFGA 2WQAE 5CGMA 3GAQA 1VPRA 3D97A 2E5VA 4GGZA 4LF8T 4Y0RA 5L3BB 2D2SA 5FMNA 2JMBA 4TWHA 2N2NA 1SRGA 3MKDA 5H9KA 4K0KT 2RTGB 2IHR1 3FR4A 3NQ3A 2WMOA 4AZRA 2HPJA 1X71A 2QRXA 3UU3A 4IREA 3MM0A 4YFPA 2G5LA 4U72A 5L3CB 2WZHA 5H9LA 1JJXA 3UEUA 2IZCB 4WHIA 4IRWA 4NLJA 3BSZE 4DR7T 4AZNA 4CN4A 4O2BE 2NNDA 1N32T 1HMRA 1KK7A 1I94T 1NEKA 4QGVA 2HKDA 1JNZA 1WLXA 5EK4A 1SREA 3JAEA 4TKHA 2IDOB 2FGSA 2IZBA 4NW4A 1BEBA 4CK4A 2V6YB 3VHMA 3FR5A 5LG4A 1VWGB 3OVUA 3T2WA 3C4ZA 2LE8A 2IUBA 1QABE 2C5IT 2XASB 3RYHE 3S26A 3C4WA 3CQCB 2CXLA 5LOVE 2L8KA 3EW1A 4GNWA 5LMNT 4UXNB 3PH5A 4RUUA 5EPQA 3QB5K 4Z8XA 1M7KA 5B5FA 2BG9E 4DVDA 1KEYA 4YCEA 3SLTA 1FE3A 3LK2B 2PY1A 3IHRA 4Y0QA 4BJMA 2I59A 1Z8UA 4NNSA 2IW5B 2WZIA 4GGRA 1YUPA 4MVKA 5HTEA 1B7TA 2BBJA 4G2AA 2YN6A 4NV7A 2XTLA 4GYSA 4LF9T 2K24A 1JIWI 1TOWA 4L5GA 3C98B 2YDQA 1RSTB 5D45A 1MEPA 2LKHA 1IKJA 1LCZA 1IKEA 3N91A 4HFOA 2W67A 5DJQC 3NVOA 1OSPO 3TLSA 5HA1A 3B2JA 4WYVA 3OPCA 4YSXA 2BKNA 5HZ5A 3E3CA 5J0ZA 4GK5E 5HCMA 4H9OC 3LHNA 4TLJA 3RQUA 3BQKA 1EUOA 1LIBA 1OBUA 4ZH9A 4CPEA 1RBPA 5K67A 5IO7A 4YBUA 4XMFA 5K06A 3AA6B 5B29A 2X51A 1YWAA 4ZHGA 1HNWT 3HI2A 1LELA 2DNXA 5HAEA 4PJJA 1GX3A 1DFVA 5ABEA 1MIWA 4P0BA 3HR0A 1E1HB 1MNEA 2IZEB 2AL0X 2BG9B 2JOZA 1YKHB 3WZPA 1G8XA 4WBNE 2OVDA 3AECA 2IC9A 2WS3A 3ZQ3A 3P7IA 1E5PA 2I6HA 2JJ9A 1EQDA 1T0VA 2X68A 4ZHFA 4HWHA 4CDFA 1SXWA 2CMRA 4A98A 1LICA 2JPFA 1OEDC 3EM0A 2RQ0A 3AEGA 2EU7X 3NKZA 5HWXA 5AQRB 1JJUA 2FKJA 4EAHA 4FJOA 1VYFA 2H88A 3Q6LA 4NXMT 3WJBA 5DG4A 2WM9A 4I6SA 1ICMA 3LV4A 3ZW0A 2X45A 1UUSA 1FIOA 4UVAB 2OF8A 4KHPT 5J1GA 2RTMA 3IBPA 4ILCA 3APWA 4U3QA 3ANWB 4DQ4A 1OPBA 1D1AA 2E2AA 5LCYA 1KFFA 2Y3FA 4EDEA 4X64T 2LRLA 4PW8A 3TZSA 4UV9B 4I95A 1VWJB 4NP1A 5AQGB 2WY2A 4H9RC 4AW8A 2MWHA 1HQQA 3FIDA 3N9OA 3CBCA 1Y9TA 1SWAA 1X8OA 4OEMA 2W4XA 1JQPA 1KFYA 3U03A 4BA9A 5LGUB 2LBVA 4ASKA 4Y0SA 5AQKB 4HWDA 2XUEA 2KZ7B 4X20E 2ACPX 4A1YA 4ID2A 2V8SV 1PTSA 3ZCJA 5JTGA 3UQ7A 5F6ZA 4RUNA 2BT9A 5FAZA 4J2CA 1L0VA 3ZYMA 4YDAA 2XSBA 1SRJA 1GX9A 3QB5A 2ZM0A 3SLOA 4LZUA 1DZMA 2VDFA 2BVMA 1OEDA 5LGTB 5AQHB 1O1VA 4DNEA 1YQ4A 3RIFA 3ZW2A 5L4HA 3U9PC 3CWZB 4AISA 5JR9B 3D95A 3UUBA 2W2UA 3PECA 2BBHA 1BR0A 5JDFA 3APVA 2AF5A 3T1DA 4ILBA 1KF6A 3MVFA 4AKGA 3IA3A 2BDEA 3LBXA 4XMDA 5FXZA 3FW4A 2BS3A 3RF1A 4MFRA 2E9XC 3F6ZB 3ONXA 2Q2PA 3RGLA 1AQBA 1DF3A 1K3BA 4AKLA 4COTA 3PTRB 4ML7B 4AZPA 2V7KA 1LFOA 2FR3A 4GE1A 1L6MA 4DV1T 3BY0A 3ELXA 1U5PA 2WEWA 5FENA 2KT9A 2RTKA 4CV7A 5KHPA 4O2AE 3Q34A 4TNVA 1AJ3A 2BS5A 3NX1A 2ODVA 3B5MA 5LJBA 2A2FX 3RKGA 2JQHA 5LKFA 3K3QC 4BGFA 1RXKA 4KIIA 2VVNA 4ZH6A 1SMPI 3EDVA 4GUZA 4O8SA 1OPAA 1QLBA 3T8OA 3FZHB 3VKHA 3ZMVB 4CI2B 1WCRA 4WNKA 3RIUC 1Y53X 3SLJA 3ZN1B 4ZGFA 3CQXC 3CX6B 2RN4A 4BQUA 2Q9QC 2XQ5A 5BVTA 1NP1A 1MIYA 4UVCB 3W15B 4P09A 1ADLA 1LCVA 2IZJA 4EEBA 1HBPA 3AE6A 4CQIA 1CBSA 2E9XA 3MJXA 3RPUA 4OX9T 3B2LA 3CK6A 4YSZA 4YJ3E 2RTLA 4NV8A 4KT5A 4QZTA 2W66A 2WCAA 1KQWA 5EDCA 1W5RA 4KC7A 4K0UA 1CRBA 4EKVA 5CJ5A 2MO5A 2QVAA 4AKHA 2FKGA 4BCSA 3NADA 1Y9LA 2X9YA 3RBYA 1GX8A 3S5VA 2UXXB 3CX7B 2HLVA 2AT0X 4QXBB 1JMXA 4ORYA 4JYAT 4CN6A 2CBJA 2HH7A 4CDEA 3FA6A 3B2HA 3AEEA 3C51A 4JGLA 2QM9A 3RIUA 3KFHA 4V1Av 3VG2A 3HPEA 4D6AA 1VWBB 2E4JA 2OY7A 3ZW1B 1LVFA 3GN5A 2ZSCA 1KZXA 4GK9A 4ZR2A 5KIDA 4Z91A 1QQSA 4AIUA 3BU1A 3P4WA 1JV4A 3U78A 5KMGP 1HMSA 4JHQA 3NRXA 4GKJT 4IIJE 4QYNA 2PFVA 4QH1A 5JDNA 5DABA 1SRFA 4K19A 2HZRA 1D0ZA 1SA0E 4QGXA 3RSWA 4ORWA 2E9XD 2CBSA 2XQ3A 4ZXLA 3FMZA 1MX7A 2LKKA 4Z27A 5F6BA 4P1NA 3UTKA 3RYFE 3WJEA 1SRIA 1FTPA 1XWMA 2D0TA 2FUPA 3CX8B 4U33A 3ZN0B 3PUQA 3RY1A 2R6GF 3P02A 3E22E 4UU2A 2J1DG 2UU9T 2KT4B 4YGZA 1NWMX 1IBMT 1SWKA 5LBQB 4F8HA 2X32A 5AQ6A 1KT7A 2DLRA 4B3TT 2H7VC 3X1DA 1VWCB 2RPAA 2RD7C 2W0GA 2P8GA 2OFRX 1A18A 1BR2A 3P6DA 4WFUA 3HWGA 2JIWA 2XAJB 4BX6B 1VCTA 3AE3A 1H7CA 2VKHA 4MISA 4TX5A 3FELA 3I17A 3U0DA 3I0AA 5LG3A 3L4RA 3P6GA 3WZNA 4O3ZA 1I78A 2W00A 3K1SA 1O8VA 3UU6A 1IJ6A 3MX7A 5L3DB 4YVBA 4KMCA 1TXLA 5EZ2A 4E7SA 4DNDA 1B56A 5HZ8A 4QX7B 3PUAA 3RYCE 2LKGA 3I0OA 1SY3A 4ARHA 5FXXA 5L8IA 1V9DA 4GOUA 5HEUA 2GH7A 5HEOA 1GQEA 1Z24A 4LF5T 4U8UO 1T8VA 1EW3A 1A57A 4XBFB 5ABGA 5LMUT 2LEHA 2PJQA 2HN2A 3RDQA 3FR2A 3RX6A 2Q39A 5LJDA 3VGWA 3KVBA 2IZAA 2Z4IA 2D0UA 5C3JA 1H91A 2DM5A 2VL0A 3L09A 1HR0T 2RTPB 4JI1T 1EZ3A 3CPZA 4AQFC 4UF0B 4AKRB 2CM4A 2MM3A 3OYZA 4PFOA 4MHCA 3BU9A 1BSOA 2L3LA 1N43A 2YMSA 5JDLA 3ZPOA 2LRKA 1PMPA 3ZT6A 1JBHA 4XAXB 1SWFA 5IO5A 4IL4A 1HNZT 1G74A 3HKBE 2NNQA 4BVMA 5AQTB 3VHIA 1QY0A 4PJ2A 1DV9A 4DR3T 1A3YA 2WSSV 5ABFB 3MZKB 4KC8A 5HZQA 4U2ZA 2M6IA 3SOTA 2ZM2A 5AEOA 3ETUA 1BR1A 3PJAA 1FMWA 4IB7A 1QY1A 1VYOA 4U7IA 1FJGT 1N7YA 3L39A 3D4RA 4NYQA 5H9NA 1GGLA 2G79A 1FEMA 3ETVA 3FEKA 4PK4A 3AAIA 3UU8A 2BKPA 4X5TA 2V6YA 1DF8A 2OL7A 3SZIA 3EBKA 4ZS3A 2UUBT 1I6ZA 2OZQA 1XKIA 1ERBA 2NW8A 3DSZA 1VWFB 3MXZA 5L3FB 4ZOLE 4Z28A 1W6FA 2AKQA 2H89A 3ZI8A 2ZLYA 4B3MT 4AQFA 2ZAGA 3RDOA 4XMEA 4JI3T 1D3SA 4TKJA 5HXRA 1HXLA 3JCFA 3PE0A 2XM2A 4DV7T 2LT3A 4U31A 3EUHA 1ZNKA 4Y59A 3RIAA 3STNA 3RDUA 2V26A 2BG9C 4HEAA 3AEBA 2RTRB 3RE6A 4X65T 4M6SA 3K8PC 1HTJF 3GWHA 4Z90A 3IFBA 2CXDA 3T1HT 1ACDA 4HPBA 1DC9A 5LGNB 1W9RA 3X00A 3ZMSB 4IE5A 3N9NA 1SXUA 3N2GE 3H3MA 1QUUA 3S60A 3T6FA 5A1LA 4M7MA 1YQ3A 1VWDB 2RTAA 3R6NA 3O1IA 1MK5A 4YTNA 1GM6A 3ZLIA 2VQET 1K24A 1OXZA 5D8JA 3KDSE 1YP6A 1XDOA 4HE8A 1SWRA 2V5CA 4IL9A 1KL5A 1SWEA 3EYCA 2NP9A 2UXDT 1LF7A 3OYXA 3RQWA 3EDUA 3KV5A 1HNXT 3FA8A 3TGAA 4JI8T 1SLFB 4KHZF 4DV0T 3N2OA 1MIVA 2B76A 3UUMA 1CJ5A 2RTDB 2RCTA 3APUA 4LQZA 5F1EA 2K5BB 3AAAB 4O3WA 5FL1A 4KCAA 3PH6A 4OFZA 1SWSA 1SWHA 2QOMA 2LHRA 2RTNB 1X8NA 3AAEB 2PBIA 1LNMA 1SY1A 2BG9A 4AZMA 2POAA 3F8AA 2L67A 3EI0A 4B3RT 1GKAB 5LJEA 3L8RA 4ZHCA 4YY3T 4JI7T 1UYOX 1VWEB 2VVSA 3KVNA 5ADXL 3RH3A 4BX5B 1NC9A 1D0YA 4DUZT 4I43B 3RI5A 1KQXA 3TLVA 1CUNA 2VL8A 2RTJA 3O19A 5JR9C 5B2AO 4U2YA 4EXZA 1YIVA 3VRBA 3N9LA 4GDZA 4YJ2E 4XMHA 5BVSA 2X66A 3ANWA 2F01A 4CZZB 