3RKGA

Structural and functional characterization of the yeast mg2+ channel mrs2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
b'KQLLSLKPISASDSLFISCTVFNSKGNIISMSEKFPKWSFLTEHSLFPRDLRKIDNSSIDIIPTIMCKPNCIVINLLHIKALIERDKVYVFDTTNPSAAAKLSVLMYDLESKLSSTKNNSQFYEHRALESIFINVMSALETDFKLHSQICIQILNDLENEVNRLKLRHLLIKSKDLTLFYQKTLLIRDLLDELLENDDDLANMYLTVKKSPKDNFSDLEMLIETYYTQCDEYVQQSESLIQDIKSTEEIVNIILDANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transporter MRS2, mitochondrial
publication title Structural and functional characterization of the N-terminal domain of the yeast Mg(2+) channel Mrs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
total genus 89
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 3rkgA02
2.40.128.330 Mainly Beta Beta Barrel Lipocalin Lipocalin 3rkgA01
3NWIA 2IUBA 3CK6A 2HN2A 2BBHA 3NVOA 2HN1A 5JTGA 2BBJA 3JCFA 3RKGA 4EGWA 4I0UA 4EV6A 4EEDA 4EEBA
chains in the Genus database with same CATH superfamily
4MEEA 4LF8T 4L5GA 2X8SA 1PEEA 4YT0A 1SWKA 1N34T 5HZ5A 3AE9A 2LEHA 2DJFA 4JI5T 3IA3A 4CDFA 4O2AE 1NBXA 4GK0E 5JDQA 2P8GA 5HXEA 4AKLA 3D9WA 4EB6E 3WVMA 4GIWA 4JLEA 4IMOA 5HAXA 2IFBA 3ZZVA 4H63H 5EK2A 1FTPA 3AEDA 1E02A 2X9HA 3AB3B 4EEBA 2C5JA 1HMRA 1DZPA 3UQ4A 4B55A 4TX5A 1AVDA 3WJDA 3HOLA 1YWAA 4EFGA 4Z27A 4YLHA 2OY1O 3P4QA 3ZT6A 3FBZA 1ERXA 3FZHB 5KHPA 1MMGA 2KINB 3VG5A 3STKA 4NLIA 4GKKT 1HR0T 4ZHFA 2RTRB 5LB7B 1GGLA 4ORYA 4YMYA 3WZQA 3WJGA 2AKQA 4HWMA 1ALBA 4ZH6A 1B56A 2R73A 2WQAE 3EM0A 2AT8X 3AEEA 3C4WA 1G73A 4HWIB 5TAOA 1B4MA 1I04A 5F8PA 3UTKA 4IGUA 4TKJA 5L3CB 4PJMA 1R8IA 2CZTA 1MK5A 3E0ZA 3AA6B 5LJCA 1ZKEA 2J62A 4GOUA 1OBUA 2OVEA 2CXDA 2F4VT 3P02A 1CJ5A 4DUYT 4GYSA 2MM3A 3JADA 3KV4A 2YINA 2VL0A 4B3RT 2GC9A 4ZHDA 2YU1A 1N9MA 2XSAA 3VGWA 3MG5A 2WDQA 4COTA 5KIDA 3P8CD 2KWHA 4PJLA 3O1IA 2BKPA 3RF1A 4BX6A 3P6GA 4EXZA 1Y55X 5FMNA 3PUYF 3LBXB 2RTGB 1KT3A 2KD2A 3L4RA 3ELXA 4YSZA 3VR9A 5JDMA 4IB8A 4DUZT 4ORRA 4U8UO 3CQGB 2A0AA 2KNDA 3PQUA 4E7SA 2A72A 2HPLA 4QYNA 3TLVA 3AEAA 4MBQA 4O4UA 4TN7B 5JVDE 4UU3A 1A2DA 2X56A 2OY7A 4IABA 2UZ2A 1G74A 1IFCA 2RTPB 3VG3A 2RCTA 3BDRA 4KIIA 3GWHA 5HXHA 4NPPA 4AXPA 2YMSA 5H9NA 2HN1A 2Y8DA 1LIFA 4O4SA 2OF9A 3SRZA 1W09A 5DQWA 5FP3A 5AQFB 1MOYA 5D8JA 1U5PA 2OV9A 4TV8E 3I9WA 4DMVA 3KBTA 2AT0X 2UUCT 1ZHCA 3GMIA 3ZW0B 3RYFE 4JI8T 3NPOA 3UEUA 1E06A 5D45A 2HH7A 2IHR1 3RI5A 5HZ6A 1SY1A 1FMVA 1LVFA 2YDQA 1UURA 5AQOB 4AQFA 4DO0A 4O4JE 4PNIA 4IHJE 1HBQA 2BS6A 3I0AA 3APWA 5FXWA 2X9WA 4Z8XA 2PBIA 3RGLA 1Y9LA 3HWEA 5AQHB 4L1NA 2VB6A 4FBRA 2K62A 2OVDA 2ZM6T 2D2SA 1VWQB 2QCBA 1KNPA 2JQQA 1HX1B 2JU8A 2L9CA 3VHHA 3FXEB 5L2LA 5DPQA 2PJQA 4F8HA 2V1DB 3V5UA 5LXTE 4KHPT 1YP7A 2Q9SA 3LK42 2VFCA 5FNVE 5B27A 3CPZA 4RUNA 2X67A 1OSPO 4H9NC 2D5UA 3ZJ2A 3WZPA 2X8TA 2FHLA 2KLQA 1MUPA 2W67A 3NWIA 2RTCB 3DTQA 4BGFA 3LBXA 4XBFB 5KDMC 2HHHT 3N9OA 2A5BA 2KWIB 2LHNA 5AQRB 1IW2A 5D47A 4A1YA 5F58A 3ZEFB 3AEHA 1YIVA 2QO6A 1N32T 3G7XA 4TV9E 3ZMSB 5H6RB 2RTHB 4DBQA 4YVBA 3CKGA 2N9DA 4GKCA 5ABHA 3VG2A 3AAAB 2WR6A 4XZCA 3CKFA 1E2TA 1VWJB 5B5FA 1E7PA 3HKBE 3T1HT 4UVCB 4FBOA 4BQUA 3ANWA 5F7GA 3PECA 1STRB 3RZYA 4IB9A 1GXAA 1WUBA 3ZN1B 1EXSA 1U4QA 4TUYE 1ICNA 4UV9B 2WSJA 1SA0E 3PUSA 2XJ7A 3EDVA 5AQQB 4ORWA 3NRXA 3PPTA 5IO5A 5ABEA 1LFOA 3FZKB 3PEDA 2W2BA 1S35A 1QY0A 4IREA 4AI6A 3K8PC 2EHOA 3CQXC 1HCIA 4GUZA 4IDOA 5LJNA 4N78D 1IIUA 4X1IE 3EW1A 4QGXA 3C78X 3RC8A 2LSKA 3WJBA 3W15B 3C76X 3CMPA 4NNSA 1LPJA 4BJMA 4A98A 1PMPA 3VE1A 4HFDA 1ACDA 1JV4A 4A8ZA 2JJ9A 4IE0A 3P4RA 1TVQA 2GK9A 5EDCA 2IZBA 1KQXA 2ALLX 1SWJA 3JAEA 3MZKB 3CQCB 2YDRA 3I0OA 3JQOA 3ELZA 2POAA 2H7VC 3UEXA 3LK2B 2X8FA 4DV5T 1IJ6A 5E0OA 4KCAA 3RRWA 4X62T 3UUMA 1TOWA 2CXLA 3ZSSA 5LNKA 2G5LA 2WU2A 3EABA 5EK3A 5HXSA 1TW4A 3K3OA 5EEDA 3J7Yq 1PTSA 1J5ET 3BLGA 2RTDB 2X4MA 4KP3C 4NYQA 4NV7A 2NW8A 4UXNB 1ZNDA 3GA8A 1R0UA 3JCFA 4U3CA 3NQ9A 4JO6A 3I9YA 4QH1A 3P6HA 5HA1A 2DCFA 1CUNA 1MX7A 4OHFA 4TZ4C 4Y0QA 5IRUA 4DNEA 3UU6A 3IBPA 4YKMA 5HTEA 1TXLA 1O1VA 1SXYA 4PFOA 4MVIA 1V9DA 3U78A 4EZHA 2NTYA 3S26A 2MOZA 1OEDC 4QGWA 1FELA 1NGLA 1YWCA 1DZKA 3EYCA 2KXPB 3C98B 5F2BA 3ZYKA 3UU4A 2FRSA 2V7KA 2WEXA 3AEGA 4BCSA 3RSWA 1K3BA 5BR8T 1VWPB 2PTFA 3B5MA 1T68X 5HZ9A 3PU8A 2CWOA 3VU1A 5LCYA 1SHZC 3Q2MA 1D3SA 1OEEA 3UU8A 3NBXX 1P6PA 4I4TE 2XQAA 5LYJE 4FGIB 3SZIA 1Z24A 2VFBA 2E2AA 4QXCB 4GK5E 4OS3A 1VCTA 4CDDA 4M7MA 2KZ7B 3NZQA 2OFAA 4IDQA 1EPBA 4PK5A 4ORUA 4QNIA 2E5VA 4GYRA 3ZJ1A 4GDAA 5M4YA 2CM9A 3P6DA 2VKHA 2XQ7A 4AQYT 4DMWA 3FMZA 3SFEA 2C5KT 1FE3A 5FXVA 2FLJA 4PAGA 2OFRX 2BG9C 1GQEA 3GN5B 4C90A 5KXJA 3VKGA 3JAFA 3FEPA 3R6NA 3N2GE 2W4XA 5L3FB 3E3CA 1W0BA 2WEWA 3PH5A 1SMPI 2GTFX 2F01A 2V6YB 3AEBA 3ZMUB 5AQMB 4HWHA 3H37A 4IMNA 3S5VA 1D1AA 2J47A 4F6RC 5JR9A 2WBLA 3NP1A 4CPIA 2IZDB 2ZM0A 2ASNX 5L3BB 2LM2A 1UYOX 3UULA 5JDGA 2BS4A 1HBPA 3NR3A 2A5CA 2IDOB 3B57A 5F5WA 2CE7A 4EXTA 5LHHB 4TLJA 1MNEA 5CYBA 1A18A 1UX4A 3RDUA 4P1NA 4ARHA 1XDOA 3H3IA 3F31A 2AH7X 4ASKA 4HFCA 2Z4IA 1SY3A 4XMEA 2RN4A 2CM4A 1JYDA 5HWYA 2QRXA 3N2KE 2XAJB 2IZKA 2V7JA 4ZI7E 4BOEA 2D9DA 4JV5T 2RPAA 3OKQA 5B5GA 2Y48B 2L9QA 4P0BA 3TLWA 5LJHA 1IBLT 1D2UA 1QFTA 3WAKA 3B2LA 2H89A 1T8VA 3ZMVB 4OMXA 2BBJA 1HMTA 1YXRA 3KFWX 4M1PA 5AEOA 1NWMX 3SLJA 2XAHB 4WFVA 3WAJA 1EIIA 3STMX 2ES0A 3ZMTB 4NP1A 3FW4A 4ZGFA 1M62A 4HN9A 5AQVB 4DR5T 3T2WA 1IZNB 3ZW2A 4LMKA 1LELA 3AE8A 2MPKA 3RBYA 3QOFA 3P50A 2JGSA 2E8IA 3A5XA 2XASB 2IMLA 4X65T 4EEJA 2BKNA 4YSXA 2DI4A 1WRDA 5HWZA 3ZN0B 4TKBA 3Q5XA 4O3ZA 3KZAA 2VVSA 2HYSA 3AE7A 2CMRA 4O9SA 3KINB 5AQPB 2V6YA 5KX5E 3X00A 1NQNA 3LFMA 3ZI8A 4ZI3C 4LF9T 4A1HA 3AXJB 1SRHA 2V7IA 4YH0A 3OYXA 2RTAA 2WP9A 3L09A 1Z8UA 3RLFF 3I1AA 2Z4HA 3L39A 4KMCA 1DFVA 3WBGA 2FJDA 1QQSA 1CBSA 2EHOD 2BVLA 3HOEA 3HKCE 1XNRT 1MDCA 1BEBA 3QNUA 2JQ9A 4YGGA 1BR0A 5HZQA 3NZPA 4PK4A 5K68A 3FR5A 2LJLA 3ETVA 4EV6A 1VWGB 4AYHA 2AT6X 4H9RC 1SE7A 3MVFA 4LQZA 4BX6B 3G06A 1MIVA 1SWLA 4HPDA 3ZW1B 1HXLA 4XMCA 2AT3X 4DV3T 3ZYMA 1LCWA 3RY2A 4FJOA 2IZJA 3FZLB 3RYIE 5AQIB 1IBMT 3E08A 3WJCA 2LM9A 3CX8B 4CN1A 2XAGB 4I60A 2XQ3A 5J2UE 2YN6A 2WWVA 2RTOB 3GAQA 4ALOA 4LF4T 4YHJA 4HTEA 5L4HA 5JREA 4ORXA 2GTLM 1RSUB 4INNA 4Y59A 5ABFA 3Q6LA 5B3MO 2LRKA 1IFBA 3D0TA 1J1JA 3CBCA 1DZJA 1IKEA 5FY7A 3RDMA 5AJBA 1VWEB 2W62A 5LG3A 4K0UA 1QY1A 3C77X 4BVMA 3AE2A 3UU5A 2CZUA 4GNYA 2CCQA 1LCZA 4O3WA 3MJXA 4JGLA 1GT1A 1VWHB 1G5WA 5HA0A 5C8YE 4AZOA 2OVAA 1G8XA 2Q2PA 2WMOA 2QVAA 2WCAA 1ML7A 2OZQA 2IZLB 4AW8A 4YGHA 4MVEA 4EYYR 4ILCA 4CK4A 2JQHA 3A7MA 3AXJA 4ILBA 1KT7A 5AQUB 4IDZA 2V5DA 1IBKT 5IWAT 4QRLA 3VHMA 4CN4A 2JRKA 3P4WA 3EUHA 2Q9QD 2IZEB 4WBNE 5LJGA 2FGSA 4N7CA 4Y0PA 3EAMA 4R0BA 4O3YA 5H9AA 3PUAA 4PJ2A 3CK6A 4BAYB 2XY8B 2PFVA 4KT5A 1NAFA 2DHRA 4MVKA 3KDSE 1N33T 5CSEA 1N36T 4GGRA 3LJCA 2ACOA 2CEAA 2AMMX 2YU2A 4JBWF 2IUBA 2ZAGA 5LGUB 2XTLA 3ZW1A 3F6ZB 