3RKGA

Structural and functional characterization of the yeast mg2+ channel mrs2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
KQLLSLKPISASDSLFISCTVFNSKGNIISMSEKFPKWSFLTEHSLFPRDLRKIDNSSIDIIPTIMCKPNCIVINLLHIKALIERDKVYVFDTTNPSAAAKLSVLMYDLESKLSSTKNNSQFYEHRALESIFINVMSALETDFKLHSQICIQILNDLENEVNRLKLRHLLIKSKDLTLFYQKTLLIRDLLDELLENDDDLANMYLTVKKSPKDNFSDLEMLIETYYTQCDEYVQQSESLIQDIKSTEEIVNIILDANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Magnesium transporter MRS2, mitochondrial
publication title Structural and functional characterization of the N-terminal domain of the yeast Mg(2+) channel Mrs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 89
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 3rkgA02
2.40.128.330 Mainly Beta Beta Barrel Lipocalin Lipocalin 3rkgA01
4I0UA 3NVOA 3JCFA 2HN2A 2HN1A 3RKGA 2IUBA 4EEDA 4EV6A 4EEBA 3NWIA 2BBJA 4EGWA 5JTGA 3CK6A 2BBHA
chains in the Genus database with same CATH superfamily
4QQ1A 3SRZA 3JAFA 5J1GA 1J5ET 4ZJ0A 3OD9A 2VWAA 1CBQA 2W2BA 2OF9A 5AQJB 1VYOA 1HCIA 5HEHA 3DTQA 2RTOB 5LBMA 1W0AA 3C64A 1LKEA 4JGLA 3NBXX 4UU3A 3KBUA 5AQFB 2QGSA 4MVKA 4GDAA 5LMNT 4PW8A 1HMSA 2C4IA 1YQ3A 2E5VA 4EXZA 3BQKA 2NNEA 2KT9A 4O49A 2POAA 3ETVA 2UXDT 1YXRA 2WR6A 4X1IE 3B2KA 2UUBT 1D0XA 4O3YA 3AUMO 4CDDA 3HKDE 5HXRA 1XNQT 2Q4NA 4GK0E 2WEWA 3ZCIA 1KOIA 1RXHA 2C1QA 5AQHB 2AL0X 4X65T 4MLKA 2EHOB 3UTKA 2VDFA 1P6PA 3LK3B 2YDSA 3KFFA 1SWTA 4JNJA 3PUGA 4X1KE 3KVAA 1VWMB 2BVLA 3ONXA 3FYFA 1GXAA 3FR5A 4ALBA 2GK9A 1NENA 2K23A 4AISA 1VWEB 2V7LA 4O2BE 3HWGA 3Q9DA 4U7IA 5FXVA 5H9NA 4EQAC 1CRBA 1O3XA 3ONLC 3RBYA 2PI3O 2L3LA 4BA9A 3H3IA 2JMKA 4PAGA 3S26A 2XKLA 1IJ5A 1DZJA 3TZSA 1WR6A 3VRBA 3PJAJ 1BWYA 2Q9QD 1MMAA 2JGSA 2EHOC 1KT6A 1KT5A 3ELXA 1MM9A 1LNMA 4JUYA 3W15B 3PUWF 2AH7X 4HGAA 1RBPA 4I43B 1UCUA 3CKGA 1YWCA 3CMPA 4PJ2A 3WVMA 2HPLA 2QYWA 3P6HA 2YG2A 3Q6LA 4P09A 1N36T 3STNA 2IAKA 3CK6A 5B2AO 4TV8E 4NW4A 3CWZB 5FKYA 4ZHCA 1SUMB 3ZUIA 4KHPT 1KFYA 5B5FA 1T8VA 4QGVA 4CPHB 2KSRA 3UU8A 2BG9A 3CR6A 2W0GA 5LG3A 3AVRA 2RTBB 4L3RA 2L9CA 1LRZA 2W67A 3L09A 3APUA 5H6RB 1JJUA 2SPCA 3L3PA 5FVLA 3D96A 2A72A 4LKPA 3VHIA 1JMZA 2ANSA 2M67A 2DM5A 4U3CA 2CHNA 2AT8X 3OYXA 2ASNX 3HKBE 1SWQA 4I9SA 3QKGA 