3T2XA 2GJ5A 2WBLA 4OS0A 1QG5A 2AMMX 4CPFA 1E02A 3WYPA 1KNZA 3STMX 2D5UA 2QO5A 5LYJE 5HEJA 3CMPA 5KICA 1OEJA 4JI0T 1VRBA 1VWNB 3CWKA 3RRWA 3P24A 5DPQA 1MX8A 3STKA 3WBGA 4GETA 2BS6A 1ZNEA 1TOUA 2VFBA 1XMOT 2XAGB 2A5BA 4UU3A 2KD2A 4GYRA 5IXGA 2IZDB 3HTYA 2FR2A 5FKYA 1W0BA 4GJVA 3B2IA 5IYZE 4OMXA 5BYPA 1BRPA 2AT8X 4Z6JA 3OBLA 2LLYA 4M1PA 5F8PA 2YINA 1SRHA 2JU7A 3T6LA 1JJJA 1XNQT 4DBQA 3D96A 2V7LA 3AA7B 2IZHB 3HWFA 5JQGE 5JR9A 5HTDA 3KV6A 2XQYA 2VB6A 5FL0A 1EPAA 3JS1A 2VWAA 4N7DA 2NWBA 1RAVA 1T7SA 3S4UA 4X62T 4LF7T 1KT5A 1VWQB 4MBQA 3WI3A 4YHHT 5LBMA 1S7DA 3NPOA 2KW1A 3WAJA 4GKCA 2LA7A 4CDDA 4KBMB 5EZYE 4BX7B 4ANJA 2VKOA 3E0ZA 4QRLA 2BLGA 5B3MO 1PEEA 4QQ1A 2WWPA 3RRCA 2AE9A 2CZTA 2IAKA 1T98A 2CAMA 4O3YA 1I05A 5F58A 3F9DA 2PI3O 3ZMTB 4YXDA 3KFGA 4YTMA 3M3ZB 3ESLA 2XSAA 2JRKA 3JAFA 3DTOA 4NPPA 2V1DB 5H9AA 4HKAA 2K3WA 5HWZA 2ACZA 3VU7H 2W63A 2GK9A 1BR4A 4Q25A 4IDOA 2I0MA 3RHWA 3KZAA 4O49A 1D1BA 2CM9A 3KBUA 2X55A 3PUXF 5LJCA 1AELA 2IFBA 3GMIA 4TZ4C 2XQ7A 3HWDA 3A8YC 1MDCA 3I1AA 2CBRA 2OLTA 1MM9A 3PU8A 2X34A 2ALLX 5LA6E 3AUMO 1WR6A 5DQWA 3ZWEA 4OS3A 1ZEEA 2BVLA 3FDCA 1HBQA 2Q9SA 1RXHA 3O1HA 1B0OA 2YKSA 4C90A 4DR5T 4IE0A 3AEHA 5EK3A 3SZHA 2DI4A 5AQFB 1MMDA 1S35A 3AE5A 2W2BA 3ZYKA 3LK42 3P4QA 4JLEA 5FY1A 3PEDA 2H7OA 3MACA 2WPUA 3QK6A 3NQ9A 4Z2VA 2YK0A 3UU5A 1FJ1E 4WBKA 3NX2A 4I9RA 3RKOA 1W4TA 2L68A 5HCDC 4KI0F 1B8EA 4EIWA 1VCSA 3ELZA 2MPKA 1SXXA 4UELA 3Q5XA 5C8YE 4E7ZA 1YWDA 2OL8O 3VPJE 3UAQA 4MVLA 3RLFF 4Z2OA 3TLUA 2IMLA 4GZVA 4YFQA 3UEWA 4ISTA 2XHEB 1NDJA 3FW5A 4B3ST 3QKGA 2F73A 4IE6A 5LJGA 3HK1A 5D48A 3BS2A 1KT3A 3AE7A 1MVGA 1HY2A 1OBPA 3O4XE 2OFMX 1J5WA 3EBWA 1G5WA 3RWXA 2RTEB 5AQPB 4CPIA 4EEJA 2WUTA 5HBSA 4HFDA 2CHOA 5HXEA 3ZW1A 4ZI2D 3KFIA 3GA8A 3NQKA 4COFA 4EEDA 2HN1A 4XMGA 5FQ8E 4NLIA 1LKXA 3LTWA 2RTHB 1N34T 2NNEA 4KUMB 1D2UA 3QC9A 3AEDA 3LJCA 1QFVA 4AKIA 1IAPA 5CB4E 2FRSA 4OELA 2N9DA 3FEPA 2Y48B 1VWIB 2JU8A 4OMWA 2JMKA 3VG7A 2J4GA 2EHOB 3LFMA 4EZHA 3WZOA 3CQRA 2X46A 3FA7A 5HXHA 4EYYR 2FBWA 1ZV4X 3HA4A 3QQ2A 5LKEA 5AQSB 5FQ7E 5L3YA 4YHJA 3H37A 1SWCA 1HX8A 2A13A 3WJFA 4ZGUA 2XAHB 2GTLN 2MHDA 4JI5T 4JUYA 1KXOA 2LFOA 4HFBA 3NRYA 3ZSSA 4AQYT 2WQ9A 4NIQA 1CBQA 1MOYA 4GH7A 4BX6A 3N9MA 5CE4A 1I9HA 1R0UA 2A3DA 4OS8A 4YGHA 4N78D 1WR0A 4LF6T 3CBSA 5DQVA 2MOZA 3QNUA 4IHJE 4ORSA 4MVEA 5LJHA 3HOEA 2G78A 3OJYC 2ZM8A 2DJGA 2CWYA 4YTPA 2HYSA 1BJ7A 2K9AA 4LMLA 2FHNX 3N2KE 4HN9A 4O4JE 4A8ZA 1E2TA 3PUWF 3HKDE 1LDQA 3H3IA 1SWDA 1QWDA 2FT9A 4ZI3C 2IZLB 2V5DA 4ODDA 1HF8A 1SWQA 3ZMUB 1SWGA 2LSJA 2FS7A 4MLKA 3TKLB 2ACOA 5FFHA 1AVGI 4L9IA 4EGWA 5LP6E 4JBWF 1QY2A 2X67A 2DJFA 4UF0A 2M6BA 1I06A 4DR6T 4H9SE 5FY7A 1Y64B 4AI6A 3RYIE 2R73A 3WOVA 4TQ2A 1G73A 5FVLA 2X4MA 5JR8A 2RTFB 4IB6A 2ANSA 2BKOA 2KLQA 1Y52X 2X0YA 1YW0A 1UZ2X 2GC9A 4U7YA 1SWLA 3WJCA 4NNTA 3AXJB 1NGLA 4TWDA 4PAGA 1AB0A 4H63V 1E7PA 5ABFA 4FI5A 5H8TA 3VG3A 1ZKEA 4NUVA 3CKDA 4BOEA 1KZWA 1YWCA 4UV8B 5EEEA 1SWBA 1ALBA 4B6XA 2W2AA 2LM2A 1S44A 1ZRYA 2FS6A 4FGIB 3I9WA 4ZZBA 4TKBA 2VK9A 4XZCA 1R8IA 4A5XA 1NQNA 2JQ9A 1GT3A 2FJEA 3OKQA 5B5GA 2L9QA 5FP3A 3VG4A 4IDZA 2I5ZO 2KTSA 4I60A 2SPCA 3P4PA 3UUNA 2F4VT 2A72A 3EVYA 5HCJA 5JDQA 4ALOA 3Q2MA 4X1KE 2VKDA 4OYKA 2FJBA 2X0LB 2A3FX 4PK6A 1BLRA 5LHGB 1ZHCA 4DMWA 2K62A 2ES0A 5ABHA 1HCIA 2YU2A 2Q4NA 1Z0PA 4QH4A 4O4LE 1DZKA 4ES7A 2MBGA 1A2DA 4DR4T 4ADZA 2FLJA 5HXCA 5FVKA 4LFAT 3R84B 3S5XA 1STPA 2Q9QB 2ZM6T 2IZFB 1GT5A 2UUCT 2A5CA 2G8CO 3Q9DA 3P4RA 4EXTA 2QA7A 3A5XA 3F57A 5D47A 2BC3A 2Y8DA 1CBIA 4INNA 2XQ4A 2LSIA 2FWVA 4BJ8A 1PM1X 4DV6T 1ERXA 3P4SA 4A97A 3SWHA 2FJDA 4ZI3D 1WYCA 1HX1B 1LUQA 3PV0F 1I4UA 1STRB 2C1QA 3AEFA 4YFRA 4X1YE 4EOZB 4H63H 3ZUOA 3AVRA 2ACXA 3FXDB 4QX8B 3FBZA 4A56A 1X9BA 2DL1A 2X9XA 5CA1E 1LRZA 4I3BA 3EMMA 4JV5T 5AQMB 1O3XA 2JMHA 5LJNA
chains in the Genus database with same CATH topology
4OS0A 2A0AA 3PECA 4FBRA 1QG5A 2AMMX 1E02A 2BBHA 3STMX 2KTDA 3APVA 2QO5A 4LKPA 4QYPA 3CMPA 3T1DA 5KICA 1OEJA 1GKAA 3CWKA 3MVFA 3P24A 5DPQA 1MX8A 3STKA 3WBGA 4GETA 1JYJA 2BS6A 3TGCA 1ZNEA 1SA8A 1TOUA 4IBAA 4GRJA 4ORUA 4XMDA 3FW4A 4UU3A 3ZZVA 2KD2A 4YKMA 3WJGA 4I9SA 1IFCA 3P6EA 3F6ZB 4YGGA 4YCHA 2Q2PA 3HTYA 1AQBA 2FR2A 2R74A 1DF3A 4N7CA 4COTA 2L9CA 3B2IA 4ML7B 4OMXA 4AZPA 3MBTA 5BYPA 1BRPA 1LFOA 2FR3A 4A60A 2AT8X 1E00A 2Z4HA 3OBLA 3BLGA 4GE1A 1L6MA 4HPDA 3BY0A 3ELXA 2WEXA 2WEWA 5FENA 2JU7A 4U8UM 3NBXX 4CV7A 5KHPA 1JJJA 5HA0A 3D96A 2BS5A 3NX1A 5LJBA 1OEEA 3SAOA 3HWFA 5HTDA 3RKGA 5L8OA 1BSYA 1XCAA 4AZQA 1EPAA 5LKFA 3JS1A 3C78X 4N7DA 2X8TA 4KIIA 4ZH6A 1SMPI 1JYDA 1TW4A 2GTFX 1OPAA 1KT5A 2NP1A 1KGLA 2R56A 5HZ6A 2OVSA 1S7DA 3NPOA 2KW1A 4GKCA 2LA7A 1ZNDA 5F7GA 1JZUA 4QRLA 2BLGA 2MJIA 3P6CA 3PP6A 1PEEA 4ZGFA 3KQ0A 4QQ1A 1LIDA 2WWPA 2CZTA 4YBPA 4O3YA 4BQUA 1I05A 2RN4A 4IB9A 4FBOA 5BVQA 5F58A 5BVTA 3F9DA 2ASNX 1NP1A 2RCQA 3KFGA 4I3CA 1ADLA 4EEBA 1HBPA 1IIUA 3PQSA 2G7BA 1LKEA 1CBSA 2GTLM 4IAXA 1BSQA 2JN3A 5H9AA 3B2LA 1N0SA 5HWZA 3FENA 4DQ3A 3CK6A 3P6HA 3P6FA 5CYBA 2AT6X 4KT5A 4QZTA 3KZAA 4O49A 2CM9A 3JSQA 1KQWA 5EDCA 5LJCA 1EIOA 1AELA 2IFBA 4KC7A 3C76X 3OD9A 3HWDA 1CRBA 2MO5A 1MDCA 4EQAC 5LJKA 4ZFXA 4NYRA 2CBRA 4A1HA 1DZPA 3CR6A 3NADA 1Y9LA 2K23A 1IFBA 1ICNA 4WFVA 1BBPA 3G7XA 2ALLX 3BDRA 1BM5A 3RBYA 1GX8A 3S5VA 4AYHA 3ZWEA 4OS3A 2HLVA 1P6PA 2AT0X 2AH7X 2ZAIA 1CBRA 4ORYA 1EPBA 1HBQA 3KFFA 2Q9SA 2AT5X 4I0UA 3FA6A 3B2HA 1B0OA 3NWIA 4JGLA 1HQPA 2QM9A 1T68X 3PQUA 3KFHA 2W2BA 1GT4A 5EDBA 3VG2A 4D6AA 1VYGA 2E4JA 3K3LA 3PEDA 3CQNA 4LZVA 2GTLO 4O4UA 3ZW1B 4FBVA 1X89A 1KZXA 1NP4A 4GK9A 4ZR2A 5KIDA 3NQ9A 1QQSA 3BU1A 4WBKA 1JV4A 1ZNHA 3TGBA 3NX2A 4I9RA 4O4XA 1FDQA 1HMSA 2L68A 5HCDC 3BX8A 1B8EA 4IMNA 3ELZA 4QYNA 1SXXA 3FA9A 2YG2A 4MIRA 4K19A 1YWDA 3FYFA 2HZRA 3VPJE 3UAQA 4KH8A 4MVLA 3UEXA 4QZUA 3RSWA 4QGXA 1CJ5A 3VU1A 1HMTA 4YFQA 4GZVA 4ORWA 3UEWA 2CZUA 3FW5A 3OE3A 3QKGA 2CBSA 1S2PA 2F73A 3FMZA 5LJGA 3HK1A 5D48A 1ML7A 1MX7A 1KT3A 3BS2A 2QMIA 2LKKA 4GU8A 1GT1A 