3FA6A 4FQBB 1NQMA 3NX1A 1KEYA 2JMHA 2V26A 1UYNX 2LA7A 4O4HE 3OBLA 5EK4A 5FL0A 2LB6A 2JN3A 4H63V 2H88A 3FZFB 2CBRA 2XQ5A 2E9XD 3ONJA 4GRJA 3RE5A 5AQSB 1AJ3A 3AKNA 2W2FA 3OYZA 4ZFXA 5J2TE 2IIUA 3PP6A 2XAQB 2KT9A 1SA8A 4ON1A 3RY1A 4I55E 1N43A 5LJKA 4DVDA 3O9XA 2H3RA 5IO7A 2QA7A 1KZXA 2I5ZO 5FY0A 2KTSA 1LCVA 4ERRA 2HZRA 2LBAA 4HFOA 3BQLA 3OBVE 5KMGP 5L3YA 4X1KE 4I9RA 3AVSA 2LLYA 4MHCA 3KV6A 4IT4A 5AQ6A 1W0AA 4U31A 3AE1A 2X34A 3ANWB 3RIUC 2NNEA 3B2IA 3LG7A 4PK6A 3EC5A 2RTIB 1YP6A 4AKIA 2LE8A 3AE3A 1VYFA 4YTNA 1X8QA 4IE5A 4A97A 4ODDA 1KT4A 2DM5A 2DLRA 1EW3A 1LIDA 3RYHE 1SRJA 4ALBA 4UV8B 4U7YA 4OK0A 1DZMA 1QLBA 2BG9E 4O4XA 3ZT7A 1JBHA 2RTNB 2EHOB 1MIWA 1SWSA 3RDOA 2YEVC 3ETUA 5CHKA 2NW9A 5CJ5A 4HWFA 2OL6O 3SS1A 5LG4A 3FZMB 2ZAIA 2LBVA 4TNNA 2FS6A 4OELA 2N1GA 2LKHA 2HPJA 4YJ2E 2ACPX 4NXNT 3FR4A 1MMNA 1XKIA 4MALA 3ZWEA 2BVMA 4IIJE 2MWHA 2UYWA 4V1Av 2XPKA 3JC6C 5IYZE 2FJBA 3VE2A 5JDNA 3TKLB 1S44A 4EDEA 5BYPA 5HWXA 4D6AA 4CQIA 1GT4A 2DJGA 4I3BA 2CPTA 3TGCA 1RXJA 1SWDA 2C1SA 2NWBA 3C4ZA 1X8PA 4HKAA 5L8OA 3FHNA 2CLYB 3N9MA 3KQ0A 3CQNA 5FY1A 3L8RA 5HEOA 4X66T 2VQFT 3CWZB 4UF0B 4YTMA 1HFAA 4ZHGA 4X64T 1FIOA 3BS2A 2LFOA 5HCJA 3HPEA 1U18A 5FYMA 2RTJA 3FENA 3VRBA 2BDEA 2M4LA 4BJNA 3ZSTA 1Y52X 1YQ3A 3D97A 3PUGA 2B76A 4P0AA 5JDLA 2NW7A 2JMKA 4U2ZA 1G7NA 2CRBA 4G2AA 3TLUA 3S5XA 1A3YA 5H9LA 2MHDA 4NYRA 4O3XB 2GTLN 2N93A 3NVOA 4L9IA 2A2GA 3HKDE 3P24A 2WWUA 5BVQA 2VDFA 2CBIA 2IZFB 1JMXA 1HG2A 4GZVA 4NUUA 1D1BA 5EEEA 5L3DB 3FA9A 2B1EA 4Z2PA 5L4EA 3IEEA 2YKSA 3T6LA 1T7SA 3FXDB 1X9BA 3SWHA 2YG2A 3C64A 1YW0A 2L67A 5FXXA 1RXHA 5HBSA 3D4RA 2CM0A 1SWCA 2LSJA 2Q4NA 1DC9A 1N4JA 1SWUA 3IA8A 4YFPA 4UVAB 1U17A 2VKDA 2WZIA 4G63A 1BSQA 3PUZF 3RYCE 2XQ6A 2D0UA 5KICA 1TOUA 3Q5DA 2FR2A 4ZI3D 4ZI2D 2Q9QB 2JW1A 3ESLA 5DQVA 2OF8A 3T8OA 4L3RA 3DP7A 3S4UA 1PM1X 3U9PC 3RQUA 4H9OC 4YTPA 2FTBA 1BM5A 3OD9A 3VHIA 5B2AO 3FIQA 1LVKA 2FWVA 3LV4A 2X0YA 3HWDA 1WCRA 5LHGB 1SXUA 2OY5O 1JZUA 4O2BE 2GJ5A 3FW5A 2QOMA 3N9LA 3WOVA 4ADZA 1T72A 2FJEA 4NUVA 2C0SA 2OFBA 1GT5A 1JMZA 5LP6E 4GGZA 3MKDA 1ZEEA 2PY1A 5K67A 3EBKA 1B0OA 4E7ZA 2BKOA 3I0QA 1MX8A 5DABA 1QSDA 2K5BB 1SWOA 2WQ9A 2E9XB 4YCEA 1BR2A 4MFRA 2WY2A 3VHLA 2F73A 3BX8A 3BX7A 4I6SA 1KOIA 1SWFA 2C1QA 4HGAA 2HKDA 3PJAJ 4X1YE 4UF0A 1QG5A 4FI5A 2CBSA 5LKEA 1XMOT 2UXCT 4LZUA 2VWAA 4Z90A 4IBAA 4GKJT 4QAEA 4U72A 2ODUA 3NX2A 3Q5WA 4CI1B 2QGSA 4PW8A 4IAWA 2OVSA 3IF8B 5LGTB 1HN2A 3CX6B 3O4XE 4JI3T 3P6CA 3RC3A 5CA1E 1FMWA 1D0ZA 4X5TA 1NENA 3AAEB 3SOTA 4HFEA 3TLSA 1ICMA 2ANSA 3FBLA 5A1LA 1VWCB 2G8CO 5JR9B 1SLFB 5GONE 1QWDA 3N9QA 3X1DA 2DWKA 4KX6A 2FJAA 4KH8A 3KVAA 1D1CA 4TQ2A 3O2YA 2VURA 2XHEB 1YQ4A 4Y0RA 5L3EB 1BRQA 2BLGA 1SWTA 1LICA 5F3JA 1ZOYA 2XKLA 2Q9QA 3PJAA 1SWGA 5D4AA 5HTDA 1ADLA 5F6ZA 1SWHA 2HLVA 3KVBA 2CAMA 3FIDA 3T2XA 3O1HA 2KTDA 5AQLB 1Y01A 1CHUA 1DU2A 3HL6A 3PUXF 2OL7A 4JNJA 3ZMZB 1MMDA 4YBPA 2D0TA 4HEAA 1N0SA 1BSOA 2V6XA 2CA5A 2X45A 2MTQA 2JOZA 3TZSA 4NLJA 1EI5A 3WJFA 2WB5A 4CZZB 5HCMA 3HWFA 1AB0A 2LKGA 4A60A 2E9XA 4QX7B 5L3GB 5HAEA 2G0UA 2FT9A 5LA6E 2IW5B 4NW4A 1H91A 3FLLA 2W00A 1T98A 2L3LA 1OPAA 3FA7A 1LF7A 4WBKA 2VL8A 4ZEYA 1SWNA 3UEVA 4LF6T 4HPAA 3WI3A 1NEKA 4OYKA 5K06A 1GT3A 5HCDC 5AJCA 3J9X1 3CQRA 4BX5A 2X9YA 2RA6A 1HXZA 3VG4A 2BG9A 4CPEA 3MK7C 4MVLA 2A3FX 3BU1A 3ZKRA 5J1GA 1HNWT 2QO4A 1JNRA 1LNMA 4H9QC 3K3NA 2W0GA 2VVNA 3V8UA 2BHVA 4HFBA 1ZNGA 2MJIA 2X0LB 3FR2A 4IE4A 2XQ9A 3AEFA 5HEUA 3F57A 2W2UA 1KXOA 1AVEA 2PI3O 4WHIA 5FVLA 1BLRA 3UUBA 3AE5A 1VCSA 4LFCT 4AIUA 4U74A 4D6BA 2E5LT 4UVBB 1B7TA 3ZUOA 5FQ7E 2RTBB 1WR6A 3SFDA 4QH5A 5JRCA 2WAUA 3NQ3A 5FL1A 3M65A 1HQQA 2ZMAA 3CMLA 3P6EA 4CXWA 5AQJB 3CBSA 2G7BA 1SWAA 3WXQA 3BRNA 3ZCIA 4COFA 2X32A 4CXYA 4OFZA 2MF6A 5LJMA 1SXXA 4WFUA 2V7LA 4ZGUA 4YBUA 1JJUA 4AZNA 5HEGA 3PV0F 4M6SA 5L8NA 3EI0A 5HXCA 2NNDA 4ZZCA 3PDFA 2K3WA 4AZQA 1EALA 4IRWA 2OY8A 5HCCC 3ZLIA 1E2AA 2IAKA 2MBGA 4DR2T 2WUTA 3O19A 1XNQT 2VK9A 2J1DG 1IAPA 5ABFB 4UR9A 1STPA 2VKJA 2WDRA 3O22A 4AKHA 3MACA 3Q9DA 1YWDA 3PH6A 4O4OA 1GX3A 5HCEC 5ABGA 3EW2A 2OA5A 3UU3A 1VWKB 4NV8A 1HF8A 3B2KA 3PK2A 4AZMA 3FYFA 3HTYA 3AE4A 3KBUA 4BJ8A 1Y53X 4ZH9A 4DV7T 3I17A 1EPAA 4Z2VA 1BR1A 3T1DA 2WSSV 1VWNB 4U33A 2C4IA 3K3LA 1E1HB 2XAFB 3AA1B 3LHNA 1CBRA 1VWLB 2XZEA 1XDPA 1ZNKA 2Y6XA 2RTMA 2BZBA 1AELA 3M3ZB 3LDQB 4DR7T 1GX8A 3UEWA 5DG4A 3UQ7A 4IE7A 1ZNEA 2A8GA 2WWPA 3BSZE 4WYVA 3IHRA 1FENA 5BVTA 2WQYA 4HWCA 1JJJA 4Z6JA 2ACXA 1W9RA 2GTLO 3VU7H 1VWIB 2RTQB 3SOLA 3B2JA 4EZ4A 2XQ8A 2V7MA 1VPRA 3TLTA 2LSIA 4Z2OA 4JHQA 4I0UA 1I78A 1HMSA 2FBWA 4BA9A 1J5WA 3AA7B 1FEMA 3TGBA 1I6ZA 1DV9A 2YOEA 3ONXA 2G79A 5C2TA 4YKOA 3VG6A 2R74A 2IZIA 3ZQ3A 2IZCB 1BBPA 4DV1T 2XM2A 4ORSA 4DR4T 4A56A 3GE2A 4CN6A 3RX6A 2I5VO 1SXWA 4U9CA 3LK3B 2WM9A 2XQ4A 2KMFA 4LMJA 1NP4A 3AVRA 4YFRA 4OS0A 4OKAA 2I6HA 4KUMB 1ZV4X 1YWBA 1KK7A 2K9AA 2BSZA 1SLEB 3FELA 2A2FX 4ZS3A 1MVGA 3T1YT 3R84B 4CDCA 4K0KT 3D95A 3MBTA 3JSQA 1BWYA 4PJNA 4I3DA 2RD7C 2XSBA 3KVNA 3UAQA 4LZVA 2Q39A 1SWQA 4LMLA 4I3CA 1GKAA 4TKHA 3VG7A 3EMMA 5AQTB 1N9YA 1XCAA 2W2AA 1QABE 2CXFA 1OXZA 4OS8A 4U46A 3RDQA 1LDOA 5ETWA 2QMIA 4EAHA 1UX5A 1T0VA 3QKGA 3PDYA 3VKHA 4DCBA 2OYBO 1S2PA 1RBPA 2Q2MA 2X9XA 1VYOA 4YFQA 4ILAA 3OJAA 3TF6A 4JI7T 4I50E 3RQWA 5C0NA 3HWGA 1FJGT 4EKVA 2PG8A 4LFBT 1KNZA 4FBVA 4EOZB 3UFEA 2WU5A 3FDCA 3Q34A 1KL4A 2BS5A 3T6FA 4U2YA 1AQBA 5HZ8A 2RTEB 4U7IA 1AVGI 4I43B 1W6FA 1BR4A 3ZT5A 5LMUT 4YCHA 5FXZA 3CX7B 4HWDA 5LHIB 1UUSA 3JS1A 2FS7A 1I4UA 4CXXA 3D96A 1OEDE 2W66A 5CGMA 1JQPA 2Y32A 4H9PC 4TJZA 4XMFA 1KFYA 2VKOA 2UU9T 3H3AA 4LFAT 2CBJA 1OEKA 1VWDB 4ES7A 2P9BA 4WZXA 5LMNT 4JI4T 3KFIA 1X89A 1SY2A 3QB5A 4YSYA 2K48A 4QZTA 1NP1A 2WZHA 1SREA 1HX8A 2IC9A 4JUYA 1WBIA 4CPHA 4IL9A 3ZC0A 5FKYA 4GGTA 3N9PA 2YDSA 2RTLA 4LKPA 4ZCBA 4DQ3A 4ISTA 5FENA 4QX8B 1JYJA 1Y9TA 5JDFA 5ADXL 4ZR2A 5JH7E 1DF3A 2DL1A 3KFGA 2JQKA 4CDEA 4DIDB 2FKGA 2H7OA 2F09A 4ZS2A 1WYBA 1KL5A 1EUOA 3NKZA 3CVRA 4ZZBA 5F6BA 3ZUIA 3K1SA 1SWPA 3RKOA 1KZWA 5H8TA 3AKMA 1VRBA 3U03A 2I0MA 1G85A 3P6FA 1VWRB 3RIUA 2XSTA 2O62A 3PUQA 5AQGB 1OWAA 2RTKA 2FUPA 4TWFA 4O49A 4EGWA 2NR4A 4AKGA 4JI1T 2UXXB 5D48A 4UIGA 4AQFC 3FB2A 1CBIA 2Y3EA 5HEJA 4A5XA 4U8UM 4DQ4A 1EIOA 4DBRA 2R6GF 3C51A 4AKRB 1JNZA 1SRIA 4QXHB 4ZOLE 1EQDA 5EZYE 2RQ0A 2UUAT 2A3DA 4LF7T 1LRZA 1BSYA 1L0VA 1K24A 4EEDA 5LKFA 3A8YC 2WMNA 3CIRA 4EYUA 1MNDA 3K3QC 1YD8G 3RIFA 5LGNB 5LBQB 5LOVE 3NADA 3KV5A 1VWMB 5C3JA 1YKHB 3DTOA 2LT3A 4IDPA 3PQSA 4JI6T 1M7KA 4PJJA 3B13A 3RKGA 4AZRA 4CI3B 3HI2A 3MXZA 3PU3A 1QFVA 4HPBA 4DNDA 4CSBA 2G78A 4GJVA 4Q25A 4OX9T 2JPFA 2VASA 5JD2A 1WFDA 1VWAB 2LRLA 2R56A 2XUEA 3E22E 1GM6A 4TNVA 2AL0X 2NNQA 2CWYA 1ZRYA 4ZXLA 2QM9A 3CR6A 4I9SA 2UUBT 2LSYA 3QC9A 4KHZF 4QXBB 4GD9A 1HNXT 4HE8A 2UXDT 4OMWA 3BY0A 4GDZA 4NNTA 3RRCA 3F8AA 2N2NA 2LSGA 1US7B 2HMBA 2M6IA 4N7DA 1RSTB 