4GDZA 1ZKEA 1YKEB 4ZXLA 4UIGA 4ARHA 4ML7B 2FBWA 2KT4B 2H7VC 3Q5DA 1BSQA 4XMHA 1W5RA 2CBJA 2RA1A 3R84B 3JQOA 1Y9TA 2VL0A 1T72A 2RCQA 4CDFA 4BX6A 5AQMB 2JPFA 1X8NA 2BC3A 3OBVE 2KLQA 4A8ZA 2WWVA 4GIWA 2H3RA 2G8CO 2QO4A 3EBWA 1PEEA 4NYQA 1AVGI 1E02A 2WQ9A 3LK2B 3ZW0A 5HTEA 4KMCA 1T7SA 1ZEEA 3ZYMA 3HKEE 4H9NC 3K3OA 3GE2A 4QAEA 4TWDA 1YQ4A 3FHNA 2DWGA 5L3BB 1SY0A 1ZHCA 2XQ8A 3T1YT 2WEXA 3VG7A 2Z4HA 1M62A 2NR4A 1KNPA 1RLBE 3NQ3A 1OPBA 5DQVA 4MVEA 1SA0E 4YJ3E 1KT7A 1LIDA 2PTFA 4Z90A 3ZMZB 1JQPA 2WUTA 4AIUA 2P8GA 5AQRB 5L47A 4HPAA 2AMMX 4GK5E 1R0UA 3BK9A 3FR4A 1SWEA 3WOVA 1SWBA 4KC7A 4OFZA 2CA5A 3RY2A 2IDOB 4CN1A 1KFFA 4LFCT 4K0KT 1X79A 1BEBA 2XQ4A 2C5IT 2RTPB 4ZH9A 3MBTA 1SXYA 2ACPX 4U46A 3GN5B 2QM9A 3RGLA 2V5CA 1WUBA 1OBPA 4UVCB 5AQQB 4DV0T 1W6FA 2RTQB 1Y01A 2DJFA 1AB0A 2IZKA 3O4XE 5H9LA 4ILCA 3GA8A 3AE8A 1VRBA 1I04A 4WBNE 2CXDA 4PJMA 5IRWA 4J2CA 1Y52X 2R73A 4GGTA 4M6SA 5ETWA 4KT5A 1QQSA 5HCCC 1U5PA 5L3EB 3MKDA 1SWCA 2IIUA 2LOSA 3CQNA 3QQ2A 1EUOA 4BOEA 3AEEA 2A2FX 3AAAB 1GT5A 1HNWT 2XZEA 2WU2A 5EEDA 2DLRA 3KBTA 1HX1B 1IKJA 2Q39A 3RE5A 1WR0A 3A8YC 5LNKA 4IDQA 5AQPB 2CRBA 3KV6A 1PM1X 3RF1A 3P6FA 2LSYA 2XQ9A 4TKHA 5HCEC 2XHEB 2Y6XA 4A5XA 2ZM8A 2E8IA 3HKCE 1SRHA 3APXA 1MX8A 4ZZBA 4YTNA 4H9SE 3EVYA 1U0XA 5HXSA 1HNXT 3RQWA 4CQIA 5D45A 3FENA 4JI3T 4YSZA 2IMLA 4BX5B 4DQ4A 4JI0T 1SWAA 4A56A 5K06A 1X8QA 3FW5A 1XDPA 3UULA 2XQ5A 4UF0A 3N9LA 3QC9A 3PK2A 1SLDB 3QUJA 3F31A 1EW3A 4HE8A 3LBXA 5ADXL 1LCVA 4L1NA 2V7KA 3PUZF 4QXHB 2WY2A 5HWZA 2VL8A 4YLHA 3P6GA 2G5LA 2CEAA 3AE5A 4YMYA 1JJJA 4ILUA 1GM6A 2LKGA 1HFAA 3N9NA 4TKBA 3CKDA 2K62A 5DQWA 3LJCA 2VFBA 4QNIA 3KQ0A 1G73A 4NNSA 4IREA 3Q5WA 3V5UA 4YDBA 3KVNA 1I06A 4N7DA 1ACDA 5AQLB 2CBSA 1TVQA 1JIWI 4YFQA 2LSIA 4FI5A 2IC9A 2IZFB 3B57A 5FVKA 3GAQA 3IF8B 5IUXA 4I0UA 2UXBT 5LJKA 2X51A 4CSBA 1JYDA 1OWAA 2OFRX 3AE4A 4DR3T 3UUNA 1PMPA 3WZOA 2HNXA 2XAFB 2LHNA 2LT3A 4EOZB 3C77X 5ABHA 2HZRA 4AZNA 5ABFA 4KUMB 2RQ0A 3RDXA 1EIIA 2FJBA 2NNDA 5FP3A 2A2UA 4GD9A 4Z2PA 2ZSCA 3AEFA 5EZYE 2LBAA 4OMXA 5F8PA 1T8BA 2VVSA 3K3QC 5H9AA 2C1SA 5JDFA 3RE6A 4AQFA 3IEEA 3FA9A 5AQNB 1E2AA 1BR1A 1E5PA 5HYAA 4ZI2C 1KXOA 2XSBA 2FGSA 3ZW2A 2W61A 2NW9A 4JLEA 2X68A 4ZHGA 5EK2A 4Y0PA 4UXNB 4AKIA 4RUNA 4O4IE 4O4HE 