5F6BA 3WJEA 1MVGA 2X8FA 1OBPA 2XKLA 4MVIA 1FTPA 2OFMX 3EBWA 1G7NA 1G5WA 3B2KA 3BRNA 3RWXA 3VE1A 1IW2A 3P02A 4L3RA 4UU2A 2QO6A 5IO6A 4YGZA 2KT4B 4EEJA 5AQ6A 1U18A 2BHVA 1KT7A 2WUTA 5HBSA 1EALA 3ZW1A 1E06A 3KFIA 3NQKA 2RA6A 3WJDA 2RD7C 4EEDA 2P8GA 2HN1A 2OFRX 2WR6A 1A18A 3FLLA 2HMBA 4PSQA 4XMGA 3P6DA 3APXA 4U9CA 5FQ8E 4NLIA 3TF6A 4WFUA 1KOIA 1B4MA 3HWGA 3AKNA 4TNNA 4FQBB 1OBQA 3AKMA 2NNEA 4LKTA 1D2UA 1U0XA 3VG6A 2M4LA 1FENA 3UEVA 5EEDA 4MISA 3FELA 3I17A 4GNYA 3I0AA 1QFVA 3L4RA 3U0DA 1UREA 3P6GA 2L5PA 2FRSA 3FEPA 4EFGA 4O3ZA 2WQAE 3NR3A 1O8VA 3GAQA 4XMCA 2JU8A 3MX7A 2WSJA 1VPRA 3D97A 4OMWA 4QGWA 4Y0RA 3VG7A 1TXLA 5EZ2A 2JMBA 1B56A 5HZ8A 3CQRA 4L1NA 2X46A 3FA7A 2AT3X 1EI5A 5H9KA 1SY3A 1MUPA 4ARHA 3FR4A 3NQ3A 5AJCA 5L8IA 4AZRA 2A2GA 1X71A 5LKEA 4O3XB 5FQ7E 4QNIA 1Z24A 4YFPA 4O9SA 4U8UO 1QFTA 1T8VA 1EW3A 1A57A 5H9LA 1JJXA 3UEUA 2A13A 3WJFA 4ZGUA 2MHDA 2GTLN 2HN2A 5C0NA 4HPCA 4WHIA 1KXOA 1X8PA 2HNXA 4NLJA 2LFOA 3BSZE 3FR2A 4AZNA 1OEKA 1HN2A 2NNDA 1HMRA 2Q39A 5LJDA 4QGVA 2Z4IA 2WQ9A 2HZQA 1H91A 1CBQA 1ZNGA 2DM5A 4GH7A 5CE4A 1KT6A 1R0UA 4IMOA 4OS8A 4TKHA 4YGHA 3C77X 2QO4A 4NW4A 1BEBA 4CK4A 1EIIA 5HCCC 2CM4A 2MM3A 3CBSA 3NP1A 4ORSA 4TJZA 3FR5A 3BU9A 4MVEA 1BSOA 5LJHA 3HOEA 2G78A 2YMSA 3OJYC 4HPAA 2IUBA 4IAWA 3HOLA 1PMPA 3V8UA 1JBHA 1QABE 5L8NA 3S26A 2HYSA 5IO5A 1BJ7A 3O2YA 4GNWA 1G74A 4EV6A 2NNQA 4A8ZA 4BVMA 4ORRA 3PH5A 4RUUA 5EPQA 1QY0A 4QAEA 3H3IA 4PJ2A 1QWDA 1SY0A 4O4SA 4YCEA 1DV9A 1A3YA 2FT9A 1FE3A 4KC8A 5HZQA 2PY1A 3SOTA 5AEOA 4Y0QA 4IB7A 1QY1A 4ODDA 5FQ6E 4NNSA 3VE2A 3D4RA 4NYQA 1G85A 1YUPA 2FS7A 4MVKA 5FFHA 2BBJA 2ACOA 1AVGI 5H9NA 1GGLA 5HTEA 4EGWA 2G79A 2OVEA 1TOWA 2FTBA 1JIWI 1QY2A 2JU3A 1FEMA 3FEKA 2JW1A 1I04A 4YDBA 1I06A 3IA8A 3EBKA 4O4OA 5D45A 1IKJA 2OZQA 2R73A 3WOVA 1TVQA 1ERBA 1XKIA 2W2FA 4TQ2A 3DSZA 1IKEA 3N91A 4HFOA 4ZHDA 5JR8A 1ZNLA 3NVOA 2AKQA 2O62A 4IB6A 3ZI8A 2ANSA 2ZAGA 4XMEA 5HA1A 3B2JA 1D3SA 1RLBE 4TKJA 1UZ2X 2GC9A 3BX7A 3JCFA 1LPJA 5HZ5A 3E3CA 3WJCA 4NNTA 3LHNA 4TLJA 1NGLA 3FIQA 1EUOA 1AB0A 1O1UA 4U8UN 4YH0A 4CSBA 1ZNKA 1LIBA 1EXSA 3VG3A 1OBUA 5H8TA 4ZH9A 3STNA 4BOEA 1RBPA 3ZW0B 1KZWA 1YWCA 2OVAA 5EEEA 5IO7A 4YBUA 4XMFA 5K06A 1SY2A 1ALBA 4M6SA 3PPTA 3IFBA 4ZHHA 2LB6A 2W2AA 5B29A 1S44A 4Y0PA 2FS6A 1ZRYA 1ACDA 1YWAA 4FGIB 4HPBA 1DC9A 4HWMA 4ZHGA 4AZOA 4TKBA 5HAEA 2A2UA 3ZUIA 1DFVA 1YWBA 1SXUA 3JQOA 1GT3A 3S60A 2AL0X 2JOZA 3WVMA 4M7MA 3VG4A 2OVDA 3ZQ3A 4YMYA 1E5PA 1EQDA 2KTSA 1T0VA 1GM6A 4ZHFA 3VG5A 3HWEA 1SXWA 1GXAA 3WXQA 5D8JA 1BRQA 1YP6A 1KT4A 4ALOA 1LICA 3EM0A 2RQ0A 2EU7X 1BLRA 2A3FX 5AJBA 2F09A 3EYCA 2K62A 2N93A 5B27A 4YKOA 1LF7A 1VYFA 2Q4NA 3Q6LA 3WJBA 3FA8A 5DG4A 3GE2A 4I6SA 3TGAA 1ICMA 1DZKA 3LV4A 2X45A 3ZW0A 4ES7A 1A2DA 1YP7A 2FLJA 3APWA 4U3QA 3S5XA 1X8QA 4D6BA 1FELA 2RCTA 3APUA 4LQZA 5F1EA 1SXYA 4DQ4A 1OPBA 4O3WA 4I3DA 4KCAA 3PH6A 1GT5A 5HZ9A 4ORXA 4EDEA 3TZSA 1PBOA 4I95A 1X8NA 1LNMA 1SY1A 4NP1A 2LBAA 5D47A 4AZMA 4IABA 2POAA 3F8AA 2L67A 5HCEC 4AW8A 2MWHA 4ON1A 1GKAB 3CBCA 5LJEA 1Y9TA 4ALBA 4ZHCA 1CBIA 1X8OA 1X8UA 4INNA 5D4AA 3RZYA 2FWVA 3U03A 1PM1X 4IB8A 1ERXA 2XSTA 2LBVA 4Y0SA 1KQXA 4A1YA 2ACPX 3DTQA 3O22A 4ID2A 3O19A 1DZJA 5JTGA 5F6ZA 4EXZA 1I4UA 2BT9A 4RUNA 1U17A 5FAZA 2QOSC 4YFRA 1YIVA 4YDAA 4R0BA 3ZUOA 1GX9A 4LZUA 1DZMA 4ZJ0A 2X8SA 1BWYA 1LIEA 4GDZA 4ZCBA 4XMHA 5BVSA 1O1VA 3ZW2A 3U9PC 2Q2MA 4I3BA 3EMMA 2GJ5A 1LIFA 3D95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUB A;  3CK6 A;  2HN2 A;  3NWI A;  2BBH A;  4EED A;  2HN1 A;  5JTG A;  3NVO A;  4EEB A;  3RKG A;  4EV6 A;  3JCF A;  2BBJ A;  4I0U A;  4EGW A; 
#chains in the Genus database with same CATH topology
 2A0A A;  5FY0 A;  2DHR A;  4LKP A;  2KWI B;  4QYP A;  4CI1 B;  2V7J A;  4UVB B;  2CLY B;  4GGT A;  5AQO B;  1GKA A;  5JVD E;  3LSV A;  3TGC A;  1SA8 A;  4BX5 A;  4H9P C;  4ORU A;  3ONJ A;  2CXF A;  3ZZV A;  2XPK A;  4YGG A;  4YCH A;  4UEM A;  2YDR A;  4QH5 A;  5KX5 E;  3RDS A;  2L9C A;  1HXZ A;  5IRW A;  3SFE A;  5IRA A;  3P8C D;  1E00 A;  5B10 O;  4IGU A;  3P50 A;  4HPD A;  1YKE B;  2YEV C;  2XJ7 A;  3EAB A;  1E2A A;  4I55 E;  1IJ8 A;  3D9W A;  3KFW X;  3AE1 A;  3HKE E;  4BAY B;  5B11 O;  5HA0 A;  4DUY T;  1OEE A;  2WAU A;  3RE5 A;  2XQA A;  3F31 A;  3SAO A;  4JNJ A;  5L8O A;  4B55 A;  2NW7 A;  1XCA A;  4AZQ A;  3SFD A;  2LM9 A;  5JRC B;  5J2U E;  3I0Q A;  2VAS A;  3N9P A;  4MAL A;  4AXP A;  1TW4 A;  1KGL A;  2QGS A;  4LMJ A;  3I9Y A;  2XAF B;  2D9D A;  4CXW A;  5HZ6 A;  4HWF A;  4DV3 T;  1N33 T;  1VWO B;  1ZND A;  1JZU A;  2MJI A;  3PP6 A;  1JMZ A;  3KQ0 A;  2LHN A;  1LID A;  5HEH A;  3D0T A;  2G0U A;  4IB9 A;  4FBO A;  4C5P A;  3Q5E A;  2ASN X;  1SWJ A;  5LXT E;  2LOP A;  2RCQ A;  4I3C A;  1FMV A;  1VOM A;  2XAQ B;  3CVR A;  3FBL A;  5BMV E;  2CCQ A;  1OWA A;  5CHK A;  4GIW A;  1LKE A;  1BSQ A;  1YD8 G;  3ZEF B;  2JN3 A;  1N0S A;  2WQY A;  5JRE A;  1XNR T;  2C5K T;  4EYU A;  3P6F A;  1SHZ C;  1IBL T;  3HKC E;  4DV5 T;  3C76 X;  4H9N C;  2KXP B;  3OD9 A;  3PUZ F;  2DCF A;  5L47 A;  5LJK A;  4JEH B;  4DO0 A;  4NYR A;  4CDC A;  3CR6 A;  2K23 A;  1IFB A;  4PFP A;  4WFV A;  3G7X A;  4BX7 A;  3ZJ2 A;  2RTI B;  3BDR A;  4MEE A;  1YXR A;  4JEU B;  4QHO A;  3QUJ A;  5GON E;  1IJ5 A;  1P6P A;  1STS B;  1UX5 A;  1ZP0 A;  2AH7 X;  1VWL B;  1CBR A;  5TAO A;  1HFA A;  2DWK A;  3MG5 A;  4CPH B;  3KFF A;  3AE8 A;  4DMV A;  2AT5 X;  4PNI A;  3CKF A;  1LCW A;  4C91 A;  1GT4 A;  5EDB A;  1VYG A;  3K3L A;  3CQN A;  4FBV A;  1X89 A;  3RDX A;  1NP4 A;  4JO6 A;  2W62 A;  3ZMZ B;  4LF4 T;  3TLT A;  1FDQ A;  3RC8 A;  3BX8 A;  1MND A;  3FA9 A;  4JI4 T;  4KH8 A;  3UEX A;  4JI6 T;  2UXB T;  1US7 B;  1WUB A;  5L2L A;  3EAM A;  3OE3 A;  1ML7 A;  3CIR A;  2QMI A;  4U3C A;  1GT1 A;  4YFS A;  1KL3 A;  2WP9 A;  2XKL A;  4MVI A;  5KDM C;  2LSY A;  1G7N A;  3B2K A;  3VE1 A;  1IW2 A;  2MF6 A;  5H6Q B;  4TNW A;  2QO6 A;  5IO6 A;  4BBO A;  4DV2 