5EPQA 3CKDA 1A57A 5AQKB 1IKJA 2RTFB 4IDNA 1SUMB 5J0ZA 1X8UA 1OEDB 3BQIA 2BC3A 1WLXA 1QUUA 5B10O 3VPJE 3EHZA 1SWEA 1PBYA 3ZPOA 3QB5K 4X20E 5EDBA 1I06A 3WZOA 1T8BA 1HG5A 3EVYA 1E00A 5FQ6E 5FQ8E 4UU2A 4K19A 2EHOC 5CE4A 5CB4E 3V5SA 4J2CA 3ZW0A 1VWFB 4PSQA 3AA0B 2FHNX 1SWBA 1XWMA 2X68A 3RIAA 4O4IE 3HR0A 3C50A 2IC6A 5AQNB 4AZPA 2AF5A 4YGZA 4YFSA 2JMBA 4WW0A 2UXBT 2BS3A 2GH7A 3STNA 2J4GA 4AISA 1MIYA 4ISSA 2L68A 1UGOA 1KT5A 4HFVA 3IFBA 3PUWF 3MM0A 2EU7X 1HNZT 1BJ7A 3SLOA 4O4LE 2CLYC 4ML7B 3L3PA 4XMHA 2LOPA 2IZHB 4H9SE 1SWRA 1W4TA 2CHNA 4JYAT 1PBOA 3PUVF 3PE0A 2HZQA 2MAWA 3H3MA 4BX5B 3PURA 2JU3A 2BG9B 4B3TT 4ILUA 1VOMA 4Y5DA 4EQAC 5JR8A 1OBQA 4EIWA 3UUNA 4KC7A 3DSZA 3HKEE 5LJDA 3O1JA 1X79A 2NP9A 1X71A 2HN2A 1I05A 2X0HA 4YJ3E 2RA1A 2JU7A 3VR8A 3QQ2A 1O1UA 4MISA 4ZHHA 5LJBA 1WYCA 4MIRA 3F2EA 2ZM2A 5JTGA 3Q5EA 3RH3A 1LUQA 1MEPA 5BVSA 3UT5E 1JJXA 3S60A 4JEHB 1LDQA 5B29A 4QWNB 2M67A 2LHRA 2NOXA 3ZYLA 5JRCB 2L5PA 1YKEB 5LBMA 2MO5A 2KSRA 3WJEA 1S94A 4AQGA 1SLGB 4GU8A 1IJ8A 1OEDA 5HXRA 3RPUA 3AAIA 2X46A 3QUJA 3OPCA 3B2HA 3DJBA 3HK1A 1LIEA 1I9HA 2K23A 3BQKA 2Q9QC 3N5LA 4U8UN 4DV0T 5IRWA 4OEMA 1VYGA 4GETA 4IB6A 5IO6A 2CHOA 4GE1A 4C91A 4Z28A 4PFPA 3MX7A 2V5CA 2AE9A 5IRAA 3CWKA 1FDQA 2I59A 3ZCJA 2QYWA 4B3MT 3EDUA 4XMDA 5LJEA 3APVA 2RP4A 4GH7A 2XM1A 3APXA 4TNWA 1CBQA 3AECA 4QGVA 4RUUA 2VQET 4Z91A 3ABVA 2L8KA 3U3IA 2WPUA 1HS7A 2OLTA 2E9XC 1HY2A 4XAXB 1Y64B 5FAZA 4LF5T 2ZSCA 1ERBA 1ZNHA 1UCUA 1L6MA 1KT6A 4CV7A 2A9UA 1X8NA 3C4XA 1NC9A 2NP1A 3WYPA 3WYQA 4YDBA 1BRPA 4BX7B 1O8VA 3LTWA 3QK6A 5CA0E 5BMVE 3ZC1A 4ZHQE 1B8EA 4YXDA 3P7IA 3P4SA 1RXKA 1KF6A 3UUXB 5IHYA 3NRYA 3SLTA 2OFMX 3F9DA 3RWXA 1IJ5A 1ZP0A 1H7CA 5JQGE 3AE6A 4HPCA 2Y3FA 4B3ST 2K24A 2QOSC 1JIWI 2E4JA 2SPCA 2Z6EA 4GK9A 2LOSA 5JR9C 3VRAA 5DJQC 4KBMB 2X66A 5FFHA 4C5PA 3EBWA 5L47A 1RLBE 5IXGA 5H9KA 1VWBB 1Z0PA 1N7YA 1UZ2X 4ANJA 1SRFA 2AVIA 4DV6T 3APUA 5HEHA 3KFHA 1RAVA 4WBOA 4XMGA 2NTXA 1OPBA 1KGLA 4ZHCA 2ZLYA 1O3XA 4BBOA 2M6BA 3N9NA 4GNWA 4CI2B 2BT9A 2ACZA 1SY0A 4QH4A 4CPFA 1NDJA 3FEKA 2ZM8A 1LKXA 5IUXA 3RDXA 2JIWA 1X8OA 1ZNLA 5EZ2A 5CFBA 2OL8O 2KW1A 5HYAA 4GJSA 4U3QA 1E5PA 4KI0F 1LIBA 3JC6D 1GX9A 1UK5A 5JDHA 1MM9A 3P4PA 3KFFA 3SZHA 4ID2A 4NIQA 4YY3T 2FR3A 3PTRB 2ODVA 4JI0T 2DWGA 4UEMA 4IL4A 1GKAB 1STSB 2MYSA 1FEWA 4KC8A 3TGAA 3OTOT 1DF8A 2C5IT 3WZNA 4QKNA 4Y0SA 3HA4A 2AT5X 4TWHA 5H6QB 4DV4T 3FA8A 2X55A 4BX7A 1U0XA 4QQ1A 2QO5A 4DR1T 4P09A 1WR0A 4B6XA 5B11O 1Y0GA 1CRBA 3N2OA 3ONLC 1YUPA 3OE3A 2FKJA 1S7DA 2RCQA 4DR6T 1HQPA 2WS3A 3GN5A 2IZAA 5AFUL 4LKTA 1QY2A 1VWOB 2YK0A 4O8SA 1UREA 2BS2A 2HNXA 3RDSA 3N91A 2V8SV 4JI2T 1D0YA 4UELA 1KQWA 4IE6A 2UXNB 3NQKA 2LKKA 1W5RA 2A2UA 4ZI2C 4DV2T 3OVUA 3SZJA 5L8IA 1LKEA 1MMAA 4YDAA 5FVKA 3UFGA 1SRGA 1OEJA 2KT4B 4OYJA 3BU9A 3KV9A 4IB7A 1SLDB 1XZYA 1KFFA 4I95A 4QYPA 3LSVA 4IAXA 2AXDS 4QZUA 4HFHA 1FJ1E 2DNXA 4L0RA 3RHWA 3BK9A 4DR3T 4NXMT 1I94T 3OJYC 1EZ3A 2WDVA 3RE6A 4JEUB 1KNRA 3SAOA 5F1EA 1XMQT 4TWDA 1OBPA 4WNKA 2X51A 1D0XA 4HFIA 4QHOA 4CPHB 2W61A 2IZGB 2W63A 4ZJ0A 1KL3A 1HTJF 4YHHT 3U0DA 3AUMO 2A13A 2BBHA 3MA9A 2XQYA 4MLKA
chains in the Genus database with same CATH topology
5D48A 1QG5A 2CBSA 2X8SA 1CBIA 5LKEA 1HBPA 1PEEA 4LZUA 4U8UM 4DQ4A 5HZ5A 3NR3A 4IBAA 4QAEA 1EIOA 3NX2A 4TLJA 5CYBA 1A18A 1EQDA 2P8GA 2RQ0A 4ARHA 4IAWA 2OVSA 3H3IA 2AH7X 1HN2A 1BSYA 3WVMA 3P6CA 4EEDA 4IMOA 2IFBA 5LKFA 3ZZVA 1FTPA 3SOTA 2Z4IA 1E02A 1ICMA 1SY3A 2ANSA 4XMEA 3NADA 4EEBA 1HMRA 2RN4A 1DZPA 2CM4A 1JYDA 3PQSA 3WJDA 3HOLA 1YWAA 4EFGA 3RKGA 4AZRA 4BOEA 1QFVA 4HPBA 1QWDA 5LJHA 4CSBA 1D2UA 1QFTA 1ERXA 4KH8A 2G78A 3B2LA 4TQ2A 5KHPA 1T8VA 3O2YA 4OMXA 3VG5A 2BBJA 1HMTA 3STKA 5AEOA 4NLIA 4Y0RA 4ZHFA 1BRQA 4ORYA 1GGLA 2BLGA 4YMYA 4WFVA 3WJGA 1LICA 2AKQA 1ALBA 4HWMA 4ZH6A 1EIIA 3STMX 1B56A 2R56A 2R73A 3FW4A 4NP1A 4ZGFA 1GM6A 2XKLA 2AL0X 2NNQA 2WQAE 3EM0A 2AT8X 1ZRYA 3ZW2A 2QM9A 3CR6A 4I9SA 5D4AA 1B4MA 1I04A 5HTDA 1ADLA 4TKJA 5F6ZA 3RBYA 2HLVA 2CZTA 4EEJA 5LJCA 1OBUA 2OVEA 2KTDA 3P02A 4OMWA 1CJ5A 3BY0A 4GDZA 4NNTA 2MM3A 5HWZA 4TKBA 4O3ZA 3F8AA 3KZAA 4YBPA 2GC9A 2HMBA 2HYSA 1N0SA 4N7DA 5EPQA 4ZHDA 1BSOA 1A57A 1IKJA 4O9SA 2X45A 4COTA 5KIDA 3ZI8A 2JOZA 3TZSA 4NLJA 4A1HA 1EI5A 3WJFA 4YH0A 1X8UA 3HWFA 1AB0A 4A60A 3VPJE 3P6GA 4EXZA 5HAEA 2FT9A 1KT3A 2KD2A 2Z4HA 3L4RA 3ELXA 1H91A 4NW4A 3FLLA 5EDBA 1I06A 4ORRA 4IB8A 4U8UO 1OPAA 2A0AA 3FA7A 1E00A 5FQ8E 5FQ6E 3PQUA 1LF7A 1DFVA 4UU2A 4WBKA 4K19A 3UEVA 3WBGA 4QYNA 4HPAA 5CE4A 1QQSA 1CBSA 4O4UA 5K06A 3ZW0A 4PSQA 1GT3A 3HOEA 5HCDC 4UU3A 1A2DA 1MDCA 1BEBA 5AJCA 3CQRA 2RA6A 4IABA 3VG4A 1G74A 1IFCA 4MVLA 3VG3A 2A3FX 2RCTA 3BDRA 4KIIA 4AZPA 4YGGA 3BU1A 5HZQA 4YGZA 2QO4A 3FR5A 2JMBA 4EV6A 1LNMA 4AYHA 2YMSA 2AT6X 4LQZA 3MVFA 3V8UA 3STNA 2BHVA 1ZNGA 2MJIA 4HPDA 3FR2A 3ZW1B 4XMCA 2HN1A 2AT3X 2L68A 5H9NA 1KT5A 1LIFA 3IFBA 4O4SA 5D8JA 2EU7X 1KXOA 1BJ7A 4WHIA 3WJCA 1BLRA 2AT0X 4ML7B 4XMHA 3ZW0B 3GAQA 4ALOA 3NPOA 4D6BA 3UEUA 1E06A 4ORXA 5D45A 1PBOA 2GTLM 4INNA 2HZQA 3ZUOA 5FQ7E 5HZ6A 3Q6LA 1SY1A 2JU3A 1IFBA 4EQAC 5JR8A 3NQ3A 3CBCA 1DZJA 1IKEA 1OBQA 1HBQA 2BS6A 3I0AA 3P6EA 5AJBA 3APWA 4KC7A 3CBSA 1Y9LA 2G7BA 1QY1A 3C77X 3DSZA 3WXQA 3BRNA 4BVMA 3HWEA 5LJDA 2CZUA 4GNYA 4L1NA 1SXXA 4WFUA 4ZGUA 4O3WA 4YBUA 4FBRA 1X71A 2HN2A 1I05A 2K62A 4JGLA 4AZNA 1GT1A 2OVDA 1G5WA 5HA0A 2JU7A 4M6SA 4AZOA 5L8NA 1O1UA 4MISA 4ZHHA 2OVAA 5LJBA 2JU8A 2L9CA 4MIRA 2NNDA 2Q2PA 4AZQA 1EALA 5HCCC 5JTGA 5BVSA 1ML7A 2OZQA 5DPQA 2WUTA 3O19A 4AW8A 4YGHA 4MVEA 1JJXA 3S60A 1YP7A 2Q9SA 4CK4A 5B29A 5B27A 4RUNA 2L5PA 2MO5A 3WJEA 1KT7A 2X8TA 3O22A 4GU8A 1MUPA 1YWDA 3PH6A 4O4OA 3NWIA 2X46A 3DTQA 5HCEC 3B2HA 3HK1A 1LIEA 2K23A 1IW2A 3B2KA 4QRLA 5D47A 4A1YA 4AZMA 3FYFA 5F58A 3HTYA 4U8UN 4ZH9A 5LJGA 3I17A 1EPAA 1VYGA 4GETA 4IB6A 4N7CA 4Y0PA 1YIVA 5IO6A 2QO6A 3G7XA 4R0BA 3T1DA 4GE1A 4O3YA 5H9AA 4PJ2A 3CK6A 3K3LA 4KT5A 3MX7A 3LHNA 3CWKA 1CBRA 4MVKA 1FDQA 1ZNKA 4XMDA 5LJEA 3APVA 2ACOA 4GKCA 1AELA 4GH7A 2AMMX 3VG2A 2WR6A 3APXA 1CBQA 1GX8A 2IUBA 2ZAGA 4QGVA 3UEWA 5DG4A 4RUUA 3ZW1A 3F6ZB 3FA6A 1ZNEA 4FBOA 4FQBB 4BQUA 3NX1A 2WWPA 3BSZE 5BVTA 1FENA 5F7GA 3PECA 2LA7A 3OBLA 2LB6A 5FAZA 3RZYA 2JN3A 4IB9A 1JJJA 1GXAA 1ERBA 2CBRA 1EXSA 1ZNHA 1ICNA 2GTLO 1L6MA 1KT6A 4GRJA 4CV7A 2WSJA 1X8NA 2NP1A 3AKNA 2W2FA 4YDBA 1BRPA 4ZFXA 3B2JA 4ORWA 1O8VA 3PPTA 5IO5A 3PP6A 4ON1A 1SA8A 1LFOA 1VPRA 3PEDA 2W2BA 1QY0A 1B8EA 4I0UA 5LJKA 1KZXA 5IO7A 1HMSA 2KTSA 2HZRA 1FEMA 3TGBA 2LBAA 4HFOA 1DV9A 1IIUA 2G79A 4QGXA 3C78X 4YKOA 3VG6A 2R74A 4I9RA 2OFMX 3F9DA 3RWXA 3ZQ3A 3WJBA 1BBPA 4ORSA 3C76X 5AQ6A 3CMPA 3GE2A 4HPCA 4NNSA 1LPJA 2QOSC 1JIWI 1PMPA 1SXWA 2E4JA 2NNEA 3B2IA 4U9CA 4GK9A 3VE1A 1ACDA 1YP6A 1JV4A 1NP4A 4A8ZA 1VYFA 1X8QA 1TVQA 4YFRA 4ODDA 1KT4A 4OS0A 2DM5A 5FFHA 1EW3A 1LIDA 3EBWA 1RLBE 5EDCA 4ALBA 1YWBA 5H9KA 1KQXA 2ALLX 