2WWUA 5FXXA 1XWMA 4D6BA 4JI7T 5JRCA 4LFBT 4OYKA 1AJ3A 1LKXA 3SFEA 1XKIA 4U7YA 2RTGB 1BRPA 3A7MA 4BJ8A 5F2BA 1HX8A 1X8OA 2FJDA 2FR3A 4PJLA 1J1JA 4AQYT 4AKRB 5LGUB 3C50A 2KNDA 5LA6E 4JI5T 3X1DA 4TWFA 2WDRA 3N2KE 4EKVA 2R56A 1U17A 2BS5A 2ZM0A 2IZHB 3ZMVB 2C5KT 3EDVA 2LFOA 2VKJA 4WFUA 4U2ZA 3RZYA 2FJAA 2RPAA 1VCTA 4YBPA 1EQDA 1OXZA 4ORYA 4MHCA 2FT9A 4I60A 4XBFB 2CM0A 4NXMT 4TNWA 5LKEA 3FA8A 3D95A 2IZJA 3E3CA 3ZT7A 3AKMA 2BT9A 3PUXF 2RTHB 1UX4A 2CCQA 2LM2A 5HZQA 2AE9A 1SWJA 2CM4A 3WJEA 3AE1A 2N9DA 5LP6E 1NQMA 2JW1A 3MM0A 5AJBA 4IDNA 1YP7A 4DUYT 4JI8T 3FIDA 3JADA 5H8TA 4TNNA 3RYHE 5FXZA 4JBWF 2X8FA 4C90A 4IE4A 1BR0A 3KFHA 3OJYC 4OS0A 4HFEA 3ANWA 2XUEA 5L2LA 5L8OA 1SWKA 2BS2A 1OEEA 2K48A 3SZJA 4ZOLE 3MK7C 2HH7A 2ODUA 2PJQA 4ES7A 2UXNB 1MMGA 3B2JA 4U8UO 4MBQA 1TXLA 2A8GA 4O3XB 4DBQA 3CBSA 4HPCA 1YP6A 1J5WA 3CX8B 1US7B 4LF7T 4BCSA 3F8AA 2PFVA 1N33T 4IDZA 4Z8XA 2Y3FA 1FDQA 2AT3X 1D1BA 1QY2A 5FNVE 2WDQA 3RH3A 1EPAA 3BY0A 5KX5E 1ZV4X 2RTAA 3AE3A 3UEVA 1JBHA 2PY1A 2EHOA 3CKFA 5B10O 2N1GA 3UUBA 1VWJB 3IA8A 2RTRB 3E0ZA 2G79A 3PU3A 1IBLT 3P4QA 1RAVA 5DPQA 2LEHA 4LF9T 3AKNA 2CLYB 5JDMA 4O4XA 1XMOT 1MNEA 2VURA 5JDLA 5JDNA 1KNRA 2QRXA 3FZLB 3BU9A 4I6SA 1HF8A 4CXWA 1I78A 2YINA 2VQET 3NR3A 2YU1A 4GETA 1L6MA 4UELA 4LQZA 4JV5T 3IFBA 2FJEA 2C5JA 4HWCA 3ZQ3A 2JRKA 2W00A 4B3ST 3PP6A 5IO7A 3VHLA 4XMCA 1UYNX 4ZI3D 5LYJE 2X8TA 1HG5A 4KHZF 2MBGA 4ZS2A 2X9HA 1VWRB 2LBVA 1SA8A 3RY1A 3C76X 2WBLA 3T1DA 1W4TA 1K3BA 4TX5A 4EFGA 4ILBA 3SOLA 1X8PA 3FA7A 1RSTB 1SRJA 5E0OA 5KMGP 5AQKB 2XQ3A 4BQUA 3FEPA 3VG4A 1W0BA 2CLYC 5JR9A 3UEWA 3UUMA 2KZ7B 1LELA 3WJFA 3NQ9A 3Q34A 2V6XA 2IZAA 2XSAA 4CXXA 2N2NA 3OTOT 2F01A 1MVGA 2GJ5A 1KL5A 4CPHA 2ZMAA 2YMSA 1VWCB 4I3CA 2OYBO 1WRDA 3VHHA 5IXGA 2FLJA 2MWHA 3VG3A 2LSKA 1BM5A 4YGZA 1HQPA 1UREA 2KW1A 2NW8A 1NEKA 4YKOA 3HWFA 5GONE 1RSUB 1MIWA 1AELA 4WHIA 1DV9A 1NWMX 4WFVA 4ZGUA 3I0OA 3KFWX 2E9XD 4EGWA 2FHNX 2NNQA 2WU5A 4L9IA 4GE1A 4RUUA 5FENA 3STKA 4GK9A 2OL6O 2RTJA 3LG7A 1KF6A 3ETUA 3EW1A 3NZQA 2V26A 3PU8A 4AI6A 2CWOA 2YDQA 4YHJA 2NW7A 1B56A 1MX7A 3UAQA 4PJJA 2VASA 1UUSA 2XPKA 2I6HA 4HN9A 2X56A 1S7DA 4AKGA 4YCEA 3TF6A 3V8UA 4ZI3C 4OMWA 2LRLA 3PQSA 2FWVA 5CHKA 1EI5A 3I1AA 3AEBA 5LOVE 1VWLB 3AVSA 4DV7T 