T;  3ZST A;  4HFV A;  5C2T A;  1U18 A;  2XM1 A;  1MMN A;  2X0H A;  1EAL A;  3SS1 A;  2I5V O;  4ZI2 C;  1WYB A;  3WJD A;  4YT0 A;  3FLL A;  4Y0P A;  3APX A;  1UUR A;  1ZOY A;  3TF6 A;  3BQL A;  4NXN T;  4TNN A;  4FQB B;  4CN1 A;  1OBQ A;  2EHO C;  3AKM A;  4HFE A;  1U0X A;  3VG6 A;  2M4L A;  1FEN A;  5H6R B;  2Y3E A;  1URE A;  2L5P A;  2YOE A;  5M4Y A;  4IE7 A;  5E0O A;  1NQM A;  4TV8 E;  3NR3 A;  4XMC A;  2BZB A;  3PUR A;  2WSJ A;  3BK9 A;  5AFU L;  2CWO A;  4QGW A;  1S94 A;  3EHZ A;  3Q5D A;  5HWY A;  3WYQ A;  1X79 A;  4EB6 E;  4WBO A;  4L1N A;  1SLD B;  5IWA T;  3T1Y T;  1EI5 A;  1VWP B;  1MMG A;  2AT3 X;  1MUP A;  3K3O A;  4YLH A;  2NW9 A;  5AJC A;  2A2G A;  4TN7 B;  4O3X B;  2NR4 A;  5AQJ B;  1DU2 A;  3RY2 A;  5AQV B;  4QNI A;  3G06 A;  4O9S A;  4BJN A;  4HFI A;  1QFT A;  3AA0 B;  2W61 A;  5C0N A;  4HPC A;  3CQG B;  1X8P A;  2HNX A;  1OEK A;  1HN2 A;  5JDG A;  2HZQ A;  2KIN B;  2V7I A;  1ZNG A;  3UT5 E;  3PU3 A;  2E5L T;  1KT6 A;  1SLG B;  4LFB T;  4YSY A;  2XY8 B;  2OY8 A;  4IMO A;  2QCB A;  3C77 X;  3DP7 A;  3OTO T;  3TLW A;  2QO4 A;  1EII A;  3FZM B;  5FNV E;  5HCC C;  3NP1 A;  3FB2 A;  4TJZ A;  3VHL A;  3V5U A;  3OBV E;  4HPA A;  4IAW A;  2EHO A;  3HOL A;  1UX4 A;  3V8U A;  3BQI A;  5L8N A;  5IUX A;  2C0S A;  3O2Y A;  3PUV F;  1VWA B;  1NAF A;  4EV6 A;  4L0R A;  4ORR A;  2BS2 A;  5LHI B;  3J7Y q;  2JGS A;  2RTO B;  2UZ2 A;  4QAE A;  1SY0 A;  4O4S A;  1W0A A;  3OJA A;  1PBY A;  3KIN B;  2RA1 A;  4HGA A;  2IZI A;  4X66 T;  3A7M A;  5BR8 T;  3VKG A;  5L4E A;  5FQ6 E;  4GKK T;  3MA9 A;  3VE2 A;  4GD9 A;  2CHN A;  3UFE A;  1G85 A;  3KV9 A;  1SWN A;  2OVE A;  2N1G A;  2FTB A;  2JU3 A;  3FZL B;  3JC6 C;  2JW1 A;  1I04 A;  5AQN B;  4YDB A;  3IA8 A;  2MTQ A;  5IHY A;  4O4O A;  2OV9 A;  1TVQ A;  2W2F A;  5FXW A;  4DID B;  4ZHD A;  4WZX A;  1ZNL A;  2WU2 A;  3NZP A;  3EC5 A;  2A9U A;  3ZKR A;  2O62 A;  1OED E;  1RSU B;  2X9W A;  3VR8 A;  1D0X A;  4O4H E;  1RLB E;  5F3J A;  5ETW A;  3ZYL A;  5J2T E;  3BX7 A;  1LPJ A;  2C1S A;  2OFA A;  3AEA A;  3ONL C;  3FIQ A;  4YH0 A;  1O1U A;  1VWR B;  4OK0 A;  4U8U N;  1EXS A;  4CSB A;  1UCU A;  5EK2 A;  5CSE A;  2PTF A;  2AVI A;  3ZW0 B;  4PJL A;  2OVA A;  2WB5 A;  2EHO D;  3L3P A;  1N9M A;  3LK3 B;  1SY2 A;  4ZHH A;  3PPT A;  2LB6 A;  1SLE B;  4ZHQ E;  5LJM A;  4HWM A;  1SE7 A;  4HWC A;  5HYA A;  4AZO A;  1IBK T;  3FZK B;  2A2U A;  3ZUI A;  3JQO A;  1YWB A;  4U74 A;  2WDR A;  2QYW A;  2VKJ A;  1WFD A;  2J62 A;  2V6X A;  3WVM A;  5L3G B;  2Z6E A;  1HG2 A;  4YMY A;  2MAW A;  5CFB A;  1VWM B;  3VG5 A;  3E08 A;  5AQL B;  2X9H A;  3HWE A;  3ZC1 A;  1GXA A;  2XQ9 A;  3WXQ A;  1BRQ A;  1KT4 A;  1D1C A;  2LSK A;  4UIG A;  5AJB A;  2LJL A;  3K3N A;  2F09 A;  3AXJ A;  4LMK A;  5AQI B;  3FHN A;  2CE7 A;  1AVE A;  2N93 A;  5B27 A;  4YKO A;  2YU1 A;  2VQF T;  4IDQ A;  5HEG A;  4ZI7 E;  3RC3 A;  2OL6 O;  2KMF A;  3GE2 A;  3PDF A;  1WBI A;  4HTE A;  4ERR A;  2ZMA A;  1YP7 A;  5AQQ B;  1OED B;  4CXY A;  1X8Q A;  2NTX A;  1FEL A;  3SOL A;  4ZZC A;  4D6B A;  1SXY A;  1VWK B;  4I3D A;  5HZ9 A;  2JQK A;  4CI3 B;  4ORX A;  3IEE A;  1MMA A;  3J9X 1;  4DR1 T;  4QXC B;  1PBO A;  4GK0 E;  2LBA A;  5LNK A;  4IAB A;  5HCE C;  4ON1 A;  4ALB A;  1X8U A;  2WDV A;  2BS4 A;  4IE4 A;  2C4I A;  2HPL A;  5D4A A;  3RZY A;  3LBX B;  4CXX A;  2XZE A;  3WZQ A;  1QSD A;  4IB8 A;  2OY1 O;  4LFC T;  1UGO A;  1LDO A;  2XST A;  3Q5W A;  3O22 A;  3DTQ A;  4G63 A;  1DZJ A;  5F2B A;  2IC6 A;  1U17 A;  2QOS C;  2K48 A;  3ABV A;  4PK5 A;  3AE2 A;  4R0B A;  3O1J A;  3V5S A;  2CLY C;  4ZJ0 A;  2C5J A;  2X8S A;  1BWY A;  1LIE A;  4ZCB A;  4P0A A;  3O9X A;  1HS7 A;  2A8G A;  4GDA A;  2Q9Q A;  2Q2M A;  3JC6 D;  5JDH A;  3ZT7 A;  5HXS A;  2WWU A;  5F5W A;  4FBR A;  3UQ4 A;  4OYJ A;  2KTD A;  2OFB A;  3PK2 A;  3M65 A;  3VRA A;  5FXV A;  2JQQ A;  1JYJ A;  4AQG A;  4IBA A;  1HG5 A;  4GRJ A;  2RTB B;  1SWU A;  2WWV A;  4YKM A;  3WJG A;  4I9S A;  1IFC A;  3KV4 A;  3P6E A;  1Y01 A;  4PJM A;  3KBT A;  2AXD S;  3F2E A;  2KSR A;  2RP4 A;  5KXJ A;  2WU5 A;  2R74 A;  5K68 A;  4N7C A;  4DBR A;  2HHH T;  2UYW A;  5LB7 B;  3MBT A;  4OKA A;  4A60 A;  4NUU A;  1XDP A;  2Z4H A;  3BLG A;  2CRB A;  4HFC A;  5AQU B;  2WEX A;  4KP3 C;  4U8U M;  1M62 A;  3NBX X;  1FEW A;  2E9X B;  5LHH B;  2CM0 A;  2KND A;  4HWI B;  2KWH A;  3PUY F;  1LIF A;  1BSY A;  2DWG A;  3B13 A;  3U3I A;  4IT4 A;  4TV9 E;  5L3E B;  3C78 X;  5FYM A;  2X8T A;  1SWO A;  1JYD A;  2IZG B;  1JNR A;  3PDY A;  2UXC T;  3LDQ B;  2GTF X;  3B57 A;  3MK7 C;  2NP1 A;  2R56 A;  4TUY E;  4TWF A;  1UK5 A;  2OVS A;  4I50 E;  5F7G A;  3P6C A;  2UXN B;  2FHL A;  4YBP A;  3LG7 A;  2M67 A;  2Q9Q D;  5BVQ A;  2XQ6 A;  1CHU A;  2V7M A;  1NBX A;  3SZJ A;  2PG8 A;  4Z2P A;  4ISS A;  4EZ4 A;  3VHH A;  4PJN A;  1IIU A;  3PQS A;  1N9Y A;  5JDM A;  2G7B A;  2GTL M;  4IAX A;  3N9Q A;  2Y32 A;  3EW2 A;  1WRD A;  3FEN A;  5CA0 E;  4DQ3 A;  3P6H A;  3GN5 B;  3CKG A;  2RTQ B;  5CYB A;  2AT6 X;  3C50 A;  3QOF A;  3JSQ A;  3UUX B;  1J5E T;  1N4J A;  5JRC A;  1EIO A;  3N5L A;  3AA1 B;  2ODU A;  4EQA C;  4KX6 A;  2B1E A;  2MYS A;  2WMN A;  2P9B A;  3C4X A;  4Y5D A;  4ZFX A;  2H3R A;  4A1H A;  1DZP A;  1ICN A;  1BBP A;  2CPT A;  4ZS2 A;  1BM5 A;  3FXE B;  2NTY A;  4AYH A;  1XMQ T;  3FZF B;  2LOS A;  2VFC A;  1T8B A;  1Y0G A;  4OHF A;  3UU4 A;  2ZAI A;  3UUL A;  4JI2 T;  4DR2 T;  1EPB A;  4H9Q C;  4I0U A;  1J1J A;  1LVK A;  4QKN A;  3NWI A;  1HQP A;  3KVA A;  4DV4 T;  4O4I E;  1T68 X;  2J47 A;  2BSZ A;  4UR9 A;  2RTC B;  3PQU A;  2Y6X A;  3AB3 B;  1SWT A;  1SWP A;  2LSG A;  4LZV A;  2GTL O;  4O4U A;  3HL6 A;  3AVS A;  5IRU A;  1KNP A;  2CBI A;  2YDS A;  1ZNH A;  2IZK A;  3TGB A;  2IIU A;  1IZN B;  4QWN B;  4O4X A;  4IMN A;  1NEN A;  2UUA T;  4U46 A;  2YG2 A;  5JD2 A;  4MIR A;  2OY5 O;  3FYF A;  2FJA