1UZ2X 3FELA 1DZMA 3JQOA 3ELZA 1MVGA 1JBHA 3APUA 2POAA 4O4XA 3UEXA 3MBTA 3D95A 2X8FA 3JSQA 3KFHA 1BWYA 3UAQA 4I3DA 2RD7C 4KCAA 4LZVA 4XMGA 2Q39A 1TOWA 1OPBA 1KGLA 4I3CA 1GKAA 4ZHCA 4TKHA 1TW4A 3VG7A 3EMMA 2ZAIA 5EEDA 2LBVA 4TNNA 2FS6A 4GNWA 1XCAA 2ACPX 2BT9A 2W2AA 3BLGA 3FR4A 1SY0A 1QABE 3FEKA 4OS8A 1XKIA 3ZWEA 4NYQA 1X8OA 1ZNDA 1ZNLA 2MWHA 1R0UA 5EZ2A 2QMIA 3JCFA 2KW1A 3NQ9A 3VE2A 4U3QA 1E5PA 1T0VA 1S44A 3QKGA 4EDEA 1LIBA 5BYPA 3P6HA 5HA1A 1GX9A 4D6AA 1MX7A 1GT4A 4I3BA 3TGCA 1S2PA 1RBPA 2Q2MA 4Y0QA 3KFFA 4YKMA 1X8PA 5HTEA 5L8OA 1TXLA 4YFQA 4ID2A 3TF6A 1O1VA 1SXYA 3KQ0A 2FR3A 4MVIA 3CQNA 5C0NA 3HWGA 4ZHGA 1GKAB 3BS2A 2LFOA 3S26A 1U18A 4FBVA 4KC8A 3FENA 4QGWA 3TGAA 2M4LA 1FELA 1NGLA 1YWCA 1DZKA 3EYCA 3D97A 2BS5A 2FRSA 2WEXA 4Y0SA 2AT5X 3RSWA 1G7NA 1AQBA 5HZ8A 3S5XA 1A3YA 3FA8A 5H9LA 1U0XA 2MHDA 4NYRA 4QQ1A 2QO5A 4O3XB 1AVGI 2GTLN 2N93A 3NVOA 4YCHA 1T68X 5HZ9A 2A2GA 3P24A 5BVQA 1CRBA 3VU1A 1YUPA 1OEEA 1D3SA 3OE3A 4GZVA 3NBXX 1S7DA 1P6PA 2RCQA 1HQPA 3JS1A 2FS7A 4FGIB 1I4UA 5EEEA 1Z24A 3D96A 3FA9A 4LKTA 1QY2A 4OS3A 4M7MA 2YG2A 1UREA 4TJZA 2L67A 4XMFA 5HBSA 2HNXA 3D4RA 1OEKA 2Q4NA 4YFPA 1DC9A 3IA8A 3N91A 4ES7A 1EPBA 1KQWA 3KFIA 1U17A 1X89A 4ORUA 4QNIA 3NQKA 1BSQA 2LKKA 2A2UA 1SY2A 5KICA 1TOUA 4QZTA 1NP1A 2CM9A 2FR2A 1LKEA 5L8IA 4YDAA 3P6DA 2JW1A 1OEJA 4L3RA 3FMZA 2KT4B 3BU9A 4LKPA 4ZCBA 1PM1X 4DQ3A 5FENA 3U9PC 1FE3A 1JYJA 1Y9TA 2FLJA 2FTBA 2OFRX 3OD9A 4I95A 4IB7A 1BM5A 3FIQA 2FWVA 3LV4A 4ZR2A 3HWDA 3FEPA 4QYPA 1SXUA 1DF3A 1JZUA 4IAXA 2GJ5A 3FW5A 3KFGA 4QZUA 3E3CA 3WOVA 3OJYC 2F09A 2WEWA 3PH5A 1EUOA 1GT5A 1SMPI 2GTFX 3ZUIA 5F6BA 2PY1A 3EBKA 3SAOA 1B0OA 5F1EA 5H8TA 1KZWA 1MX8A 1OBPA 3AKMA 4IMNA 3S5VA 3U03A 1G85A 3P6FA 2WQ9A 2XSTA 2O62A 4YCEA 4ZJ0A 4I6SA 3U0DA 3BX7A 2F73A 3BX8A 2A13A 2BBHA 3NP1A 1KOIA 2ASNX 4O49A 4EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWI A;  2IUB A;  3CK6 A;  2HN2 A;  2BBH A;  3NVO A;  2HN1 A;  5JTG A;  2BBJ A;  3JCF A;  3RKG A;  4EGW A;  4I0U A;  4EV6 A;  4EED A;  4EEB A; 
#chains in the Genus database with same CATH topology
 4MEE A;  4LF8 T;  4L5G A;  2X8S A;  1PEE A;  4YT0 A;  1SWK A;  1N34 T;  5HZ5 A;  3AE9 A;  2LEH A;  2DJF A;  4JI5 T;  3IA3 A;  4CDF A;  4O2A E;  1NBX A;  4GK0 E;  5JDQ A;  2P8G A;  5HXE A;  4AKL A;  3D9W A;  4EB6 E;  3WVM A;  4GIW A;  4JLE A;  4IMO A;  5HAX A;  2IFB A;  3ZZV A;  4H63 H;  5EK2 A;  1FTP A;  3AED A;  1E02 A;  2X9H A;  3AB3 B;  4EEB A;  2C5J A;  1HMR A;  1DZP A;  3UQ4 A;  4B55 A;  4TX5 A;  1AVD A;  3WJD A;  3HOL A;  1YWA A;  4EFG A;  4Z27 A;  4YLH A;  2OY1 O;  3P4Q A;  3ZT6 A;  3FBZ A;  1ERX A;  3FZH B;  5KHP A;  1MMG A;  2KIN B;  3VG5 A;  3STK A;  4NLI A;  4GKK T;  1HR0 T;  4ZHF A;  2RTR B;  5LB7 B;  1GGL A;  4ORY A;  4YMY A;  3WZQ A;  3WJG A;  2AKQ A;  4HWM A;  1ALB A;  4ZH6 A;  1B56 A;  2R73 A;  2WQA E;  3EM0 A;  2AT8 X;  3AEE A;  3C4W A;  1G73 A;  4HWI B;  5TAO A;  1B4M A;  1I04 A;  5F8P A;  3UTK A;  4IGU A;  4TKJ A;  5L3C B;  4PJM A;  1R8I A;  2CZT A;  1MK5 A;  3E0Z A;  3AA6 B;  5LJC A;  1ZKE A;  2J62 A;  4GOU A;  1OBU A;  2OVE A;  2CXD A;  2F4V T;  3P02 A;  1CJ5 A;  4DUY T;  4GYS A;  2MM3 A;  3JAD A;  3KV4 A;  2YIN A;  2VL0 A;  4B3R T;  2GC9 A;  4ZHD A;  2YU1 A;  1N9M A;  2XSA A;  3VGW A;  3MG5 A;  2WDQ A;  4COT A;  5KID A;  3P8C D;  2KWH A;  4PJL A;  3O1I A;  2BKP A;  3RF1 A;  4BX6 A;  3P6G A;  4EXZ A;  1Y55 X;  5FMN A;  3PUY F;  3LBX B;  2RTG B;  1KT3 A;  2KD2 A;  3L4R A;  3ELX A;  4YSZ A;  3VR9 A;  5JDM A;  4IB8 A;  4DUZ T;  4ORR A;  4U8U O;  3CQG B;  2A0A A;  2KND A;  3PQU A;  4E7S A;  2A72 A;  2HPL A;  4QYN A;  3TLV A;  3AEA A;  4MBQ A;  4O4U A;  4TN7 B;  5JVD E;  4UU3 A;  1A2D A;  2X56 A;  2OY7 A;  4IAB A;  2UZ2 A;  1G74 A;  1IFC A;  2RTP B;  3VG3 A;  2RCT A;  3BDR A;  4KII A;  3GWH A;  5HXH A;  4NPP A;  4AXP A;  2YMS A;  5H9N A;  2HN1 A;  2Y8D A;  1LIF A;  4O4S A;  2OF9 A;  3SRZ A;  1W09 A;  5DQW A;  5FP3 A;  5AQF B;  1MOY A;  5D8J A;  1U5P A;  2OV9 A;  4TV8 E;  3I9W A;  4DMV A;  3KBT A;  2AT0 X;  2UUC T;  1ZHC A;  3GMI A;  3ZW0 B;  3RYF E;  4JI8 T;  3NPO A;  3UEU A;  1E06 A;  5D45 A;  2HH7 A;  2IHR 1;  3RI5 A;  5HZ6 A;  1SY1 A;  1FMV A;  1LVF A;  2YDQ A;  1UUR A;  5AQO B;  4AQF A;  4DO0 A;  4O4J E;  4PNI A;  4IHJ E;  1HBQ A;  2BS6 A;  3I0A A;  3APW A;  5FXW A;  2X9W A;  4Z8X A;  2PBI A;  3RGL A;  1Y9L A;  3HWE A;  5AQH B;  4L1N A;  2VB6 A;  4FBR A;  2K62 A;  2OVD A;  2ZM6 T;  2D2S A;  1VWQ B;  2QCB A;  1KNP A;  2JQQ A;  1HX1 B;  2JU8 A;  2L9C A;  3VHH A;  3FXE B;  5L2L A;  5DPQ A;  2PJQ A;  4F8H A;  2V1D B;  3V5U A;  5LXT E;  4KHP T;  1YP7 A;  2Q9S A;  3LK4 2;  2VFC A;  5FNV E;  5B27 A;  3CPZ A;  4RUN A;  2X67 A;  1OSP O;  4H9N C;  2D5U A;  3ZJ2 A;  3WZP A;  2X8T A;  2FHL A;  2KLQ A;  1MUP A;  2W67 A;  3NWI A;  2RTC B;  3DTQ A;  4BGF A;  3LBX A;  4XBF B;  5KDM C;  2HHH T;  3N9O A;  2A5B A;  2KWI B;  2LHN A;  5AQR B;  1IW2 A;  5D47 A;  4A1Y A;  5F58 A;  3ZEF B;  3AEH A;  1YIV A;  2QO6 A;  1N32 T;  3G7X A;  4TV9 E;  3ZMS B;  5H6R B;  2RTH B;  4DBQ A;  4YVB A;  3CKG A;  2N9D A;  4GKC A;  5ABH A;  3VG2 A;  3AAA B;  2WR6 A;  4XZC A;  3CKF A;  1E2T A;  1VWJ B;  5B5F A;  1E7P A;  3HKB E;  3T1H T;  4UVC B;  4FBO A;  4BQU A;  3ANW A;  5F7G A;  3PEC A;  1STR B;  3RZY A;  4IB9 A;  1GXA A;  1WUB A;  3ZN1 B;  1EXS A;  1U4Q A;  4TUY E;  1ICN A;  4UV9 B;  2WSJ A;  1SA0 E;  3PUS A;  2XJ7 A;  3EDV A;  5AQQ B;  4ORW A;  3NRX A;  3PPT A;  5IO5 A;  5ABE A;  1LFO A;  3FZK B;  3PED A;  2W2B A;  1S35 A;  1QY0 A;  4IRE A;  4AI6 A;  3K8P C;  2EHO A;  3CQX C;  1HCI A;  4GUZ A;  4IDO A;  5LJN A;  4N78 D;  1IIU A;  4X1I E;  3EW1 A;  4QGX A;  3C78 X;  3RC8 A;  2LSK A;  3WJB A;  3W15 B;  3C76 X;  3CMP A;  4NNS A;  1LPJ A;  4BJM A;  4A98 A;  1PMP A;  3VE1 A;  4HFD A;  1ACD A;  1JV4 A;  4A8Z A;  2JJ9 A;  4IE0 A;  3P4R A;  1TVQ A;  2GK9 A;  5EDC A;  2IZB A;  1KQX A;  2ALL X;  1SWJ A;  3JAE A;  3MZK B;  3CQC B;  2YDR A;  3I0O A;  3JQO A;  3ELZ A;  2POA A;  2H7V C;  3UEX A;  3LK2 B;  2X8F A;  4DV5 T;  1IJ6 A;  5E0O A;  4KCA A;  3RRW A;  4X62 T;  3UUM A;  1TOW A;  2CXL A;  3ZSS A;  5LNK A;  2G5L A;  2WU2 A;  3EAB A;  5EK3 A;  5HXS A;  1TW4 A;  3K3O A;  5EED A;  3J7Y q;  1PTS A;  1J5E T;  3BLG A;  2RTD B;  2X4M A;  4KP3 C;  4NYQ A;  4NV7 A;  2NW8 A;  4UXN B;  1ZND A;  3GA8 A;  1R0U A;  3JCF A;  4U3C A;  3NQ9 A;  4JO6 A;  3I9Y A;  4QH1 A;  3P6H A;  5HA1 A;  2DCF A;  1CUN A;  1MX7 A;  4OHF A;  4TZ4 C;  4Y0Q A;  5IRU A;  4DNE A;  3UU6 A;  3IBP A;  4YKM A;  5HTE A;  1TXL A;  1O1V A;  1SXY A;  4PFO A;  4MVI A;  1V9D A;  3U78 A;  4EZH A;  2NTY A;  3S26 A;  2MOZ A;  1OED C;  4QGW A;  1FEL A;  1NGL A;  1YWC A;  1DZK A;  3EYC A;  2KXP B;  3C98 B;  5F2B A;  3ZYK A;  3UU4 A;  