3A5XA 2G0UA 4DIDB 5IO6A 2E9XB 1SRIA 4G63A 1W9RA 4KH8A 2BBJA 2KWHA 2X45A 2MAWA 3S5XA 1B0OA 2X4MA 4OKAA 2CHOA 1WYBA 4PK6A 5LJGA 4FBVA 3TGCA 2L9QA 4U72A 4ILAA 2FHLA 3JCFA 3WI3A 3FLLA 5FAZA 2Q9QB 4YBUA 1BR2A 1NAFA 4Z28A 2JQQA 3K8PC 2LJLA 2JMHA 1VWHB 5LHIB 1T68X 2HYSA 4Z91A 4YJ2E 1ZNLA 3RLFF 4F8HA 3HWEA 3GN5A 4NV8A 4O9SA 4P1NA 2WAUA 4LF5T 2LHRA 3UEUA 4P0BA 1G7NA 2J4GA 1AVEA 2CMRA 3G06A 1K24A 1E1HB 2RCTA 1JZUA 3STMX 2FRSA 3RIFA 2K5BB 4A60A 2E9XC 4TWHA 2BZBA 4EYYR 3O1JA 1R8IA 3PDFA 3WAJA 3ABVA 4O4LE 3P4RA 3ZT6A 5BVQA 1WCRA 4ZS3A 3OJAA 1SHZC 4DR6T 2MM3A 3E22E 1LDOA 2NP9A 2FS7A 3PECA 1PTSA 3S4UA 3AXJB 2RTCB 3PUYF 5CSEA 2Q9QC 1VYFA 4H63H 3OBLA 1PBOA 3S60A 2L67A 3WXQA 1Y64B 2V8SV 5L3FB 4LFAT 2OY1O 5JDGA 2M6BA 3VR9A 3FR2A 2X9WA 4YFSA 3IBPA 1LUQA 5LHHB 2IC6A 4O4JE 1X71A 4FQBB 3B2LA 4YVBA 2LLYA 2A3FX 5F6ZA 3BS2A 4TUYE 3LTWA 4X66T 1S35A 5KHPA 4IE5A 5B29A 1A57A 4DNEA 5CYBA 3RDMA 4GUZA 1QFTA 2MOZA 2W2AA 3VE2A 4EEJA 3PJAA 3OE3A 4BX5A 4DUZT 4IBAA 3PUQA 2OFAA 4G2AA 1WBIA 3N9MA 3D0TA 2MO5A 4ID2A 5HAEA 1G5WA 3P6EA 3S5VA 5IO5A 2HN1A 3MVFA 3N91A 1S44A 4FBOA 3NX1A 3ZT5A 3PUVF 4XMGA 3SLJA 3PPTA 3KV9A 1B7TA 1HG2A 3RDUA 1NP1A 2LB6A 2WS3A 4GJVA 4YDAA 3SFDA 1LFOA 3BX8A 3TGAA 1CBSA 1ML7A 2UUCT 4QH1A 4YTPA 2L5PA 5L8NA 4N7CA 2HHHT 2R6GF 5J2UE 5FL1A 4O3WA 4EV6A 3FXDB 4L5GA 4B55A 2WWPA 2YN6A 3MXZA 1I9HA 2E2AA 4U2YA 4DVDA 4EB6E 2KWIB 1D0YA 5F3JA 3I17A 1QWDA 3QB5A 2WMNA 1YIVA 2CXLA 3MG5A 3ZSSA 2Y3EA 1ZNHA 4GKCA 5CA1E 2WQYA 5AQTB 5BMVE 4O4UA 5LGNB 2A5CA 1N7YA 4DQ3A 4ZHHA 4ZEYA 3ZC1A 1UYOX 2WQAE 2A0AA 4HWHA 4ISTA 3CMLA 2LKKA 2JQKA 1TW4A 4Y0SA 2ZAGA 1QLBA 5FY7A 4GJSA 4AZQA 3NRYA 1JNZA 3CQGB 2P9BA 2XQ7A 5EK4A 2QCBA 1ICNA 3T6LA 2RTIB 2ZM2A 2X55A 3O19A 3OKQA 5FMNA 5FXWA 1VWPB 3FBZA 3RHWA 4HWMA 3VU7H 5JREA 4WBKA 4CK4A 3RIUC 2YOEA 4JI1T 3CX7B 5EEEA 2LRKA 1SMPI 5HCMA 2DI4A 1EXSA 4X62T 4HFVA 1UGOA 4UU2A 4KBMB 4O2AE 1G8XA 1UX5A 1SWPA 2D0UA 3EHZA 1HQQA 2E4JA 3WJCA 1KEYA 3ZJ2A 4UEMA 3UFEA 3WYQA 5FY0A 1VWDB 3T2WA 4ZHDA 4CN6A 4U74A 5H6QB 3VR8A 5HBSA 3KZAA 4DO0A 3KV5A 4GGRA 4CV7A 3FB2A 3P4PA 2ES0A 1UZ2X 2RTDB 2WCAA 2JN3A 2CPTA 4I9RA 1DZKA 1SY3A 4CPFA 1LVKA 4ZI7E 1UK5A 2JU7A 4GOUA 4Y59A 5HZ6A 4YFRA 4X64T 4MVIA 1GX9A 1SLEB 4MISA 1PBYA 1CBRA 3GWHA 3CVRA 