A;  4X1I E;  4QZU A;  1T72 A;  3VU1 A;  1HMT A;  2XQ8 A;  1RXJ A;  2CZU A;  2CEA A;  1UYN X;  3AE9 A;  1S2P A;  4I4T E;  3RDM A;  4ILA A;  4IDP A;  4IDN A;  4QXH B;  4GU8 A;  4CPH A;  1KNR A;  2E8I A;  5HAX A;  2X8F A;  3PJA J;  3WAK A;  4GJS A;  2OYB O;  3H3A A;  4ILU A;  4WW0 A;  1N36 T;  3BRN A;  3IF8 B;  1AVD A;  4L3R A;  2VUR A;  3DJB A;  4HFH A;  1W09 A;  3PUG A;  1Y55 X;  2OF9 A;  1U4Q A;  2X56 A;  2BHV A;  2CA5 A;  1XZY A;  2WDQ A;  3ZC0 A;  1E06 A;  2RA6 A;  3SRZ A;  1VWH B;  4PSQ A;  1KL4 A;  2WR6 A;  2HMB A;  3UFG A;  4U9C A;  3JAD A;  4DCB A;  1KOI A;  1B4M A;  3PUS A;  3AKN A;  1SUM B;  3VR9 A;  3ZCI A;  4LKT A;  4F6R C;  3CML A;  2OA5 A;  3UEV A;  3AE4 A;  5JH7 E;  5EED A;  4ZEY A;  4GNY A;  3C64 A;  3ZJ1 A;  3ZT5 A;  2NOX A;  3NZQ A;  4EFG A;  2WQA E;  5CGM A;  3GAQ A;  1VPR A;  3D97 A;  2E5V A;  4GGZ A;  4LF8 T;  4Y0R A;  5L3B B;  2D2S A;  5FMN A;  2JMB A;  4TWH A;  2N2N A;  1SRG A;  3MKD A;  5H9K A;  4K0K T;  2RTG B;  2IHR 1;  3FR4 A;  3NQ3 A;  2WMO A;  4AZR A;  2HPJ A;  1X71 A;  2QRX A;  3UU3 A;  4IRE A;  3MM0 A;  4YFP A;  2G5L A;  4U72 A;  5L3C B;  2WZH A;  5H9L A;  1JJX A;  3UEU A;  2IZC B;  4WHI A;  4IRW A;  4NLJ A;  3BSZ E;  4DR7 T;  4AZN A;  4CN4 A;  4O2B E;  2NND A;  1N32 T;  1HMR A;  1KK7 A;  1I94 T;  1NEK A;  4QGV A;  2HKD A;  1JNZ A;  1WLX A;  5EK4 A;  1SRE A;  3JAE A;  4TKH A;  2IDO B;  2FGS A;  2IZB A;  4NW4 A;  1BEB A;  4CK4 A;  2V6Y B;  3VHM A;  3FR5 A;  5LG4 A;  1VWG B;  3OVU A;  3T2W A;  3C4Z A;  2LE8 A;  2IUB A;  1QAB E;  2C5I T;  2XAS B;  3RYH E;  3S26 A;  3C4W A;  3CQC B;  2CXL A;  5LOV E;  2L8K A;  3EW1 A;  4GNW A;  5LMN T;  4UXN B;  3PH5 A;  4RUU A;  5EPQ A;  3QB5 K;  4Z8X A;  1M7K A;  5B5F A;  2BG9 E;  4DVD A;  1KEY A;  4YCE A;  3SLT A;  1FE3 A;  3LK2 B;  2PY1 A;  3IHR A;  4Y0Q A;  4BJM A;  2I59 A;  1Z8U A;  4NNS A;  2IW5 B;  2WZI A;  4GGR A;  1YUP A;  4MVK A;  5HTE A;  1B7T A;  2BBJ A;  4G2A A;  2YN6 A;  4NV7 A;  2XTL A;  4GYS A;  4LF9 T;  2K24 A;  1JIW I;  1TOW A;  4L5G A;  3C98 B;  2YDQ A;  1RST B;  5D45 A;  1MEP A;  2LKH A;  1IKJ A;  1LCZ A;  1IKE A;  3N91 A;  4HFO A;  2W67 A;  5DJQ C;  3NVO A;  1OSP O;  3TLS A;  5HA1 A;  3B2J A;  4WYV A;  3OPC A;  4YSX A;  2BKN A;  5HZ5 A;  3E3C A;  5J0Z A;  4GK5 E;  5HCM A;  4H9O C;  3LHN A;  4TLJ A;  3RQU A;  3BQK A;  1EUO A;  1LIB A;  1OBU A;  4ZH9 A;  4CPE A;  1RBP A;  5K67 A;  5IO7 A;  4YBU A;  4XMF A;  5K06 A;  3AA6 B;  5B29 A;  2X51 A;  1YWA A;  4ZHG A;  1HNW T;  3HI2 A;  1LEL A;  2DNX A;  5HAE A;  4PJJ A;  1GX3 A;  1DFV A;  5ABE A;  1MIW A;  4P0B A;  3HR0 A;  1E1H B;  1MNE A;  2IZE B;  2AL0 X;  2BG9 B;  2JOZ A;  1YKH B;  3WZP A;  1G8X A;  4WBN E;  2OVD A;  3AEC A;  2IC9 A;  2WS3 A;  3ZQ3 A;  3P7I A;  1E5P A;  2I6H A;  2JJ9 A;  1EQD A;  1T0V A;  2X68 A;  4ZHF A;  4HWH A;  4CDF A;  1SXW A;  2CMR A;  4A98 A;  1LIC A;  2JPF A;  1OED C;  3EM0 A;  2RQ0 A;  3AEG A;  2EU7 X;  3NKZ A;  5HWX A;  5AQR B;  1JJU A;  2FKJ A;  4EAH A;  4FJO A;  1VYF A;  2H88 A;  3Q6L A;  4NXM T;  3WJB A;  5DG4 A;  2WM9 A;  4I6S A;  1ICM A;  3LV4 A;  3ZW0 A;  2X45 A;  1UUS A;  1FIO A;  4UVA B;  2OF8 A;  4KHP T;  5J1G A;  2RTM A;  3IBP A;  4ILC A;  3APW A;  4U3Q A;  3ANW B;  4DQ4 A;  1OPB A;  1D1A A;  2E2A A;  5LCY A;  1KFF A;  2Y3F A;  4EDE A;  4X64 T;  2LRL A;  4PW8 A;  3TZS A;  4UV9 B;  4I95 A;  1VWJ B;  4NP1 A;  5AQG B;  2WY2 A;  4H9R C;  4AW8 A;  2MWH A;  1HQQ A;  3FID A;  3N9O A;  3CBC A;  1Y9T A;  1SWA A;  1X8O A;  4OEM A;  2W4X A;  1JQP A;  1KFY A;  3U03 A;  4BA9 A;  5LGU B;  2LBV A;  4ASK A;  4Y0S A;  5AQK B;  4HWD A;  2XUE A;  2KZ7 B;  4X20 E;  2ACP X;  4A1Y A;  4ID2 A;  2V8S V;  1PTS A;  3ZCJ A;  5JTG A;  3UQ7 A;  5F6Z A;  4RUN A;  2BT9 A;  5FAZ A;  4J2C A;  1L0V A;  3ZYM A;  4YDA A;  2XSB A;  1SRJ A;  1GX9 A;  3QB5 A;  2ZM0 A;  3SLO A;  4LZU A;  1DZM A;  2VDF A;  2BVM A;  1OED A;  5LGT B;  5AQH B;  1O1V A;  4DNE A;  1YQ4 A;  3RIF A;  3ZW2 A;  5L4H A;  3U9P C;  3CWZ B;  4AIS A;  5JR9 B;  3D95 A;  3UUB A;  2W2U A;  3PEC A;  2BBH A;  1BR0 A;  5JDF A;  3APV A;  2AF5 A;  3T1D A;  4ILB A;  1KF6 A;  3MVF A;  4AKG A;  3IA3 A;  2BDE A;  3LBX A;  4XMD A;  5FXZ A;  3FW4 A;  2BS3 A;  3RF1 A;  4MFR A;  2E9X C;  3F6Z B;  3ONX A;  2Q2P A;  3RGL A;  1AQB A;  1DF3 A;  1K3B A;  4AKL A;  4COT A;  3PTR B;  4ML7 B;  4AZP A;  2V7K A;  1LFO A;  2FR3 A;  4GE1 A;  1L6M A;  4DV1 T;  3BY0 A;  3ELX A;  1U5P A;  2WEW A;  5FEN A;  2KT9 A;  2RTK A;  4CV7 A;  5KHP A;  4O2A E;  3Q34 A;  4TNV A;  1AJ3 A;  2BS5 A;  3NX1 A;  2ODV A;  3B5M A;  5LJB A;  2A2F X;  3RKG A;  2JQH A;  5LKF A;  3K3Q C;  4BGF A;  1RXK A;  4KII A;  2VVN A;  4ZH6 A;  1SMP I;  3EDV A;  4GUZ A;  4O8S A;  1OPA A;  1QLB A;  3T8O A;  3FZH B;  3VKH A;  3ZMV B;  4CI2 B;  1WCR A;  4WNK A;  3RIU C;  1Y53 X;  3SLJ A;  3ZN1 B;  4ZGF A;  3CQX C;  3CX6 B;  2RN4 A;  4BQU A;  2Q9Q C;  2XQ5 A;  5BVT A;  1NP1 A;  1MIY A;  4UVC B;  3W15 B;  4P09 A;  1ADL A;  1LCV A;  2IZJ A;  4EEB A;  1HBP A;  3AE6 A;  4CQI A;  1CBS A;  2E9X A;  3MJX A;  3RPU A;  4OX9 T;  3B2L A;  3CK6 A;  4YSZ A;  4YJ3 E;  2RTL A;  4NV8 A;  4KT5 A;  4QZT A;  2W66 A;  2WCA A;  1KQW A;  5EDC A;  1W5R A;  4KC7 A;  4K0U A;  1CRB A;  4EKV A;  5CJ5 A;  2MO5 A;  2QVA A;  4AKH A;  2FKG A;  4BCS A;  3NAD A;  1Y9L A;  2X9Y A;  3RBY A;  1GX8 A;  3S5V A;  2UXX B;  3CX7 B;  2HLV A;  2AT0 X;  4QXB B;  1JMX A;  4ORY A;  4JYA T;  4CN6 A;  2CBJ A;  2HH7 A;  4CDE A;  3FA6 A;  3B2H A;  3AEE A;  3C51 A;  4JGL A;  2QM9 A;  3RIU A;  3KFH A;  4V1A v;  3VG2 A;  3HPE A;  4D6A A;  1VWB B;  2E4J A;  2OY7 A;  3ZW1 B;  1LVF A;  3GN5 A;  2ZSC A;  1KZX A;  4GK9 A;  4ZR2 A;  5KID A;  4Z91 A;  1QQS A;  4AIU A;  3BU1 A;  3P4W A;  1JV4 A;  3U78 A;  5KMG P;  1HMS A;  4JHQ A;  3NRX A;  4GKJ T;  4IIJ E;  4QYN A;  2PFV A;  4QH1 A;  5JDN A;  5DAB A;  1SRF A;  4K19 A;  2HZR A;  1D0Z