2FRS A;  2V7K A;  2WEX A;  3AEG A;  4BCS A;  3RSW A;  1K3B A;  5BR8 T;  1VWP B;  2PTF A;  3B5M A;  1T68 X;  5HZ9 A;  3PU8 A;  2CWO A;  3VU1 A;  5LCY A;  1SHZ C;  3Q2M A;  1D3S A;  1OEE A;  3UU8 A;  3NBX X;  1P6P A;  4I4T E;  2XQA A;  5LYJ E;  4FGI B;  3SZI A;  1Z24 A;  2VFB A;  2E2A A;  4QXC B;  4GK5 E;  4OS3 A;  1VCT A;  4CDD A;  4M7M A;  2KZ7 B;  3NZQ A;  2OFA A;  4IDQ A;  1EPB A;  4PK5 A;  4ORU A;  4QNI A;  2E5V A;  4GYR A;  3ZJ1 A;  4GDA A;  5M4Y A;  2CM9 A;  3P6D A;  2VKH A;  2XQ7 A;  4AQY T;  4DMW A;  3FMZ A;  3SFE A;  2C5K T;  1FE3 A;  5FXV A;  2FLJ A;  4PAG A;  2OFR X;  2BG9 C;  1GQE A;  3GN5 B;  4C90 A;  5KXJ A;  3VKG A;  3JAF A;  3FEP A;  3R6N A;  3N2G E;  2W4X A;  5L3F B;  3E3C A;  1W0B A;  2WEW A;  3PH5 A;  1SMP I;  2GTF X;  2F01 A;  2V6Y B;  3AEB A;  3ZMU B;  5AQM B;  4HWH A;  3H37 A;  4IMN A;  3S5V A;  1D1A A;  2J47 A;  4F6R C;  5JR9 A;  2WBL A;  3NP1 A;  4CPI A;  2IZD B;  2ZM0 A;  2ASN X;  5L3B B;  2LM2 A;  1UYO X;  3UUL A;  5JDG A;  2BS4 A;  1HBP A;  3NR3 A;  2A5C A;  2IDO B;  3B57 A;  5F5W A;  2CE7 A;  4EXT A;  5LHH B;  4TLJ A;  1MNE A;  5CYB A;  1A18 A;  1UX4 A;  3RDU A;  4P1N A;  4ARH A;  1XDO A;  3H3I A;  3F31 A;  2AH7 X;  4ASK A;  4HFC A;  2Z4I A;  1SY3 A;  4XME A;  2RN4 A;  2CM4 A;  1JYD A;  5HWY A;  2QRX A;  3N2K E;  2XAJ B;  2IZK A;  2V7J A;  4ZI7 E;  4BOE A;  2D9D A;  4JV5 T;  2RPA A;  3OKQ A;  5B5G A;  2Y48 B;  2L9Q A;  4P0B A;  3TLW A;  5LJH A;  1IBL T;  1D2U A;  1QFT A;  3WAK A;  3B2L A;  2H89 A;  1T8V A;  3ZMV B;  4OMX A;  2BBJ A;  1HMT A;  1YXR A;  3KFW X;  4M1P A;  5AEO A;  1NWM X;  3SLJ A;  2XAH B;  4WFV A;  3WAJ A;  1EII A;  3STM X;  2ES0 A;  3ZMT B;  4NP1 A;  3FW4 A;  4ZGF A;  1M62 A;  4HN9 A;  5AQV B;  4DR5 T;  3T2W A;  1IZN B;  3ZW2 A;  4LMK A;  1LEL A;  3AE8 A;  2MPK A;  3RBY A;  3QOF A;  3P50 A;  2JGS A;  2E8I A;  3A5X A;  2XAS B;  2IML A;  4X65 T;  4EEJ A;  2BKN A;  4YSX A;  2DI4 A;  1WRD A;  5HWZ A;  3ZN0 B;  4TKB A;  3Q5X A;  4O3Z A;  3KZA A;  2VVS A;  2HYS A;  3AE7 A;  2CMR A;  4O9S A;  3KIN B;  5AQP B;  2V6Y A;  5KX5 E;  3X00 A;  1NQN A;  3LFM A;  3ZI8 A;  4ZI3 C;  4LF9 T;  4A1H A;  3AXJ B;  1SRH A;  2V7I A;  4YH0 A;  3OYX A;  2RTA A;  2WP9 A;  3L09 A;  1Z8U A;  3RLF F;  3I1A A;  2Z4H A;  3L39 A;  4KMC A;  1DFV A;  3WBG A;  2FJD A;  1QQS A;  1CBS A;  2EHO D;  2BVL A;  3HOE A;  3HKC E;  1XNR T;  1MDC A;  1BEB A;  3QNU A;  2JQ9 A;  4YGG A;  1BR0 A;  5HZQ A;  3NZP A;  4PK4 A;  5K68 A;  3FR5 A;  2LJL A;  3ETV A;  4EV6 A;  1VWG B;  4AYH A;  2AT6 X;  4H9R C;  1SE7 A;  3MVF A;  4LQZ A;  4BX6 B;  3G06 A;  1MIV A;  1SWL A;  4HPD A;  3ZW1 B;  1HXL A;  4XMC A;  2AT3 X;  4DV3 T;  3ZYM A;  1LCW A;  3RY2 A;  4FJO A;  2IZJ A;  3FZL B;  3RYI E;  5AQI B;  1IBM T;  3E08 A;  3WJC A;  2LM9 A;  3CX8 B;  4CN1 A;  2XAG B;  4I60 A;  2XQ3 A;  5J2U E;  2YN6 A;  2WWV A;  2RTO B;  3GAQ A;  4ALO A;  4LF4 T;  4YHJ A;  4HTE A;  5L4H A;  5JRE A;  4ORX A;  2GTL M;  1RSU B;  4INN A;  4Y59 A;  5ABF A;  3Q6L A;  5B3M O;  2LRK A;  1IFB A;  3D0T A;  1J1J A;  3CBC A;  1DZJ A;  1IKE A;  5FY7 A;  3RDM A;  5AJB A;  1VWE B;  2W62 A;  5LG3 A;  4K0U A;  1QY1 A;  3C77 X;  4BVM A;  3AE2 A;  3UU5 A;  2CZU A;  4GNY A;  2CCQ A;  1LCZ A;  4O3W A;  3MJX A;  4JGL A;  1GT1 A;  1VWH B;  1G5W A;  5HA0 A;  5C8Y E;  4AZO A;  2OVA A;  1G8X A;  2Q2P A;  2WMO A;  2QVA A;  2WCA A;  1ML7 A;  2OZQ A;  2IZL B;  4AW8 A;  4YGH A;  4MVE A;  4EYY R;  4ILC A;  4CK4 A;  2JQH A;  3A7M A;  3AXJ A;  4ILB A;  1KT7 A;  5AQU B;  4IDZ A;  2V5D A;  1IBK T;  5IWA T;  4QRL A;  3VHM A;  4CN4 A;  2JRK A;  3P4W A;  3EUH A;  2Q9Q D;  2IZE B;  4WBN E;  5LJG A;  2FGS A;  4N7C A;  4Y0P A;  3EAM A;  4R0B A;  4O3Y A;  5H9A A;  3PUA A;  4PJ2 A;  3CK6 A;  4BAY B;  2XY8 B;  2PFV A;  4KT5 A;  1NAF A;  2DHR A;  4MVK A;  3KDS E;  1N33 T;  5CSE A;  1N36 T;  4GGR A;  3LJC A;  2ACO A;  2CEA A;  2AMM X;  2YU2 A;  4JBW F;  2IUB A;  2ZAG A;  5LGU B;  2XTL A;  3ZW1 A;  3F6Z B;  3FA6 A;  4FQB B;  1NQM A;  3NX1 A;  1KEY A;  2JMH A;  2V26 A;  1UYN X;  2LA7 A;  4O4H E;  3OBL A;  5EK4 A;  5FL0 A;  2LB6 A;  2JN3 A;  4H63 V;  2H88 A;  3FZF B;  2CBR A;  2XQ5 A;  2E9X D;  3ONJ A;  4GRJ A;  3RE5 A;  5AQS B;  1AJ3 A;  3AKN A;  2W2F A;  3OYZ A;  4ZFX A;  5J2T E;  2IIU A;  3PP6 A;  2XAQ B;  2KT9 A;  1SA8 A;  4ON1 A;  3RY1 A;  4I55 E;  1N43 A;  5LJK A;  4DVD A;  3O9X A;  2H3R A;  5IO7 A;  2QA7 A;  1KZX A;  2I5Z O;  5FY0 A;  2KTS A;  1LCV A;  4ERR A;  2HZR A;  2LBA A;  4HFO A;  3BQL A;  3OBV E;  5KMG P;  5L3Y A;  4X1K E;  4I9R A;  3AVS A;  2LLY A;  4MHC A;  3KV6 A;  4IT4 A;  5AQ6 A;  1W0A A;  4U31 A;  3AE1 A;  2X34 A;  3ANW B;  3RIU C;  2NNE A;  3B2I A;  3LG7 A;  4PK6 A;  3EC5 A;  2RTI B;  1YP6 A;  4AKI A;  2LE8 A;  3AE3 A;  1VYF A;  4YTN A;  1X8Q A;  4IE5 A;  4A97 A;  4ODD A;  1KT4 A;  2DM5 A;  2DLR A;  1EW3 A;  1LID A;  3RYH E;  1SRJ A;  4ALB A;  4UV8 B;  4U7Y A;  4OK0 A;  1DZM A;  1QLB A;  2BG9 E;  4O4X A;  3ZT7 A;  1JBH A;  2RTN B;  2EHO B;  1MIW A;  1SWS A;  3RDO A;  2YEV C;  3ETU A;  5CHK A;  2NW9 A;  5CJ5 A;  4HWF A;  2OL6 O;  3SS1 A;  5LG4 A;  3FZM B;  2ZAI A;  2LBV A;  4TNN A;  2FS6 A;  4OEL A;  2N1G A;  2LKH A;  2HPJ A;  4YJ2 E;  2ACP X;  4NXN T;  3FR4 A;  1MMN A;  1XKI A;  4MAL A;  3ZWE A;  2BVM A;  4IIJ E;  2MWH A;  2UYW A;  4V1A v;  2XPK A;  3JC6 C;  5IYZ E;  2FJB A;  3VE2 A;  5JDN A;  3TKL B;  1S44 A;  4EDE A;  5BYP A;  5HWX A;  4D6A A;  4CQI A;  1GT4 A;  2DJG A;  4I3B A;  2CPT A;  3TGC A;  1RXJ A;  1SWD A;  2C1S A;  2NWB A;  3C4Z A;  1X8P A;  4HKA A;  5L8O A;  3FHN A;  2CLY B;  3N9M A;  3KQ0 A;  3CQN A;  5FY1 A;  3L8R A;  5HEO A;  4X66 T;  2VQF T;  3CWZ B;  4UF0 B;  4YTM A;  1HFA A;  4ZHG A;  4X64 T;  1FIO A;  3BS2 A;  2LFO A;  5HCJ A;  3HPE A;  1U18 A;  5FYM A;  2RTJ A;  3FEN A;  3VRB A;  2BDE A;  2M4L A;  4BJN A;  3ZST A;  1Y52 X;  1YQ3 A;  3D97 A;  3PUG A;  2B76 A;  4P0A A;  5JDL A;  2NW7 A;  2JMK A;  4U2Z A;  1G7N A;  2CRB A;  4G2A A;  3TLU A;  3S5X A;  1A3Y A;  5H9L A;  2MHD A;  4NYR A;  4O3X B;  2GTL N;  2N93 A;  3NVO A;  4L9I A;  2A2G A;  3HKD E;  3P24 A;  2WWU A;  5BVQ A;  2VDF A;  2CBI A;  2IZF B;  1JMX A;  1HG2 A;  4GZV A;  4NUU A;  1D1B A;  5EEE A;  5L3D B;  3FA9 A;  2B1E A;  4Z2P A;  5L4E A;  3IEE A;  2YKS A;  3T6L A;  1T7S A;  3FXD B;  1X9B A;  3SWH A;  2YG2 A;  3C64 A;  1YW0 A;  2L67 A;  5FXX A;  1RXH A;  5HBS A;  3D4R A;  2CM0 A;  1SWC A;  2LSJ A;  2Q4N A;  1DC9 A;  1N4J A;  1SWU A;  3IA8 A;  4YFP A;  4UVA B;  1U17 A;  2VKD A;  2WZI A;  4G63 A;  1BSQ A;  3PUZ F;  3RYC E;  2XQ6 A;  2D0U A;  5KIC A;  1TOU A;  3Q5D A;  2FR2 A;  4ZI3 D;  4ZI2 D;  2Q9Q B;  2JW1 A;  3ESL A;  5DQV A;  2OF8 A;  3T8O A;  4L3R A;  3DP7 A;  3S4U A;  1PM1 X;  3U9P C;  3RQU A;  