2OVAA 2N93A 1YW0A 3C51A 5F1EA 2QMIA 2OV9A 4Z27A 4B3TT 2V7IA 3ONJA 1SXXA 4EAHA 1E2TA 3KVBA 3MX7A 5AQGB 4EIWA 4QH4A 2HPJA 1DF8A 3VG2A 1E00A 2OFBA 2X9XA 3AE9A 3UU6A 2RTMA 4IB8A 4LMJA 2Q2PA 2D2SA 3FZHB 2V6YB 3AAEB 4DR5T 2W4XA 4KIIA 2OLTA 3K1SA 1U4QA 4L0RA 3VKGA 1SWDA 4DV5T 4COTA 1D1CA 4XMFA 4GU8A 3U0DA 2D5UA 4WYVA 2D0TA 4M7MA 2VKDA 1VWOB 3K3LA 3FIQA 1G85A 1SWOA 2VKOA 5J0ZA 1WLXA 2OVSA 5BYPA 2X67A 1IJ8A 3C4ZA 3O2YA 3ZMUB 5L3YA 1M7KA 3QK6A 4YHHT 4Y0QA 1FELA 2F09A 3LSVA 5HCDC 5AQIB 3LV4A 1Z0PA 2LE8A 5FQ8E 2CAMA 5B27A 3PTRB 4NPPA 2OY5O 5JR8A 3UQ4A 3FBLA 4JHQA 4NIQA 4TZ4C 3KFIA 1V9DA 3C98B 2WZHA 4OHFA 4ANJA 1HR0T 1G74A 2JMBA 2RTFB 2YEVC 1N34T 1ZOYA 2ACOA 2AXDS 3V5SA 1X89A 3AEGA 3SS1A 2C0SA 4N78D 4QXCB 2OVDA 5F6BA 4NLIA 4IL4A 3BQLA 5AEOA 2AT0X 2XAGB 1FE3A 1OEJA 1SXUA 3JS1A 2L68A 2XM1A 2I0MA 4YY3T 1HXLA 3WZQA 3NZPA 3U03A 3SZIA 2F73A 1OEKA 1I05A 2K24A 2WSSV 2X34A 5LJMA 1NQNA 4QGWA 1YD8G 4DCBA 3ZW1B 3EYCA 3QOFA 1E06A 2KINB 2W2FA 3JSQA 5B5GA 4LZVA 2YK0A 4JI6T 4BX7B 1QY0A 1MOYA 1O1UA 5BR8T 2BHVA 1IW2A 3VHMA 3TLWA 4YSXA 1HXZA 4LKTA 4TNVA 3SZHA 2WPUA 4P0AA 5J2TE 4HFBA 4WW0A 1O8VA 1VYGA 3VU1A 2GTLO 4HFIA 3P4WA 1N9MA 4NXNT 3SWHA 2QOSC 3H3MA 5JVDE 4AZPA 4MFRA 2BVMA 3UT5E 1ERXA 4C5PA 4QZTA 2IZCB 4EDEA 2I5ZO 2DHRA 2FUPA 3NADA 2CM9A 5KIDA 4GKJT 2R74A 5LJEA 4DR7T 2FKJA 2NTXA 4ZZCA 5EPQA 2CZUA 1MDCA 4ASKA 4K0UA 5JH7E 4ZHFA 1VWGB 2OY7A 2CE7A 3KFGA 5LXTE 2QO5A 3UU4A 1H91A 4KP3C 2OY8A 5JRCB 5HEJA 2LA7A 4WNKA 3VG5A 4ORUA 5KICA 3CQCB 5BVSA 4IE7A 3LK42 3EC5A 4DBRA 2UXXB 2IZEB 4CI3B 1E7PA 2OVEA 1LCWA 4XMEA 4GGZA 2IUBA 4QRLA 3KDSE 3FW4A 4OX9T 4ORWA 1OEDB 3P4SA 5LB7B 1SWUA 2XJ7A 3PH5A 4XAXB 5DG4A 2Y48B 3HR0A 3D97A 3WZPA 4OELA 2G78A 1HS7A 3P6DA 1HMTA 2VVNA 2RTLA 2QO6A 2BS4A 3RRWA 1SWLA 2ACXA 2V5DA 3EBKA 4I55E 4NUVA 5IYZE 1FEWA 4DV2T 1LIEA 3EDUA 5FL0A 3ZUOA 1VWKB 1KZXA 3IHRA 3F6ZB 2HMBA 5LCYA 2HN2A 4HFDA 4LF6T 1XNRT 2JOZA 4EEBA 1T98A 4COFA 2AVIA 2UXCT 3AEHA 4GRJA 4Q25A 4GNYA 3RKGA 1IAPA 4FJOA 3UQ7A 1TOUA 5CE4A 1O1VA 3ZSTA 4PFPA 2WM9A 1YWBA 1OEDC 3AA1B 2CXFA 4OEMA 5LJCA 3EABA 1B4MA 4OYJA 1DZPA 1HMRA 1SY2A 3N5LA 2EHOD 3EMMA 1BLRA 1QY1A 3LHNA 2X32A 1HNZT 3FDCA 2E9XA 2LSGA 4CI2B 1N0SA 1N43A 5KXJA 2JQHA 1XDOA 4LMLA 4XZCA 5HEUA 2EU7X 