A;  1SA0 E;  4QGX A;  3RSW A;  4ORW A;  2E9X D;  2CBS A;  2XQ3 A;  4ZXL A;  3FMZ A;  1MX7 A;  2LKK A;  4Z27 A;  5F6B A;  4P1N A;  3UTK A;  3RYF E;  3WJE A;  1SRI A;  1FTP A;  1XWM A;  2D0T A;  2FUP A;  3CX8 B;  4U33 A;  3ZN0 B;  3PUQ A;  3RY1 A;  2R6G F;  3P02 A;  3E22 E;  4UU2 A;  2J1D G;  2UU9 T;  2KT4 B;  4YGZ A;  1NWM X;  1IBM T;  1SWK A;  5LBQ B;  4F8H A;  2X32 A;  5AQ6 A;  1KT7 A;  2DLR A;  4B3T T;  2H7V C;  3X1D A;  1VWC B;  2RPA A;  2RD7 C;  2W0G A;  2P8G A;  2OFR X;  1A18 A;  1BR2 A;  3P6D A;  4WFU A;  3HWG A;  2JIW A;  2XAJ B;  4BX6 B;  1VCT A;  3AE3 A;  1H7C A;  2VKH A;  4MIS A;  4TX5 A;  3FEL A;  3I17 A;  3U0D A;  3I0A A;  5LG3 A;  3L4R A;  3P6G A;  3WZN A;  4O3Z A;  1I78 A;  2W00 A;  3K1S A;  1O8V A;  3UU6 A;  1IJ6 A;  3MX7 A;  5L3D B;  4YVB A;  4KMC A;  1TXL A;  5EZ2 A;  4E7S A;  4DND A;  1B56 A;  5HZ8 A;  4QX7 B;  3PUA A;  3RYC E;  2LKG A;  3I0O A;  1SY3 A;  4ARH A;  5FXX A;  5L8I A;  1V9D A;  4GOU A;  5HEU A;  2GH7 A;  5HEO A;  1GQE A;  1Z24 A;  4LF5 T;  4U8U O;  1T8V A;  1EW3 A;  1A57 A;  4XBF B;  5ABG A;  5LMU T;  2LEH A;  2PJQ A;  2HN2 A;  3RDQ A;  3FR2 A;  3RX6 A;  2Q39 A;  5LJD A;  3VGW A;  3KVB A;  2IZA A;  2Z4I A;  2D0U A;  5C3J A;  1H91 A;  2DM5 A;  2VL0 A;  3L09 A;  1HR0 T;  2RTP B;  4JI1 T;  1EZ3 A;  3CPZ A;  4AQF C;  4UF0 B;  4AKR B;  2CM4 A;  2MM3 A;  3OYZ A;  4PFO A;  4MHC A;  3BU9 A;  1BSO A;  2L3L A;  1N43 A;  2YMS A;  5JDL A;  3ZPO A;  2LRK A;  1PMP A;  3ZT6 A;  1JBH A;  4XAX B;  1SWF A;  5IO5 A;  4IL4 A;  1HNZ T;  1G74 A;  3HKB E;  2NNQ A;  4BVM A;  5AQT B;  3VHI A;  1QY0 A;  4PJ2 A;  1DV9 A;  4DR3 T;  1A3Y A;  2WSS V;  5ABF B;  3MZK B;  4KC8 A;  5HZQ A;  4U2Z A;  2M6I A;  3SOT A;  2ZM2 A;  5AEO A;  3ETU A;  1BR1 A;  3PJA A;  1FMW A;  4IB7 A;  1QY1 A;  1VYO A;  4U7I A;  1FJG T;  1N7Y A;  3L39 A;  3D4R A;  4NYQ A;  5H9N A;  1GGL A;  2G79 A;  1FEM A;  3ETV A;  3FEK A;  4PK4 A;  3AAI A;  3UU8 A;  2BKP A;  4X5T A;  2V6Y A;  1DF8 A;  2OL7 A;  3SZI A;  3EBK A;  4ZS3 A;  2UUB T;  1I6Z A;  2OZQ A;  1XKI A;  1ERB A;  2NW8 A;  3DSZ A;  1VWF B;  3MXZ A;  5L3F B;  4ZOL E;  4Z28 A;  1W6F A;  2AKQ A;  2H89 A;  3ZI8 A;  2ZLY A;  4B3M T;  4AQF A;  2ZAG A;  3RDO A;  4XME A;  4JI3 T;  1D3S A;  4TKJ A;  5HXR A;  1HXL A;  3JCF A;  3PE0 A;  2XM2 A;  4DV7 T;  2LT3 A;  4U31 A;  3EUH A;  1ZNK A;  4Y59 A;  3RIA A;  3STN A;  3RDU A;  2V26 A;  2BG9 C;  4HEA A;  3AEB A;  2RTR B;  3RE6 A;  4X65 T;  4M6S A;  3K8P C;  1HTJ F;  3GWH A;  4Z90 A;  3IFB A;  2CXD A;  3T1H T;  1ACD A;  4HPB A;  1DC9 A;  5LGN B;  1W9R A;  3X00 A;  3ZMS B;  4IE5 A;  3N9N A;  1SXU A;  3N2G E;  3H3M A;  1QUU A;  3S60 A;  3T6F A;  5A1L A;  4M7M A;  1YQ3 A;  1VWD B;  2RTA A;  3R6N A;  3O1I A;  1MK5 A;  4YTN A;  1GM6 A;  3ZLI A;  2VQE T;  1K24 A;  1OXZ A;  5D8J A;  3KDS E;  1YP6 A;  1XDO A;  4HE8 A;  1SWR A;  2V5C A;  4IL9 A;  1KL5 A;  1SWE A;  3EYC A;  2NP9 A;  2UXD T;  1LF7 A;  3OYX A;  3RQW A;  3EDU A;  3KV5 A;  1HNX T;  3FA8 A;  3TGA A;  4JI8 T;  1SLF B;  4KHZ F;  4DV0 T;  3N2O A;  1MIV A;  2B76 A;  3UUM A;  1CJ5 A;  2RTD B;  2RCT A;  3APU A;  4LQZ A;  5F1E A;  2K5B B;  3AAA B;  4O3W A;  5FL1 A;  4KCA A;  3PH6 A;  4OFZ A;  1SWS A;  1SWH A;  2QOM A;  2LHR A;  2RTN B;  1X8N A;  3AAE B;  2PBI A;  1LNM A;  1SY1 A;  2BG9 A;  4AZM A;  2POA A;  3F8A A;  2L67 A;  3EI0 A;  4B3R T;  1GKA B;  5LJE A;  3L8R A;  4ZHC A;  4YY3 T;  4JI7 T;  1UYO X;  1VWE B;  2VVS A;  3KVN A;  5ADX L;  3RH3 A;  4BX5 B;  1NC9 A;  1D0Y A;  4DUZ T;  4I43 B;  3RI5 A;  1KQX A;  3TLV A;  1CUN A;  2VL8 A;  2RTJ A;  3O19 A;  5JR9 C;  5B2A O;  4U2Y A;  4EXZ A;  1YIV A;  3VRB A;  3N9L A;  4GDZ A;  4YJ2 E;  4XMH A;  5BVS A;  2X66 A;  3ANW A;  2F01 A;  4CZZ B;  3T2X A;  2GJ5 A;  2WBL A;  4OS0 A;  1QG5 A;  2AMM X;  4CPF A;  1E02 A;  3WYP A;  1KNZ A;  3STM X;  2D5U A;  2QO5 A;  5LYJ E;  5HEJ A;  3CMP A;  5KIC A;  1OEJ A;  4JI0 T;  1VRB A;  1VWN B;  3CWK A;  3RRW A;  3P24 A;  5DPQ A;  1MX8 A;  3STK A;  3WBG A;  4GET A;  2BS6 A;  1ZNE A;  1TOU A;  2VFB A;  1XMO T;  2XAG B;  2A5B A;  4UU3 A;  2KD2 A;  4GYR A;  5IXG A;  2IZD B;  3HTY A;  2FR2 A;  5FKY A;  1W0B A;  4GJV A;  3B2I A;  5IYZ E;  4OMX A;  5BYP A;  1BRP A;  2AT8 X;  4Z6J A;  3OBL A;  2LLY A;  4M1P A;  5F8P A;  2YIN A;  1SRH A;  2JU7 A;  3T6L A;  1JJJ A;  1XNQ T;  4DBQ A;  3D96 A;  2V7L A;  3AA7 B;  2IZH B;  3HWF A;  5JQG E;  5JR9 A;  5HTD A;  3KV6 A;  2XQY A;  2VB6 A;  5FL0 A;  1EPA A;  3JS1 A;  2VWA A;  4N7D A;  2NWB A;  1RAV A;  1T7S A;  3S4U A;  4X62 T;  4LF7 T;  1KT5 A;  1VWQ B;  4MBQ A;  3WI3 A;  4YHH T;  5LBM A;  1S7D A;  3NPO A;  2KW1 A;  3WAJ A;  4GKC A;  2LA7 A;  4CDD A;  4KBM B;  5EZY E;  4BX7 B;  4ANJ A;  2VKO A;  3E0Z A;  4QRL A;  2BLG A;  5B3M O;  1PEE A;  4QQ1 A;  2WWP A;  3RRC A;  2AE9 A;  2CZT A;  2IAK A;  1T98 A;  2CAM A;  4O3Y A;  1I05 A;  5F58 A;  3F9D A;  2PI3 O;  3ZMT B;  4YXD A;  3KFG A;  4YTM A;  3M3Z B;  3ESL A;  2XSA A;  2JRK A;  3JAF A;  3DTO A;  4NPP A;  2V1D B;  5H9A A;  4HKA A;  2K3W A;  5HWZ A;  2ACZ A;  3VU7 H;  2W63 A;  2GK9 A;  1BR4 A;  4Q25 A;  4IDO A;  2I0M A;  3RHW A;  3KZA A;  4O49 A;  1D1B A;  2CM9 A;  3KBU A;  2X55 A;  3PUX F;  5LJC A;  1AEL A;  2IFB A;  3GMI A;  4TZ4 C;  2XQ7 A;  3HWD A;  3A8Y C;  1MDC A;  3I1A A;  2CBR A;  2OLT A;  1MM9 A;  3PU8 A;  2X34 A;  2ALL X;  5LA6 E;  3AUM O;  1WR6 A;  5DQW A;  3ZWE A;  4OS3 A;  1ZEE A;  2BVL A;  3FDC A;  1HBQ A;  2Q9S A;  1RXH A;  3O1H A;  1B0O A;  2YKS A;  4C90 A;  4DR5 T;  4IE0 A;  3AEH A;  5EK3 A;  3SZH A;  2DI4 A;  5AQF B;  1MMD A;  1S35 A;  3AE5 A;  2W2B A;  3ZYK A;  3LK4 2;  3P4Q A;  4JLE A;  5FY1 A;  3PED A;  2H7O A;  3MAC A;  2WPU A;  3QK6 A;  3NQ9 A;  4Z2V A;  2YK0 A;  3UU5 A;  1FJ1 E;  4WBK A;  3NX2 A;  4I9R A;  3RKO A;  1W4T A;  2L68 A;  5HCD C;  4KI0 F;  1B8E A;  4EIW A;  1VCS A;  3ELZ A;  2MPK A;  1SXX A;  4UEL