4H9O C;  4YTP A;  2FTB A;  1BM5 A;  3OD9 A;  3VHI A;  5B2A O;  3FIQ A;  1LVK A;  2FWV A;  3LV4 A;  2X0Y A;  3HWD A;  1WCR A;  5LHG B;  1SXU A;  2OY5 O;  1JZU A;  4O2B E;  2GJ5 A;  3FW5 A;  2QOM A;  3N9L A;  3WOV A;  4ADZ A;  1T72 A;  2FJE A;  4NUV A;  2C0S A;  2OFB A;  1GT5 A;  1JMZ A;  5LP6 E;  4GGZ A;  3MKD A;  1ZEE A;  2PY1 A;  5K67 A;  3EBK A;  1B0O A;  4E7Z A;  2BKO A;  3I0Q A;  1MX8 A;  5DAB A;  1QSD A;  2K5B B;  1SWO A;  2WQ9 A;  2E9X B;  4YCE A;  1BR2 A;  4MFR A;  2WY2 A;  3VHL A;  2F73 A;  3BX8 A;  3BX7 A;  4I6S A;  1KOI A;  1SWF A;  2C1Q A;  4HGA A;  2HKD A;  3PJA J;  4X1Y E;  4UF0 A;  1QG5 A;  4FI5 A;  2CBS A;  5LKE A;  1XMO T;  2UXC T;  4LZU A;  2VWA A;  4Z90 A;  4IBA A;  4GKJ T;  4QAE A;  4U72 A;  2ODU A;  3NX2 A;  3Q5W A;  4CI1 B;  2QGS A;  4PW8 A;  4IAW A;  2OVS A;  3IF8 B;  5LGT B;  1HN2 A;  3CX6 B;  3O4X E;  4JI3 T;  3P6C A;  3RC3 A;  5CA1 E;  1FMW A;  1D0Z A;  4X5T A;  1NEN A;  3AAE B;  3SOT A;  4HFE A;  3TLS A;  1ICM A;  2ANS A;  3FBL A;  5A1L A;  1VWC B;  2G8C O;  5JR9 B;  1SLF B;  5GON E;  1QWD A;  3N9Q A;  3X1D A;  2DWK A;  4KX6 A;  2FJA A;  4KH8 A;  3KVA A;  1D1C A;  4TQ2 A;  3O2Y A;  2VUR A;  2XHE B;  1YQ4 A;  4Y0R A;  5L3E B;  1BRQ A;  2BLG A;  1SWT A;  1LIC A;  5F3J A;  1ZOY A;  2XKL A;  2Q9Q A;  3PJA A;  1SWG A;  5D4A A;  5HTD A;  1ADL A;  5F6Z A;  1SWH A;  2HLV A;  3KVB A;  2CAM A;  3FID A;  3T2X A;  3O1H A;  2KTD A;  5AQL B;  1Y01 A;  1CHU A;  1DU2 A;  3HL6 A;  3PUX F;  2OL7 A;  4JNJ A;  3ZMZ B;  1MMD A;  4YBP A;  2D0T A;  4HEA A;  1N0S A;  1BSO A;  2V6X A;  2CA5 A;  2X45 A;  2MTQ A;  2JOZ A;  3TZS A;  4NLJ A;  1EI5 A;  3WJF A;  2WB5 A;  4CZZ B;  5HCM A;  3HWF A;  1AB0 A;  2LKG A;  4A60 A;  2E9X A;  4QX7 B;  5L3G B;  5HAE A;  2G0U A;  2FT9 A;  5LA6 E;  2IW5 B;  4NW4 A;  1H91 A;  3FLL A;  2W00 A;  1T98 A;  2L3L A;  1OPA A;  3FA7 A;  1LF7 A;  4WBK A;  2VL8 A;  4ZEY A;  1SWN A;  3UEV A;  4LF6 T;  4HPA A;  3WI3 A;  1NEK A;  4OYK A;  5K06 A;  1GT3 A;  5HCD C;  5AJC A;  3J9X 1;  3CQR A;  4BX5 A;  2X9Y A;  2RA6 A;  1HXZ A;  3VG4 A;  2BG9 A;  4CPE A;  3MK7 C;  4MVL A;  2A3F X;  3BU1 A;  3ZKR A;  5J1G A;  1HNW T;  2QO4 A;  1JNR A;  1LNM A;  4H9Q C;  3K3N A;  2W0G A;  2VVN A;  3V8U A;  2BHV A;  4HFB A;  1ZNG A;  2MJI A;  2X0L B;  3FR2 A;  4IE4 A;  2XQ9 A;  3AEF A;  5HEU A;  3F57 A;  2W2U A;  1KXO A;  1AVE A;  2PI3 O;  4WHI A;  5FVL A;  1BLR A;  3UUB A;  3AE5 A;  1VCS A;  4LFC T;  4AIU A;  4U74 A;  4D6B A;  2E5L T;  4UVB B;  1B7T A;  3ZUO A;  5FQ7 E;  2RTB B;  1WR6 A;  3SFD A;  4QH5 A;  5JRC A;  2WAU A;  3NQ3 A;  5FL1 A;  3M65 A;  1HQQ A;  2ZMA A;  3CML A;  3P6E A;  4CXW A;  5AQJ B;  3CBS A;  2G7B A;  1SWA A;  3WXQ A;  3BRN A;  3ZCI A;  4COF A;  2X32 A;  4CXY A;  4OFZ A;  2MF6 A;  5LJM A;  1SXX A;  4WFU A;  2V7L A;  4ZGU A;  4YBU A;  1JJU A;  4AZN A;  5HEG A;  3PV0 F;  4M6S A;  5L8N A;  3EI0 A;  5HXC A;  2NND A;  4ZZC A;  3PDF A;  2K3W A;  4AZQ A;  1EAL A;  4IRW A;  2OY8 A;  5HCC C;  3ZLI A;  1E2A A;  2IAK A;  2MBG A;  4DR2 T;  2WUT A;  3O19 A;  1XNQ T;  2VK9 A;  2J1D G;  1IAP A;  5ABF B;  4UR9 A;  1STP A;  2VKJ A;  2WDR A;  3O22 A;  4AKH A;  3MAC A;  3Q9D A;  1YWD A;  3PH6 A;  4O4O A;  1GX3 A;  5HCE C;  5ABG A;  3EW2 A;  2OA5 A;  3UU3 A;  1VWK B;  4NV8 A;  1HF8 A;  3B2K A;  3PK2 A;  4AZM A;  3FYF A;  3HTY A;  3AE4 A;  3KBU A;  4BJ8 A;  1Y53 X;  4ZH9 A;  4DV7 T;  3I17 A;  1EPA A;  4Z2V A;  1BR1 A;  3T1D A;  2WSS V;  1VWN B;  4U33 A;  2C4I A;  3K3L A;  1E1H B;  2XAF B;  3AA1 B;  3LHN A;  1CBR A;  1VWL B;  2XZE A;  1XDP A;  1ZNK A;  2Y6X A;  2RTM A;  2BZB A;  1AEL A;  3M3Z B;  3LDQ B;  4DR7 T;  1GX8 A;  3UEW A;  5DG4 A;  3UQ7 A;  4IE7 A;  1ZNE A;  2A8G A;  2WWP A;  3BSZ E;  4WYV A;  3IHR A;  1FEN A;  5BVT A;  2WQY A;  4HWC A;  1JJJ A;  4Z6J A;  2ACX A;  1W9R A;  2GTL O;  3VU7 H;  1VWI B;  2RTQ B;  3SOL A;  3B2J A;  4EZ4 A;  2XQ8 A;  2V7M A;  1VPR A;  3TLT A;  2LSI A;  4Z2O A;  4JHQ A;  4I0U A;  1I78 A;  1HMS A;  2FBW A;  4BA9 A;  1J5W A;  3AA7 B;  1FEM A;  3TGB A;  1I6Z A;  1DV9 A;  2YOE A;  3ONX A;  2G79 A;  5C2T A;  4YKO A;  3VG6 A;  2R74 A;  2IZI A;  3ZQ3 A;  2IZC B;  1BBP A;  4DV1 T;  2XM2 A;  4ORS A;  4DR4 T;  4A56 A;  3GE2 A;  4CN6 A;  3RX6 A;  2I5V O;  1SXW A;  4U9C A;  3LK3 B;  2WM9 A;  2XQ4 A;  2KMF A;  4LMJ A;  1NP4 A;  3AVR A;  4YFR A;  4OS0 A;  4OKA A;  2I6H A;  4KUM B;  1ZV4 X;  1YWB A;  1KK7 A;  2K9A A;  2BSZ A;  1SLE B;  3FEL A;  2A2F X;  4ZS3 A;  1MVG A;  3T1Y T;  3R84 B;  4CDC A;  4K0K T;  3D95 A;  3MBT A;  3JSQ A;  1BWY A;  4PJN A;  4I3D A;  2RD7 C;  2XSB A;  3KVN A;  3UAQ A;  4LZV A;  2Q39 A;  1SWQ A;  4LML A;  4I3C A;  1GKA A;  4TKH A;  3VG7 A;  3EMM A;  5AQT B;  1N9Y A;  1XCA A;  2W2A A;  1QAB E;  2CXF A;  1OXZ A;  4OS8 A;  4U46 A;  3RDQ A;  1LDO A;  5ETW A;  2QMI A;  4EAH A;  1UX5 A;  1T0V A;  3QKG A;  3PDY A;  3VKH A;  4DCB A;  2OYB O;  1S2P A;  1RBP A;  2Q2M A;  2X9X A;  1VYO A;  4YFQ A;  4ILA A;  3OJA A;  3TF6 A;  4JI7 T;  4I50 E;  3RQW A;  5C0N A;  3HWG A;  1FJG T;  4EKV A;  2PG8 A;  4LFB T;  1KNZ A;  4FBV A;  4EOZ B;  3UFE A;  2WU5 A;  3FDC A;  3Q34 A;  1KL4 A;  2BS5 A;  3T6F A;  4U2Y A;  1AQB A;  5HZ8 A;  2RTE B;  4U7I A;  1AVG I;  4I43 B;  1W6F A;  1BR4 A;  3ZT5 A;  5LMU T;  4YCH A;  5FXZ A;  3CX7 B;  4HWD A;  5LHI B;  1UUS A;  3JS1 A;  2FS7 A;  1I4U A;  4CXX A;  3D96 A;  1OED E;  2W66 A;  5CGM A;  1JQP A;  2Y32 A;  4H9P C;  4TJZ A;  4XMF A;  1KFY A;  2VKO A;  2UU9 T;  3H3A A;  4LFA T;  2CBJ A;  1OEK A;  1VWD B;  4ES7 A;  2P9B A;  4WZX A;  5LMN T;  4JI4 T;  3KFI A;  1X89 A;  1SY2 A;  3QB5 A;  4YSY A;  2K48 A;  4QZT A;  1NP1 A;  2WZH A;  1SRE A;  1HX8 A;  2IC9 A;  4JUY A;  1WBI A;  4CPH A;  4IL9 A;  3ZC0 A;  5FKY A;  4GGT A;  3N9P A;  2YDS A;  2RTL A;  4LKP A;  4ZCB A;  4DQ3 A;  4IST A;  5FEN A;  4QX8 B;  1JYJ A;  1Y9T A;  5JDF A;  5ADX L;  4ZR2 A;  5JH7 E;  1DF3 A;  2DL1 A;  3KFG A;  2JQK A;  4CDE A;  4DID B;  2FKG A;  2H7O A;  2F09 A;  4ZS2 A;  1WYB A;  1KL5 A;  1EUO A;  3NKZ A;  3CVR A;  4ZZB A;  5F6B A;  3ZUI A;  3K1S A;  1SWP A;  3RKO A;  1KZW A;  5H8T A;  3AKM A;  1VRB A;  3U03 A;  2I0M A;  1G85 A;  3P6F A;  1VWR B;  3RIU A;  2XST A;  2O62 A;  3PUQ A;  5AQG B;  1OWA A;  2RTK A;  2FUP A;  4TWF A;  4O49 A;  4EGW A;  2NR4 A;  4AKG A;  4JI1 T;  2UXX B;  5D48 A;  4UIG A;  4AQF C;  3FB2 A;  1CBI A;  2Y3E A;  5HEJ A;  4A5X A;  4U8U M;  4DQ4 A;  1EIO A;  4DBR A;  2R6G F;  3C51 A;  4AKR B;  1JNZ A;  1SRI A;  4QXH B;  4ZOL E;  1EQD A;  5EZY E;  2RQ0 A;  2UUA T;  2A3D A;  4LF7 T;  1LRZ A;  1BSY A;  1L0V A;  1K24 A;  4EED A;  5LKF A;  3A8Y C;  2WMN A;  3CIR A;  4EYU A;  1MND A;  3K3Q C;  1YD8 G;  3RIF A;  5LGN B;  5LBQ B;  5LOV E;  3NAD A;  3KV5 A;  1VWM B;  5C3J