3CQRA 2IZGB 5EDCA 2IZIA 4BJNA 1RXKA 1VCSA 4PFOA 4HWDA 4IAXA 1VOMA 5JQGE 4F6RC 1GX8A 5D48A 4I4TE 3MACA 4GZVA 1KT3A 1CJ5A 2WZIA 2Q9QA 2UUAT 1FENA 2WSJA 3HOLA 5C3JA 4UVAB 5HWXA 1FMVA 2NWBA 3DP7A 4U31A 3O1IA 4R0BA 2W66A 4EZ4A 1MK5A 2Q9SA 2DCFA 3UUXB 3M3ZB 1B8EA 3MZKB 4ADZA 3FZFB 1Y55X 5HA0A 2RN4A 2Z6EA 3B5MA 4PNIA 1IKEA 1EIOA 3I9WA 4QH5A 2WB5A 5HXEA 2IZLB 4GKKT 4PK5A 1SWNA 5AJCA 1ALBA 1GKAB 2WP9A 4NYRA 4UV9B 3PE0A 3WJGA 4AYHA 1YWDA 1MIVA 4LF8T 2YU2A 2ZLYA 3L8RA 5HA1A 2GTFX 4TLJA 4NUUA 5L3CB 2KTSA 1Z8UA 3ZPOA 4IT4A 5HEGA 5LHGB 5F58A 1YUPA 5HTDA 2FR2A 3DSZA 4DMVA 3WJDA 4YSYA 3RDOA 3AXJA 5FYMA 3J7Yq 2OF8A 3H3AA 5AQOB 1BBPA 2LKHA 3RDSA 4ZGFA 3PUSA 4YTMA 1ICMA 4Z6JA 4WBOA 1XMQT 3VE1A 4YT0A 1H7CA 3CX6B 5AFUL 4QX8B 2GTLN 2PG8A 3L39A 4B3RT 3N9PA 4DV6T 1GT1A 2H89A 2PBIA 3T8OA 4QGXA 3I0QA 3C4WA 5CA0E 4I3BA 4QXBB 3OYZA 1RXJA 2CWYA 3ZYLA 4TV9E 1OEDE 1I6ZA 4U8UN 3ZCJA 4AZRA 3GMIA 4BAYB 1LVFA 5L3DB 4BGFA 3CIRA 3Q5EA 3C78X 1VWAB 5L4EA 1LCZA 4M1PA 2XASB 1VWBB 4DNDA 3RPUA 5JR9B 2HKDA 2OA5A 2XTLA 2ALLX 2VB6A 2HLVA 2IW5B 1ADLA 4X1YE 2OL8O 5FQ6E 1FJ1E 2KTDA 5ABGA 2Z4IA 2JU3A 4PSQA 2XQYA 1SLFB 3B13A 4EZHA 2GTLM 2J1DG 2BS3A 1SREA 3O1HA 3SLOA 2W63A 4GYSA 3ZC0A 4C91A 3P50A 4LMKA 2JU8A 4YH0A 5HWYA 5LJBA 1W09A 5EZ2A 3ESLA 1ZNDA 4U8UM 2J47A 4A97A 1SWSA 1Y9LA 5TAOA 3JAEA 2YDRA 1AVDA 5AQVB 1T0VA 2LSJA 1STRB 3I0AA 1U18A 4I3DA 2A3DA 1SWRA 5ABEA 2IFBA 3APVA 5HAXA 1NP4A 3AA7B 2I59A 2KXPB 3RDQA 4CDEA 1ZP0A 5JR9C 1YWAA 2VK9A 2AT6X 4QYPA 5F7GA 3EAMA 3ZYKA 2MHDA 4GH7A 3JC6D 3U9PC 3RIUA 3O9XA 4BBOA 5D47A 3BU1A 3F2EA 2XAJB 3ZKRA 2CBRA 2IZDB 1S94A 3TKLB 4U9CA 2XSTA 2RP4A 4CN4A 3BLGA 3WBGA 5LG4A 4CZZB 3MJXA 4JEUB 4NNTA 1SRGA 3P02A 1DF3A 5JTGA 2A5BA 4ZCBA 5JDQA 3O22A 4IL9A 2MYSA 4JI4T 3RYFE 4HEAA 1A18A 5JD2A 2A2GA 4IMNA 5FFHA 4BVMA 1IBMT 1D0ZA 3ELZA 4A1YA 1FMWA 1HY2A 1GT3A 2QA7A 1SWGA 3AA6B 4EEDA 5LJNA 2GH7A 4Z2OA 4ODDA 4HFCA 3FELA 2BG9B 2NOXA 2ZAIA 2H7OA 4OS3A 3ZLIA 2M6IA 3AE6A 3BQIA 4E7SA 2FKGA 3LFMA 4U33A 3G7XA 4LF4T 1SWHA 3HOEA 4NV7A 3LDQB 4QWNB 3NRXA 1JV4A 3T1HT 1KK7A 2XAHB 3OVUA 5D4AA 1N4JA 4O4OA 4D6AA 4IB9A 2X66A 1MMNA 4ZHQE 2DJGA 2X8SA 4IB7A 5LJHA 5L4HA 4HWIB 5L3GB 1GQEA 3NX2A 2A9UA 2H88A 3BSZE 2KMFA 3TGBA 4HFHA 3RYIE 3VPJE 2GC9A 2B1EA 