A;  3Q5X A;  5C8Y E;  4E7Z A;  1YWD A;  2OL8 O;  3VPJ E;  3UAQ A;  4MVL A;  3RLF F;  4Z2O A;  3TLU A;  2IML A;  4GZV A;  4YFQ A;  3UEW A;  4IST A;  2XHE B;  1NDJ A;  3FW5 A;  4B3S T;  3QKG A;  2F73 A;  4IE6 A;  5LJG A;  3HK1 A;  5D48 A;  3BS2 A;  1KT3 A;  3AE7 A;  1MVG A;  1HY2 A;  1OBP A;  3O4X E;  2OFM X;  1J5W A;  3EBW A;  1G5W A;  3RWX A;  2RTE B;  5AQP B;  4CPI A;  4EEJ A;  2WUT A;  5HBS A;  4HFD A;  2CHO A;  5HXE A;  3ZW1 A;  4ZI2 D;  3KFI A;  3GA8 A;  3NQK A;  4COF A;  4EED A;  2HN1 A;  4XMG A;  5FQ8 E;  4NLI A;  1LKX A;  3LTW A;  2RTH B;  1N34 T;  2NNE A;  4KUM B;  1D2U A;  3QC9 A;  3AED A;  3LJC A;  1QFV A;  4AKI A;  1IAP A;  5CB4 E;  2FRS A;  4OEL A;  2N9D A;  3FEP A;  2Y48 B;  1VWI B;  2JU8 A;  4OMW A;  2JMK A;  3VG7 A;  2J4G A;  2EHO B;  3LFM A;  4EZH A;  3WZO A;  3CQR A;  2X46 A;  3FA7 A;  5HXH A;  4EYY R;  2FBW A;  1ZV4 X;  3HA4 A;  3QQ2 A;  5LKE A;  5AQS B;  5FQ7 E;  5L3Y A;  4YHJ A;  3H37 A;  1SWC A;  1HX8 A;  2A13 A;  3WJF A;  4ZGU A;  2XAH B;  2GTL N;  2MHD A;  4JI5 T;  4JUY A;  1KXO A;  2LFO A;  4HFB A;  3NRY A;  3ZSS A;  4AQY T;  2WQ9 A;  4NIQ A;  1CBQ A;  1MOY A;  4GH7 A;  4BX6 A;  3N9M A;  5CE4 A;  1I9H A;  1R0U A;  2A3D A;  4OS8 A;  4YGH A;  4N78 D;  1WR0 A;  4LF6 T;  3CBS A;  5DQV A;  2MOZ A;  3QNU A;  4IHJ E;  4ORS A;  4MVE A;  5LJH A;  3HOE A;  2G78 A;  3OJY C;  2ZM8 A;  2DJG A;  2CWY A;  4YTP A;  2HYS A;  1BJ7 A;  2K9A A;  4LML A;  2FHN X;  3N2K E;  4HN9 A;  4O4J E;  4A8Z A;  1E2T A;  3PUW F;  3HKD E;  1LDQ A;  3H3I A;  1SWD A;  1QWD A;  2FT9 A;  4ZI3 C;  2IZL B;  2V5D A;  4ODD A;  1HF8 A;  1SWQ A;  3ZMU B;  1SWG A;  2LSJ A;  2FS7 A;  4MLK A;  3TKL B;  2ACO A;  5FFH A;  1AVG I;  4L9I A;  4EGW A;  5LP6 E;  4JBW F;  1QY2 A;  2X67 A;  2DJF A;  4UF0 A;  2M6B A;  1I06 A;  4DR6 T;  4H9S E;  5FY7 A;  1Y64 B;  4AI6 A;  3RYI E;  2R73 A;  3WOV A;  4TQ2 A;  1G73 A;  5FVL A;  2X4M A;  5JR8 A;  2RTF B;  4IB6 A;  2ANS A;  2BKO A;  2KLQ A;  1Y52 X;  2X0Y A;  1YW0 A;  1UZ2 X;  2GC9 A;  4U7Y A;  1SWL A;  3WJC A;  4NNT A;  3AXJ B;  1NGL A;  4TWD A;  4PAG A;  1AB0 A;  4H63 V;  1E7P A;  5ABF A;  4FI5 A;  5H8T A;  3VG3 A;  1ZKE A;  4NUV A;  3CKD A;  4BOE A;  1KZW A;  1YWC A;  4UV8 B;  5EEE A;  1SWB A;  1ALB A;  4B6X A;  2W2A A;  2LM2 A;  1S44 A;  1ZRY A;  2FS6 A;  4FGI B;  3I9W A;  4ZZB A;  4TKB A;  2VK9 A;  4XZC A;  1R8I A;  4A5X A;  1NQN A;  2JQ9 A;  1GT3 A;  2FJE A;  3OKQ A;  5B5G A;  2L9Q A;  5FP3 A;  3VG4 A;  4IDZ A;  2I5Z O;  2KTS A;  4I60 A;  2SPC A;  3P4P A;  3UUN A;  2F4V T;  2A72 A;  3EVY A;  5HCJ A;  5JDQ A;  4ALO A;  3Q2M A;  4X1K E;  2VKD A;  4OYK A;  2FJB A;  2X0L B;  2A3F X;  4PK6 A;  1BLR A;  5LHG B;  1ZHC A;  4DMW A;  2K62 A;  2ES0 A;  5ABH A;  1HCI A;  2YU2 A;  2Q4N A;  1Z0P A;  4QH4 A;  4O4L E;  1DZK A;  4ES7 A;  2MBG A;  1A2D A;  4DR4 T;  4ADZ A;  2FLJ A;  5HXC A;  5FVK A;  4LFA T;  3R84 B;  3S5X A;  1STP A;  2Q9Q B;  2ZM6 T;  2IZF B;  1GT5 A;  2UUC T;  2A5C A;  2G8C O;  3Q9D A;  3P4R A;  4EXT A;  2QA7 A;  3A5X A;  3F57 A;  5D47 A;  2BC3 A;  2Y8D A;  1CBI A;  4INN A;  2XQ4 A;  2LSI A;  2FWV A;  4BJ8 A;  1PM1 X;  4DV6 T;  1ERX A;  3P4S A;  4A97 A;  3SWH A;  2FJD A;  4ZI3 D;  1WYC A;  1HX1 B;  1LUQ A;  3PV0 F;  1I4U A;  1STR B;  2C1Q A;  3AEF A;  4YFR A;  4X1Y E;  4EOZ B;  4H63 H;  3ZUO A;  3AVR A;  2ACX A;  3FXD B;  4QX8 B;  3FBZ A;  4A56 A;  1X9B A;  2DL1 A;  2X9X A;  5CA1 E;  1LRZ A;  4I3B A;  3EMM A;  4JV5 T;  5AQM B;  1O3X A;  2JMH A;  5LJN A; 
#chains in the Genus database with same CATH homology
 4OS0 A;  2A0A A;  3PEC A;  4FBR A;  1QG5 A;  2AMM X;  1E02 A;  2BBH A;  3STM X;  2KTD A;  3APV A;  2QO5 A;  4LKP A;  4QYP A;  3CMP A;  3T1D A;  5KIC A;  1OEJ A;  1GKA A;  3CWK A;  3MVF A;  3P24 A;  5DPQ A;  1MX8 A;  3STK A;  3WBG A;  4GET A;  1JYJ A;  2BS6 A;  3TGC A;  1ZNE A;  1SA8 A;  1TOU A;  4IBA A;  4GRJ A;  4ORU A;  4XMD A;  3FW4 A;  4UU3 A;  3ZZV A;  2KD2 A;  4YKM A;  3WJG A;  4I9S A;  1IFC A;  3P6E A;  3F6Z B;  4YGG A;  4YCH A;  2Q2P A;  3HTY A;  1AQB A;  2FR2 A;  2R74 A;  1DF3 A;  4N7C A;  4COT A;  2L9C A;  3B2I A;  4ML7 B;  4OMX A;  4AZP A;  3MBT A;  5BYP A;  1BRP A;  1LFO A;  2FR3 A;  4A60 A;  2AT8 X;  1E00 A;  2Z4H A;  3OBL A;  3BLG A;  4GE1 A;  1L6M A;  4HPD A;  3BY0 A;  3ELX A;  2WEX A;  2WEW A;  5FEN A;  2JU7 A;  4U8U M;  3NBX X;  4CV7 A;  5KHP A;  1JJJ A;  5HA0 A;  3D96 A;  2BS5 A;  3NX1 A;  5LJB A;  1OEE A;  3SAO A;  3HWF A;  5HTD A;  3RKG A;  5L8O A;  1BSY A;  1XCA A;  4AZQ A;  1EPA A;  5LKF A;  3JS1 A;  3C78 X;  4N7D A;  2X8T A;  4KII A;  4ZH6 A;  1SMP I;  1JYD A;  1TW4 A;  2GTF X;  1OPA A;  1KT5 A;  2NP1 A;  1KGL A;  2R56 A;  5HZ6 A;  2OVS A;  1S7D A;  3NPO A;  2KW1 A;  4GKC A;  2LA7 A;  1ZND A;  5F7G A;  1JZU A;  4QRL A;  2BLG A;  2MJI A;  3P6C A;  3PP6 A;  1PEE A;  4ZGF A;  3KQ0 A;  4QQ1 A;  1LID A;  2WWP A;  2CZT A;  4YBP A;  4O3Y A;  4BQU A;  1I05 A;  2RN4 A;  4IB9 A;  4FBO A;  5BVQ A;  5F58 A;  5BVT A;  3F9D A;  2ASN X;  1NP1 A;  2RCQ A;  3KFG A;  4I3C A;  1ADL A;  4EEB A;  1HBP A;  1IIU A;  3PQS A;  2G7B A;  1LKE A;  1CBS A;  2GTL M;  4IAX A;  1BSQ A;  2JN3 A;  5H9A A;  3B2L A;  1N0S A;  5HWZ A;  3FEN A;  4DQ3 A;  3CK6 A;  3P6H A;  3P6F A;  5CYB A;  2AT6 X;  4KT5 A;  4QZT A;  3KZA A;  4O49 A;  2CM9 A;  3JSQ A;  1KQW A;  5EDC A;  5LJC A;  1EIO A;  1AEL A;  2IFB A;  4KC7 A;  3C76 X;  3OD9 A;  3HWD A;  1CRB A;  2MO5 A;  1MDC A;  4EQA C;  5LJK A;  4ZFX A;  4NYR A;  2CBR A;  4A1H A;  1DZP A;  3CR6 A;  3NAD A;  1Y9L A;  2K23 A;  1IFB A;  1ICN A;  4WFV A;  1BBP A;  3G7X A;  2ALL X;  3BDR A;  1BM5 A;  3RBY A;  1GX8 A;  3S5V A;  4AYH A;  3ZWE A;  4OS3 A;  2HLV A;  1P6P A;  2AT0 X;  2AH7 X;  2ZAI A;  1CBR A;  4ORY A;  1EPB A;  1HBQ A;  3KFF A;  2Q9S A;  2AT5 X;  4I0U A;  3FA6 A;  3B2H A;  1B0O A;  3NWI A;  4JGL A;  1HQP A;  2QM9 A;  1T68 X;  3PQU A;  3KFH A;  2W2B A;  1GT4 A;  5EDB A;  3VG2 A;  4D6A A;  1VYG A;  2E4J A;  3K3L A;  3PED A;  3CQN A;  4LZV A;  2GTL O;  4O4U A;  3ZW1 B;  4FBV A;  1X89 A;  1KZX A;  1NP4 A;  4GK9 A;  4ZR2 A;  5KID A;  3NQ9 A;  1QQS A;  3BU1 A;  4WBK A;  1JV4 A;  1ZNH A;  3TGB A;  3NX2 A;  4I9R A;  4O4X A;  1FDQ A;  1HMS A;  2L68 A;  5HCD C;  3BX8 A;  1B8E A;  4IMN A;  3ELZ A;  4QYN A;  1SXX A;  3FA9 A;  2YG2 A;  4MIR A;  4K19 A;  1YWD A;  3FYF A;  2HZR A;  3VPJ E;  3UAQ A;  4KH8 A;  4MVL A;  3UEX A;  4QZU A;  3RSW A;  4QGX A;  1CJ5 A;  3VU1 A;  1HMT A;  4YFQ A;  4GZV A;  4ORW A;  3UEW A;  2CZU A;  3FW5 A;  3OE3 A;  3QKG A;  2CBS A;  1S2P A;  2F73 A;  3FMZ A;  5LJG A;  3HK1 A;  5D48 A;  1ML7 A;  1MX7 A;  1KT3 A;  3BS2 A;  2QMI A;  2LKK A;  4GU8 A;  1GT1 A;  5F6B A;  3WJE A;  1MVG A;  2X8F A;  1OBP A;  2XKL A;  4MVI A;  1FTP A;  2OFM X;  3EBW A;  1G7N A;  1G5W A;  3B2K A;  3BRN A;  3RWX A;  3VE1 A;  1IW2 A;  3P02 A;  4L3R A;  4UU2 A;  2QO6 A;  5IO6 A;  4YGZ A;  2KT4 B;  4EEJ A;  5AQ6 A;  1U18 A;  2BHV A;  1KT7 A;  2WUT A;  5HBS A;  1EAL A;  3ZW1 A;  1E06 A;  3KFI A;  3NQK A;  2RA6 A;  3WJD A;  2RD7 C;  4EED A;  2P8G A;  2HN1 A;  2OFR X;  2WR6 A;  1A18 A;  3FLL A;  2HMB A;  4PSQ A;  4XMG A;  3P6D A;  3APX A;  4U9C A;  5FQ8 E;  4NLI A;  3TF6 A;  4WFU A;  1KOI A;  1B4M A;  3HWG A;  3AKN A;  4TNN A;  4FQB B;  1OBQ A;  3AKM A;  2NNE A;  4LKT A;  1D2U A;  1U0X A;  3VG6 A;  2M4L A;  1FEN A;  3UEV A;  5EED A;  4MIS A;  3FEL A;  3I17 A;  4GNY A;  3I0A A;  1QFV A;  3L4R A;  3U0D A;  1URE A;  3P6G A;  2L5P A;  2FRS A;  3FEP A;  4EFG A;  4O3Z A;  2WQA E;  3NR3 A;  1O8V A;  3GAQ A;  4XMC A;  2JU8 A;  3MX7 A;  2WSJ A;  1VPR A;  3D97 A;  4OMW A;  4QGW A;  4Y0R A;  3VG7 A;  1TXL A;  5EZ2 A;  2JMB A;  1B56 A;  5HZ8 A;  3CQR A;  4L1N A;  2X46 A;  3FA7 A;  2AT3 X;  1EI5 A;  5H9K A;  1SY3 A;  1MUP A;  4ARH A;  3FR4 A;  3NQ3 A;  5AJC A;  5L8I A;  4AZR A;  2A2G A;  1X71 A;  5LKE A;  4O3X B;  5FQ7 E;  4QNI A;  1Z24 A;  4YFP A;  4O9S A;  4U8U O;  1QFT A;  1T8V A;  1EW3 A;  1A57 A;  5H9L A;  1JJX A;  3UEU A;  2A13 A;  3WJF A;  4ZGU A;  2MHD A;  2GTL N;  2HN2 A;  5C0N A;  4HPC A;  4WHI A;  1KXO A;  1X8P A;  2HNX A;  4NLJ A;  2LFO A;  3BSZ E;  3FR2 A;  4AZN A;  1OEK A;  1HN2 A;  2NND A;  1HMR A;  2Q39 A;  5LJD A;  4QGV A;  2Z4I A;  2WQ9 A;  2HZQ A;  1H91 A;  1CBQ A;  1ZNG A;  2DM5 A;  4GH7 A;  5CE4 A;  1KT6 A;  1R0U A;  4IMO A;  4OS8 A;  4TKH A;  4YGH A;  3C77 X;  2QO4 A;  4NW4 A;  1BEB A;  4CK4 A;  1EII A;  5HCC C;  2CM4 A;  2MM3 A;  3CBS A;  3NP1 A;  4ORS A;  4TJZ A;  3FR5 A;  3BU9 A;  4MVE A;  1BSO A;  5LJH A;  3HOE A;  2G78 A;  2YMS A;  3OJY C;  4HPA A;  2IUB A;  4IAW A;  3HOL A;  1PMP A;  3V8U A;  1JBH A;  1QAB E;  5L8N A;  3S26 A;  2HYS A;  5IO5 A;  1BJ7 A;  3O2Y A;  4GNW A;  1G74 A;  4EV6 A;  2NNQ A;  4A8Z A;  4BVM A;  4ORR A;  3PH5 A;  4RUU A;  5EPQ A;  1QY0 A;  4QAE A;  3H3I A;  4PJ2 A;  1QWD A;  1SY0 A;  4O4S A;  4YCE A;  1DV9 A;  1A3Y A;  2FT9 A;  1FE3 A;  4KC8 A;  5HZQ A;  2PY1 A;  3SOT A;  5AEO A;  4Y0Q A;  4IB7 A;  1QY1 A;  4ODD A;  5FQ6 E;  4NNS A;  3VE2 A;  3D4R A;  4NYQ A;  1G85 A;  1YUP A;  2FS7 A;  4MVK A;  5FFH A;  2BBJ A;  2ACO A;  1AVG I;  5H9N A;  1GGL A;  5HTE A;  4EGW A;  2G79 A;  2OVE A;  1TOW A;  2FTB A;  1JIW I;  1QY2 A;  2JU3 A;  1FEM A;  3FEK A;  2JW1 A;  1I04 A;  4YDB A;  1I06 A;  3IA8 A;  3EBK A;  4O4O A;  5D45 A;  1IKJ A;  2OZQ A;  2R73 A;  3WOV A;  1TVQ A;  1ERB A;  1XKI A;  2W2F A;  4TQ2 A;  3DSZ A;  1IKE A;  3N91 A;  4HFO A;  4ZHD A;  5JR8 A;  1ZNL A;  3NVO A;  2AKQ A;  2O62 A;  4IB6 A;  3ZI8 A;  2ANS A;  2ZAG A;  4XME A;  5HA1 A;  3B2J A;  1D3S A;  1RLB E;  4TKJ A;  1UZ2 X;  2GC9 A;  3BX7 A;  3JCF A;  1LPJ A;  5HZ5 A;  3E3C A;  3WJC A;  4NNT A;  3LHN A;  4TLJ A;  1NGL A;  3FIQ A;  1EUO A;  1AB0 A;  1O1U A;  4U8U N;  4YH0 A;  4CSB A;  1ZNK A;  1LIB A;  1EXS A;  3VG3 A;  1OBU A;  5H8T A;  4ZH9 A;  3STN A;  4BOE A;  1RBP A;  3ZW0 B;  1KZW A;  1YWC A;  2OVA A;  5EEE A;  5IO7 A;  4YBU A;  4XMF A;  5K06 A;  1SY2 A;  1ALB A;  4M6S A;  3PPT A;  3IFB A;  4ZHH A;  2LB6 A;  2W2A A;  5B29 A;  1S44 A;  4Y0P A;  2FS6 A;  1ZRY A;  1ACD A;  1YWA A;  4FGI B;  4HPB A;  1DC9 A;  4HWM A;  4ZHG A;  4AZO A;  4TKB A;  5HAE A;  2A2U A;  3ZUI A;  1DFV A;  1YWB A;  1SXU A;  3JQO A;  1GT3 A;  3S60 A;  2AL0 X;  2JOZ A;  3WVM A;  4M7M A;  3VG4 A;  2OVD A;  3ZQ3 A;  4YMY A;  1E5P A;  1EQD A;  2KTS A;  1T0V A;  1GM6 A;  4ZHF A;  3VG5 A;  3HWE A;  1SXW A;  1GXA A;  3WXQ A;  5D8J A;  1BRQ A;  1YP6 A;  1KT4 A;  4ALO A;  1LIC A;  3EM0 A;  2RQ0 A;  2EU7 X;  1BLR A;  2A3F X;  5AJB A;  2F09 A;  3EYC A;  2K62 A;  2N93 A;  5B27 A;  4YKO A;  1LF7 A;  1VYF A;  2Q4N A;  3Q6L A;  3WJB A;  3FA8 A;  5DG4 A;  3GE2 A;  4I6S A;  3TGA A;  1ICM A;  1DZK A;  3LV4 A;  2X45 A;  3ZW0 A;  4ES7 A;  1A2D A;  1YP7 A;  2FLJ A;  3APW A;  4U3Q A;  3S5X A;  1X8Q A;  4D6B A;  1FEL A;  2RCT A;  3APU A;  4LQZ A;  5F1E A;  1SXY A;  4DQ4 A;  1OPB A;  4O3W A;  4I3D A;  4KCA A;  3PH6 A;  1GT5 A;  5HZ9 A;  4ORX A;  4EDE A;  3TZS A;  1PBO A;  4I95 A;  1X8N A;  1LNM A;  1SY1 A;  4NP1 A;  2LBA A;  5D47 A;  4AZM A;  4IAB A;  2POA A;  3F8A A;  2L67 A;  5HCE C;  4AW8 A;  2MWH A;  4ON1 A;  1GKA B;  3CBC A;  5LJE A;  1Y9T A;  4ALB A;  4ZHC A;  1CBI A;  1X8O A;  1X8U A;  4INN A;  5D4A A;  3RZY A;  2FWV A;  3U03 A;  1PM1 X;  4IB8 A;  1ERX A;  2XST A;  2LBV A;  4Y0S A;  1KQX A;  4A1Y A;  2ACP X;  3DTQ A;  3O22 A;  4ID2 A;  3O19 A;  1DZJ A;  5JTG A;  5F6Z A;  4EXZ A;  1I4U A;  2BT9 A;  4RUN A;  1U17 A;  5FAZ A;  2QOS C;  4YFR A;  1YIV A;  4YDA A;  4R0B A;  3ZUO A;  1GX9 A;  4LZU A;  1DZM A;  4ZJ0 A;  2X8S A;  1BWY A;  1LIE A;  4GDZ A;  4ZCB A;  4XMH A;  5BVS A;  1O1V A;  3ZW2 A;  3U9P C;  2Q2M A;  4I3B A;  3EMM A;  2GJ5 A;  1LIF A;  3D95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...