A;  1YKH B;  3DTO A;  2LT3 A;  4IDP A;  3PQS A;  4JI6 T;  1M7K A;  4PJJ A;  3B13 A;  3RKG A;  4AZR A;  4CI3 B;  3HI2 A;  3MXZ A;  3PU3 A;  1QFV A;  4HPB A;  4DND A;  4CSB A;  2G78 A;  4GJV A;  4Q25 A;  4OX9 T;  2JPF A;  2VAS A;  5JD2 A;  1WFD A;  1VWA B;  2LRL A;  2R56 A;  2XUE A;  3E22 E;  1GM6 A;  4TNV A;  2AL0 X;  2NNQ A;  2CWY A;  1ZRY A;  4ZXL A;  2QM9 A;  3CR6 A;  4I9S A;  2UUB T;  2LSY A;  3QC9 A;  4KHZ F;  4QXB B;  4GD9 A;  1HNX T;  4HE8 A;  2UXD T;  4OMW A;  3BY0 A;  4GDZ A;  4NNT A;  3RRC A;  3F8A A;  2N2N A;  2LSG A;  1US7 B;  2HMB A;  2M6I A;  4N7D A;  1RST B;  5EPQ A;  3CKD A;  1A57 A;  5AQK B;  1IKJ A;  2RTF B;  4IDN A;  1SUM B;  5J0Z A;  1X8U A;  1OED B;  3BQI A;  2BC3 A;  1WLX A;  1QUU A;  5B10 O;  3VPJ E;  3EHZ A;  1SWE A;  1PBY A;  3ZPO A;  3QB5 K;  4X20 E;  5EDB A;  1I06 A;  3WZO A;  1T8B A;  1HG5 A;  3EVY A;  1E00 A;  5FQ6 E;  5FQ8 E;  4UU2 A;  4K19 A;  2EHO C;  5CE4 A;  5CB4 E;  3V5S A;  4J2C A;  3ZW0 A;  1VWF B;  4PSQ A;  3AA0 B;  2FHN X;  1SWB A;  1XWM A;  2X68 A;  3RIA A;  4O4I E;  3HR0 A;  3C50 A;  2IC6 A;  5AQN B;  4AZP A;  2AF5 A;  4YGZ A;  4YFS A;  2JMB A;  4WW0 A;  2UXB T;  2BS3 A;  2GH7 A;  3STN A;  2J4G A;  4AIS A;  1MIY A;  4ISS A;  2L68 A;  1UGO A;  1KT5 A;  4HFV A;  3IFB A;  3PUW F;  3MM0 A;  2EU7 X;  1HNZ T;  1BJ7 A;  3SLO A;  4O4L E;  2CLY C;  4ML7 B;  3L3P A;  4XMH A;  2LOP A;  2IZH B;  4H9S E;  1SWR A;  1W4T A;  2CHN A;  4JYA T;  1PBO A;  3PUV F;  3PE0 A;  2HZQ A;  2MAW A;  3H3M A;  4BX5 B;  3PUR A;  2JU3 A;  2BG9 B;  4B3T T;  4ILU A;  1VOM A;  4Y5D A;  4EQA C;  5JR8 A;  1OBQ A;  4EIW A;  3UUN A;  4KC7 A;  3DSZ A;  3HKE E;  5LJD A;  3O1J A;  1X79 A;  2NP9 A;  1X71 A;  2HN2 A;  1I05 A;  2X0H A;  4YJ3 E;  2RA1 A;  2JU7 A;  3VR8 A;  3QQ2 A;  1O1U A;  4MIS A;  4ZHH A;  5LJB A;  1WYC A;  4MIR A;  3F2E A;  2ZM2 A;  5JTG A;  3Q5E A;  3RH3 A;  1LUQ A;  1MEP A;  5BVS A;  3UT5 E;  1JJX A;  3S60 A;  4JEH B;  1LDQ A;  5B29 A;  4QWN B;  2M67 A;  2LHR A;  2NOX A;  3ZYL A;  5JRC B;  2L5P A;  1YKE B;  5LBM A;  2MO5 A;  2KSR A;  3WJE A;  1S94 A;  4AQG A;  1SLG B;  4GU8 A;  1IJ8 A;  1OED A;  5HXR A;  3RPU A;  3AAI A;  2X46 A;  3QUJ A;  3OPC A;  3B2H A;  3DJB A;  3HK1 A;  1LIE A;  1I9H A;  2K23 A;  3BQK A;  2Q9Q C;  3N5L A;  4U8U N;  4DV0 T;  5IRW A;  4OEM A;  1VYG A;  4GET A;  4IB6 A;  5IO6 A;  2CHO A;  4GE1 A;  4C91 A;  4Z28 A;  4PFP A;  3MX7 A;  2V5C A;  2AE9 A;  5IRA A;  3CWK A;  1FDQ A;  2I59 A;  3ZCJ A;  2QYW A;  4B3M T;  3EDU A;  4XMD A;  5LJE A;  3APV A;  2RP4 A;  4GH7 A;  2XM1 A;  3APX A;  4TNW A;  1CBQ A;  3AEC A;  4QGV A;  4RUU A;  2VQE T;  4Z91 A;  3ABV A;  2L8K A;  3U3I A;  2WPU A;  1HS7 A;  2OLT A;  2E9X C;  1HY2 A;  4XAX B;  1Y64 B;  5FAZ A;  4LF5 T;  2ZSC A;  1ERB A;  1ZNH A;  1UCU A;  1L6M A;  1KT6 A;  4CV7 A;  2A9U A;  1X8N A;  3C4X A;  1NC9 A;  2NP1 A;  3WYP A;  3WYQ A;  4YDB A;  1BRP A;  4BX7 B;  1O8V A;  3LTW A;  3QK6 A;  5CA0 E;  5BMV E;  3ZC1 A;  4ZHQ E;  1B8E A;  4YXD A;  3P7I A;  3P4S A;  1RXK A;  1KF6 A;  3UUX B;  5IHY A;  3NRY A;  3SLT A;  2OFM X;  3F9D A;  3RWX A;  1IJ5 A;  1ZP0 A;  1H7C A;  5JQG E;  3AE6 A;  4HPC A;  2Y3F A;  4B3S T;  2K24 A;  2QOS C;  1JIW I;  2E4J A;  2SPC A;  2Z6E A;  4GK9 A;  2LOS A;  5JR9 C;  3VRA A;  5DJQ C;  4KBM B;  2X66 A;  5FFH A;  4C5P A;  3EBW A;  5L47 A;  1RLB E;  5IXG A;  5H9K A;  1VWB B;  1Z0P A;  1N7Y A;  1UZ2 X;  4ANJ A;  1SRF A;  2AVI A;  4DV6 T;  3APU A;  5HEH A;  3KFH A;  1RAV A;  4WBO A;  4XMG A;  2NTX A;  1OPB A;  1KGL A;  4ZHC A;  2ZLY A;  1O3X A;  4BBO A;  2M6B A;  3N9N A;  4GNW A;  4CI2 B;  2BT9 A;  2ACZ A;  1SY0 A;  4QH4 A;  4CPF A;  1NDJ A;  3FEK A;  2ZM8 A;  1LKX A;  5IUX A;  3RDX A;  2JIW A;  1X8O A;  1ZNL A;  5EZ2 A;  5CFB A;  2OL8 O;  2KW1 A;  5HYA A;  4GJS A;  4U3Q A;  1E5P A;  4KI0 F;  1LIB A;  3JC6 D;  1GX9 A;  1UK5 A;  5JDH A;  1MM9 A;  3P4P A;  3KFF A;  3SZH A;  4ID2 A;  4NIQ A;  4YY3 T;  2FR3 A;  3PTR B;  2ODV A;  4JI0 T;  2DWG A;  4UEM A;  4IL4 A;  1GKA B;  1STS B;  2MYS A;  1FEW A;  4KC8 A;  3TGA A;  3OTO T;  1DF8 A;  2C5I T;  3WZN A;  4QKN A;  4Y0S A;  3HA4 A;  2AT5 X;  4TWH A;  5H6Q B;  4DV4 T;  3FA8 A;  2X55 A;  4BX7 A;  1U0X A;  4QQ1 A;  2QO5 A;  4DR1 T;  4P09 A;  1WR0 A;  4B6X A;  5B11 O;  1Y0G A;  1CRB A;  3N2O A;  3ONL C;  1YUP A;  3OE3 A;  2FKJ A;  1S7D A;  2RCQ A;  4DR6 T;  1HQP A;  2WS3 A;  3GN5 A;  2IZA A;  5AFU L;  4LKT A;  1QY2 A;  1VWO B;  2YK0 A;  4O8S A;  1URE A;  2BS2 A;  2HNX A;  3RDS A;  3N91 A;  2V8S V;  4JI2 T;  1D0Y A;  4UEL A;  1KQW A;  4IE6 A;  2UXN B;  3NQK A;  2LKK A;  1W5R A;  2A2U A;  4ZI2 C;  4DV2 T;  3OVU A;  3SZJ A;  5L8I A;  1LKE A;  1MMA A;  4YDA A;  5FVK A;  3UFG A;  1SRG A;  1OEJ A;  2KT4 B;  4OYJ A;  3BU9 A;  3KV9 A;  4IB7 A;  1SLD B;  1XZY A;  1KFF A;  4I95 A;  4QYP A;  3LSV A;  4IAX A;  2AXD S;  4QZU A;  4HFH A;  1FJ1 E;  2DNX A;  4L0R A;  3RHW A;  3BK9 A;  4DR3 T;  4NXM T;  1I94 T;  3OJY C;  1EZ3 A;  2WDV A;  3RE6 A;  4JEU B;  1KNR A;  3SAO A;  5F1E A;  1XMQ T;  4TWD A;  1OBP A;  4WNK A;  2X51 A;  1D0X A;  4HFI A;  4QHO A;  4CPH B;  2W61 A;  2IZG B;  2W63 A;  4ZJ0 A;  1KL3 A;  1HTJ F;  4YHH T;  3U0D A;  3AUM O;  2A13 A;  2BBH A;  3MA9 A;  2XQY A;  4MLK A; 
#chains in the Genus database with same CATH homology
 5D48 A;  1QG5 A;  2CBS A;  2X8S A;  1CBI A;  5LKE A;  1HBP A;  1PEE A;  4LZU A;  4U8U M;  4DQ4 A;  5HZ5 A;  3NR3 A;  4IBA A;  4QAE A;  1EIO A;  3NX2 A;  4TLJ A;  5CYB A;  1A18 A;  1EQD A;  2P8G A;  2RQ0 A;  4ARH A;  4IAW A;  2OVS A;  3H3I A;  2AH7 X;  1HN2 A;  1BSY A;  3WVM A;  3P6C A;  4EED A;  4IMO A;  2IFB A;  5LKF A;  3ZZV A;  1FTP A;  3SOT A;  2Z4I A;  1E02 A;  1ICM A;  1SY3 A;  2ANS A;  4XME A;  3NAD A;  4EEB A;  1HMR A;  2RN4 A;  1DZP A;  2CM4 A;  1JYD A;  3PQS A;  3WJD A;  3HOL A;  1YWA A;  4EFG A;  3RKG A;  4AZR A;  4BOE A;  1QFV A;  4HPB A;  1QWD A;  5LJH A;  4CSB A;  1D2U A;  1QFT A;  1ERX A;  4KH8 A;  2G78 A;  3B2L A;  4TQ2 A;  5KHP A;  1T8V A;  3O2Y A;  4OMX A;  3VG5 A;  2BBJ A;  1HMT A;  3STK A;  5AEO A;  4NLI A;  4Y0R A;  4ZHF A;  1BRQ A;  4ORY A;  1GGL A;  2BLG A;  4YMY A;  4WFV A;  3WJG A;  1LIC A;  2AKQ A;  1ALB A;  4HWM A;  4ZH6 A;  1EII A;  3STM X;  1B56 A;  2R56 A;  2R73 A;  3FW4 A;  4NP1 A;  4ZGF A;  1GM6 A;  2XKL A;  2AL0 X;  2NNQ A;  2WQA E;  3EM0 A;  2AT8 X;  1ZRY A;  3ZW2 A;  2QM9 A;  3CR6 A;  4I9S A;  5D4A A;  1B4M A;  1I04 A;  5HTD A;  1ADL A;  4TKJ A;  5F6Z A;  3RBY A;  2HLV A;  2CZT A;  4EEJ A;  5LJC A;  1OBU A;  2OVE A;  2KTD A;  3P02 A;  4OMW A;  1CJ5 A;  3BY0 A;  4GDZ A;  4NNT A;  2MM3 A;  5HWZ A;  4TKB A;  4O3Z A;  3F8A A;  3KZA A;  4YBP A;  2GC9 A;  2HMB A;  2HYS A;  1N0S A;  4N7D A;  5EPQ A;  4ZHD A;  1BSO A;  1A57 A;  1IKJ A;  4O9S A;  2X45 A;  4COT A;  5KID A;  3ZI8 A;  2JOZ A;  3TZS A;  4NLJ A;  4A1H A;  1EI5 A;  3WJF A;  4YH0 A;  1X8U A;  3HWF A;  1AB0 A;  4A60 A;  3VPJ E;  3P6G A;  4EXZ A;  5HAE A;  2FT9 A;  1KT3 A;  2KD2 A;  2Z4H A;  3L4R A;  3ELX A;  1H91 A;  4NW4 A;  3FLL A;  5EDB A;  1I06 A;  4ORR A;  4IB8 A;  4U8U O;  1OPA A;  2A0A A;  3FA7 A;  1E00 A;  5FQ8 E;  5FQ6 E;  3PQU A;  1LF7 A;  1DFV A;  4UU2 A;  4WBK A;  4K19 A;  3UEV A;  3WBG A;  4QYN A;  4HPA A;  5CE4 A;  1QQS A;  1CBS A;  4O4U A;  5K06 A;  3ZW0 A;  4PSQ A;  1GT3 A;  3HOE A;  5HCD C;  4UU3 A;  1A2D A;  1MDC A;  1BEB A;  5AJC A;  3CQR A;  2RA6 A;  4IAB A;  3VG4 A;  1G74 A;  1IFC A;  4MVL A;  3VG3 A;  2A3F X;  2RCT A;  3BDR A;  4KII A;  4AZP A;  4YGG A;  3BU1 A;  5HZQ A;  4YGZ A;  2QO4 A;  3FR5 A;  2JMB A;  4EV6 A;  1LNM A;  4AYH A;  2YMS A;  2AT6 X;  4LQZ A;  3MVF A;  3V8U A;  3STN A;  2BHV A;  1ZNG A;  2MJI A;  4HPD A;  3FR2 A;  3ZW1 B;  4XMC A;  2HN1 A;  2AT3 X;  2L68 A;  5H9N A;  1KT5 A;  1LIF A;  3IFB A;  4O4S A;  5D8J A;  2EU7 X;  1KXO A;  1BJ7 A;  4WHI A;  3WJC A;  1BLR A;  2AT0 X;  4ML7 B;  4XMH A;  3ZW0 B;  3GAQ A;  4ALO A;  3NPO A;  4D6B A;  3UEU A;  1E06 A;  4ORX A;  5D45 A;  1PBO A;  2GTL M;  4INN A;  2HZQ A;  3ZUO A;  5FQ7 E;  5HZ6 A;  3Q6L A;  1SY1 A;  2JU3 A;  1IFB A;  4EQA C;  5JR8 A;  3NQ3 A;  3CBC A;  1DZJ A;  1IKE A;  1OBQ A;  1HBQ A;  2BS6 A;  3I0A A;  3P6E A;  5AJB A;  3APW A;  4KC7 A;  3CBS A;  1Y9L A;  2G7B A;  1QY1 A;  3C77 X;  3DSZ A;  3WXQ A;  3BRN A;  4BVM A;  3HWE A;  5LJD A;  2CZU A;  4GNY A;  4L1N A;  1SXX A;  4WFU A;  4ZGU A;  4O3W A;  4YBU A;  4FBR A;  1X71 A;  2HN2 A;  1I05 A;  2K62 A;  4JGL A;  4AZN A;  1GT1 A;  2OVD A;  1G5W A;  5HA0 A;  2JU7 A;  4M6S A;  4AZO A;  5L8N A;  1O1U A;  4MIS A;  4ZHH A;  2OVA A;  5LJB A;  2JU8 A;  2L9C A;  4MIR A;  2NND A;  2Q2P A;  4AZQ A;  1EAL A;  5HCC C;  5JTG A;  5BVS A;  1ML7 A;  2OZQ A;  5DPQ A;  2WUT A;  3O19 A;  4AW8 A;  4YGH A;  4MVE A;  1JJX A;  3S60 A;  1YP7 A;  2Q9S A;  4CK4 A;  5B29 A;  5B27 A;  4RUN A;  2L5P A;  2MO5 A;  3WJE A;  1KT7 A;  2X8T A;  3O22 A;  4GU8 A;  1MUP A;  1YWD A;  3PH6 A;  4O4O A;  3NWI A;  2X46 A;  3DTQ A;  5HCE C;  3B2H A;  3HK1 A;  1LIE A;  2K23 A;  1IW2 A;  3B2K A;  4QRL A;  5D47 A;  4A1Y A;  4AZM A;  3FYF A;  5F58 A;  3HTY A;  4U8U N;  4ZH9 A;  5LJG A;  3I17 A;  1EPA A;  1VYG A;  4GET A;  4IB6 A;  4N7C A;  4Y0P A;  1YIV A;  5IO6 A;  2QO6 A;  3G7X A;  4R0B A;  3T1D A;  4GE1 A;  4O3Y A;  5H9A A;  4PJ2 A;  3CK6 A;  3K3L A;  4KT5 A;  3MX7 A;  3LHN A;  3CWK A;  1CBR A;  4MVK A;  1FDQ A;  1ZNK A;  4XMD A;  5LJE A;  3APV A;  2ACO A;  4GKC A;  1AEL A;  4GH7 A;  2AMM X;  3VG2 A;  2WR6 A;  3APX A;  1CBQ A;  1GX8 A;  2IUB A;  2ZAG A;  4QGV A;  3UEW A;  5DG4 A;  4RUU A;  3ZW1 A;  3F6Z B;  3FA6 A;  1ZNE A;  4FBO A;  4FQB B;  4BQU A;  3NX1 A;  2WWP A;  3BSZ E;  5BVT A;  1FEN A;  5F7G A;  3PEC A;  2LA7 A;  3OBL A;  2LB6 A;  5FAZ A;  3RZY A;  2JN3 A;  4IB9 A;  1JJJ A;  1GXA A;  1ERB A;  2CBR A;  1EXS A;  1ZNH A;  1ICN A;  2GTL O;  1L6M A;  1KT6 A;  4GRJ A;  4CV7 A;  2WSJ A;  1X8N A;  2NP1 A;  3AKN A;  2W2F A;  4YDB A;  1BRP A;  4ZFX A;  3B2J A;  4ORW A;  1O8V A;  3PPT A;  5IO5 A;  3PP6 A;  4ON1 A;  1SA8 A;  1LFO A;  1VPR A;  3PED A;  2W2B A;  1QY0 A;  1B8E A;  4I0U A;  5LJK A;  1KZX A;  5IO7 A;  1HMS A;  2KTS A;  2HZR A;  1FEM A;  3TGB A;  2LBA A;  4HFO A;  1DV9 A;  1IIU A;  2G79 A;  4QGX A;  3C78 X;  4YKO A;  3VG6 A;  2R74 A;  4I9R A;  2OFM X;  3F9D A;  3RWX A;  3ZQ3 A;  3WJB A;  1BBP A;  4ORS A;  3C76 X;  5AQ6 A;  3CMP A;  3GE2 A;  4HPC A;  4NNS A;  1LPJ A;  2QOS C;  1JIW I;  1PMP A;  1SXW A;  2E4J A;  2NNE A;  3B2I A;  4U9C A;  4GK9 A;  3VE1 A;  1ACD A;  1YP6 A;  1JV4 A;  1NP4 A;  4A8Z A;  1VYF A;  1X8Q A;  1TVQ A;  4YFR A;  4ODD A;  1KT4 A;  4OS0 A;  2DM5 A;  5FFH A;  1EW3 A;  1LID A;  3EBW A;  1RLB E;  5EDC A;  4ALB A;  1YWB A;  5H9K A;  1KQX A;  2ALL X;  1UZ2 X;  3FEL A;  1DZM A;  3JQO A;  3ELZ A;  1MVG A;  1JBH A;  3APU A;  2POA A;  4O4X A;  3UEX A;  3MBT A;  3D95 A;  2X8F A;  3JSQ A;  3KFH A;  1BWY A;  3UAQ A;  4I3D A;  2RD7 C;  4KCA A;  4LZV A;  4XMG A;  2Q39 A;  1TOW A;  1OPB A;  1KGL A;  4I3C A;  1GKA A;  4ZHC A;  4TKH A;  1TW4 A;  3VG7 A;  3EMM A;  2ZAI A;  5EED A;  2LBV A;  4TNN A;  2FS6 A;  4GNW A;  1XCA A;  2ACP X;  2BT9 A;  2W2A A;  3BLG A;  3FR4 A;  1SY0 A;  1QAB E;  3FEK A;  4OS8 A;  1XKI A;  3ZWE A;  4NYQ A;  1X8O A;  1ZND A;  1ZNL A;  2MWH A;  1R0U A;  5EZ2 A;  2QMI A;  3JCF A;  2KW1 A;  3NQ9 A;  3VE2 A;  4U3Q A;  1E5P A;  1T0V A;  1S44 A;  3QKG A;  4EDE A;  1LIB A;  5BYP A;  3P6H A;  5HA1 A;  1GX9 A;  4D6A A;  1MX7 A;  1GT4 A;  4I3B A;  3TGC A;  1S2P A;  1RBP A;  2Q2M A;  4Y0Q A;  3KFF A;  4YKM A;  1X8P A;  5HTE A;  5L8O A;  1TXL A;  4YFQ A;  4ID2 A;  3TF6 A;  1O1V A;  1SXY A;  3KQ0 A;  2FR3 A;  4MVI A;  3CQN A;  5C0N A;  3HWG A;  4ZHG A;  1GKA B;  3BS2 A;  2LFO A;  3S26 A;  1U18 A;  4FBV A;  4KC8 A;  3FEN A;  4QGW A;  3TGA A;  2M4L A;  1FEL A;  1NGL A;  1YWC A;  1DZK A;  3EYC A;  3D97 A;  2BS5 A;  2FRS A;  2WEX A;  4Y0S A;  2AT5 X;  3RSW A;  1G7N A;  1AQB A;  5HZ8 A;  3S5X A;  1A3Y A;  3FA8 A;  5H9L A;  1U0X A;  2MHD A;  4NYR A;  4QQ1 A;  2QO5 A;  4O3X B;  1AVG I;  2GTL N;  2N93 A;  3NVO A;  4YCH A;  1T68 X;  5HZ9 A;  2A2G A;  3P24 A;  5BVQ A;  1CRB A;  3VU1 A;  1YUP A;  1OEE A;  1D3S A;  3OE3 A;  4GZV A;  3NBX X;  1S7D A;  1P6P A;  2RCQ A;  1HQP A;  3JS1 A;  2FS7 A;  4FGI B;  1I4U A;  5EEE A;  1Z24 A;  3D96 A;  3FA9 A;  4LKT A;  1QY2 A;  4OS3 A;  4M7M A;  2YG2 A;  1URE A;  4TJZ A;  2L67 A;  4XMF A;  5HBS A;  2HNX A;  3D4R A;  1OEK A;  2Q4N A;  4YFP A;  1DC9 A;  3IA8 A;  3N91 A;  4ES7 A;  1EPB A;  1KQW A;  3KFI A;  1U17 A;  1X89 A;  4ORU A;  4QNI A;  3NQK A;  1BSQ A;  2LKK A;  2A2U A;  1SY2 A;  5KIC A;  1TOU A;  4QZT A;  1NP1 A;  2CM9 A;  2FR2 A;  1LKE A;  5L8I A;  4YDA A;  3P6D A;  2JW1 A;  1OEJ A;  4L3R A;  3FMZ A;  2KT4 B;  3BU9 A;  4LKP A;  4ZCB A;  1PM1 X;  4DQ3 A;  5FEN A;  3U9P C;  1FE3 A;  1JYJ A;  1Y9T A;  2FLJ A;  2FTB A;  2OFR X;  3OD9 A;  4I95 A;  4IB7 A;  1BM5 A;  3FIQ A;  2FWV A;  3LV4 A;  4ZR2 A;  3HWD A;  3FEP A;  4QYP A;  1SXU A;  1DF3 A;  1JZU A;  4IAX A;  2GJ5 A;  3FW5 A;  3KFG A;  4QZU A;  3E3C A;  3WOV A;  3OJY C;  2F09 A;  2WEW A;  3PH5 A;  1EUO A;  1GT5 A;  1SMP I;  2GTF X;  3ZUI A;  5F6B A;  2PY1 A;  3EBK A;  3SAO A;  1B0O A;  5F1E A;  5H8T A;  1KZW A;  1MX8 A;  1OBP A;  3AKM A;  4IMN A;  3S5V A;  3U03 A;  1G85 A;  3P6F A;  2WQ9 A;  2XST A;  2O62 A;  4YCE A;  4ZJ0 A;  4I6S A;  3U0D A;  3BX7 A;  2F73 A;  3BX8 A;  2A13 A;  2BBH A;  3NP1 A;  1KOI A;  2ASN X;  4O49 A;  4EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...