3D9WA 4BX6B 2BKPA 4QKNA 2OL7A 1FJGT 4O4SA 3C4XA 2DL1A 4IDOA 4IRWA 1KGLA 5CJ5A 2FTBA 4E7ZA 1EPBA 2AKQA 1DZMA 2RTKA 4ZR2A 3HA4A 2RTNB 2KD2A 3WYPA 4OS8A 2O62A 5D8JA 3UEXA 3UU3A 2BG9C 2MTQA 4DR4T 3JC6C 4K19A 1IZNB 1SE7A 3TLVA 3VRAA 3ZW0B 3MA9A 5HEOA 3R6NA 2YKSA 2VQFT 3H37A 2JIWA 2OZQA 5HCJA 5F5WA 5C8YE 1OSPO 3RSWA 2DWKA 4YXDA 1MUPA 5DABA 1LIBA 2X0HA 4QX7B 1LPJA 5H9KA 4QHOA 1EALA 3PUAA 1DC9A 3CQXC 2W2UA 1BR4A 3N9QA 1HTJF 3EW2A 2V6YA 1VWFB 3RYCE 4DV1T 2F4VT 4QYNA 3PDYA 4EXTA 1NDJA 1OBUA 4YGGA 2G7BA 3F9DA 2HZQA 4MVLA 2L8KA 5IRAA 3RQUA 3NWIA 3IA3A 5A1LA 4CI1B 2LOPA 1GX3A 2BSZA 1BSOA 4ON1A 4YFPA 3NP1A 2XY8B 4IMOA 4ZI2D 4UVBB 1ERBA 1GGLA 1FEMA 2UYWA 2X9YA 3I9YA 4IDPA 4NLJA 1UURA 4UV8B 4HPDA 3RWXA 3UFGA 4YKMA 2LM9A 4AW8A 4ZFXA 3P6CA 2D9DA 1JYJA 1MMDA 5LBQB 4JEHB 2NTYA 4ORXA 3TLSA 4MALA 4AQGA 3RC8A 3ZN0B 2XQ6A 4AXPA 4O8SA 4PK4A 5IWAT 5IHYA 1A2DA 1STPA 3N9OA 1GT4A 3RRCA 3ZZVA 5HZ8A 2WDVA 4XMDA 1X8UA 2QOMA 1TOWA 2DNXA 1L0VA 3P8CD 1X9BA 2J62A 3CWKA 2BBHA 5K68A 2NP1A 1FTPA 3PH6A 3HWDA 5LKFA 2A13A 4H9OC 2OFMX 4HWFA 3T6FA 1NC9A 2BG9E 4HPBA 1Z24A 1S2PA 1OPAA 3RI5A 3ZW1A 2XM2A 2VFCA 1XZYA 4DR1T 4IE6A 4KX6A 2UU9T 4B3MT 2MJIA 1KZWA 3CBCA 3HL6A 3ZMTB 3B2HA 1KNZA 1JMXA 3AEDA 3PQUA 3SLTA 4BX7A 3FMZA 4OK0A 2BDEA 1CUNA 4GYRA 1ZNKA 3ZWEA 4X5TA 3NQKA 2V7MA 1NGLA 3EM0A 2K3WA 2BKNA 1XCAA 2JJ9A 2CZTA 3U3IA 3KV4A 1IBKT 4JO6A 1I94T 3VKHA 3SAOA 3PURA 5EK3A 2BLGA 1HBQA 3T2XA 1N32T 4IB6A 4AZOA 2IZBA 4UF0B 2W62A 3EI0A 3ZMSB 1IFCA 1OBQA 1Y53X 4CPIA 5HZ9A 3N2OA 1YKHB 2FS6A 5DJQC 4WZXA 3LBXB 1SRFA 3L4RA 2MF6A 1ZNGA 3CPZA 2BKOA 4O3ZA 2K9AA 2V1DB 5LMUT 4BJMA 2RTEB 4IAWA 1MNDA 4TKJA 3FZMB 3AEAA 3FZKB 4QZUA 2VKHA 1QUUA 4IHJE 4DV3T 3EUHA 3DJBA 3E08A 4DMWA 1A3YA 1STSB 5JDHA 2ACZA 5HXCA 4INNA 4KCAA 3NVOA 4ERRA 3SOTA 4H9PC 3ZEFB 4YCHA 5CFBA 4CDCA 5BVTA 1JNRA 4ZH6A 1QG5A 5L8IA 5CGMA 1OEDA 1BSYA 5C0NA 2BS6A 1CHUA 4IGUA 4HTEA 5K67A 2E5LT 5AQSB 1SY1A 1D3SA 5CB4E 2WMOA 3NPOA 1ZNEA 3APWA 5FY1A 4TQ2A 5EDBA 1VPRA 2AT5X 1JJXA 4ISSA 3TLUA 3QB5K 2XQAA 4TN7B 1HN2A 3PV0F 4H63V 4IIJE 3RX6A 1BJ7A 1KL3A 3UU5A 3BX7A 5ABFB 4H9RC 4IABA 4KC8A 3N2GE 1D2UA 4Z2VA 1QSDA 2AF5A 3ZI8A 5AQUB 4LZUA 2I5VO 5B11O 1KT4A 3J9X1 2M4LA 4Y0RA 1MIYA 4X20E 4AKLA 5B3MO 4AZMA 3RKOA 4YGHA 3BDRA 1SWFA 3BRNA 5HZ5A 1QABE 3AE7A 5C2TA 1EZ3A 2CBIA 4B6XA 1LICA 1WYCA 1WFDA 3HTYA 1LDQA 1VWNB 3RIAA 1HBPA 2Y32A 4FGIB 3OPCA 2Q2MA 4MIRA 4ALOA 3AAIA 3RC3A 1VWIB 2RA6A 4A98A 3VG6A 1IFBA 3DTOA 3HI2A 1LF7A 3HPEA 3AB3B 1VWQB 4AKHA 3TLTA 4KI0F 3K3NA 2MPKA 5HXHA 1N9YA 3Q2MA 3F57A 4IE0A 2JQ9A 1BRQA 2Y8DA 4FBRA 4AQFC 1D1AA 2QVAA 3KINB 3WAKA 3FXEB 4ORSA 5AQ6A 3AE2A 3AECA 3HK1A 2X46A 4PJNA 3PEDA 4JYAT 5FQ7E 4CPEA 3B2IA 3U78A 2X0YA 4I95A 3FEKA 3AA0B 4Y5DA 3QNUA 2ZM6T 1LIFA 4DV4T 4TJZA 3WZNA 5IRUA 1AQBA 4A1HA 4JI2T 3ZN1B 4DR2T 1NBXA 5LJDA 1GKAA 4CXYA 3P24A 4HFOA 1IIUA 3M65A 1CBIA 1KQXA 5M4YA 3ZJ1A 1KQWA 3Q5XA 3X00A 1Y0GA 2ODVA 1SXWA 4NP1A 4EYUA 1I4UA 4MEEA 3NKZA 2XAQB 4V1Av 3P7IA 1DU2A 4ORRA 2RD7C 1QFVA 3FA6A 4HKAA 1ZRYA 1SLGB 1KL4A 4U3QA 3WJBA 1FIOA 2B76A 1IJ6A 4H9QC 2IHR1 4UR9A 1MEPA 3D4RA 4I50E 5LGTB 2V7JA 2UZ2A 3ANWB 5KDMC 4GNWA 2X0LB 3VGWA 1DFVA
chains in the Genus database with same CATH topology
2ZAGA 1T0VA 4QQ1A 2R56A 1U17A 2BS5A 3I0AA 1U18A 4AZQA 2LFOA 3RZYA 4I3DA 4WFUA 4ZJ0A 3OD9A 1ICNA 1CBQA 2IFBA 2W2BA 3APVA 3DTQA 1EQDA 4YBPA 3O19A 1LKEA 4JGLA 3NBXX 4ORYA 2FT9A 4HWMA 4MVKA 4UU3A 1NP4A 1HMSA 4WBKA 5LKEA 4CK4A 3FA8A 3D95A 3E3CA 3AKMA 2BT9A 1YWAA 5EEEA 4EXZA 2AT6X 4QYPA 5F7GA 2NNEA 1SMPI 4O49A 2MHDA 2POAA 4GH7A 1EXSA 3U9PC 5HZQA 2WR6A 5D47A 3B2KA 3BU1A 2CM4A 4UU2A 3WJEA 4O3YA 5AJBA 2JW1A 2CBRA 2Q4NA 2WEWA 1YP7A 4U9CA 2E4JA 2XSTA 3WJCA 1KOIA 2AL0X 5H8TA 4TNNA 3BLGA 4ZHDA 3WBGA 5HBSA 3KZAA 1P6PA 4NNTA 2X8FA 3KFFA 3P02A 3KFHA 1DF3A 4CV7A 5JTGA 4ZCBA 3OJYC 4OS0A 1UZ2X 2JN3A 3O22A 3FYFA 4I9RA 1DZKA 1GXAA 5L8OA 3FR5A 4ALBA 1A18A 1OEEA 1SY3A 2A2GA 4IMNA 5FFHA 4BVMA 2JU7A 5HZ6A 2K23A 3ELZA 4A1YA 4YFRA 3HWGA 1GT3A 4MVIA 1GX9A 5H9NA 4EQAC 4EEDA 4ES7A 4MISA 3B2JA 1CBRA 4ODDA 4U8UO 3FELA 1TXLA 1CRBA 2OVAA 2N93A 3RBYA 4O3XB 2ZAIA 3CBSA 4HPCA 1YP6A 4OS3A 5F1EA 2QMIA 3H3IA 3F8AA 3G7XA 3S26A 2XKLA 3HOEA 1SXXA 1DZJA 3MX7A 1FDQA 2AT3X 3TZSA 1JV4A 1BWYA 5D4AA 1QY2A 4O4OA 4D6AA 4IB9A 1E00A 3VG2A 4IB8A 1EPAA 3BY0A 1KT6A 1KT5A 2X8SA 2Q2PA 4IB7A 3ELXA 5LJHA 4KIIA 1LNMA 3UEVA 3NX2A 1JBHA 2PY1A 4COTA 3BSZE 3TGBA 4XMFA 4GU8A 3U0DA 3VPJE 3IA8A 2GC9A 1RBPA 2AH7X 4M7MA 3K3LA 3FIQA 1YWCA 3CMPA 4PJ2A 1G85A 2G79A 3WVMA 4O4SA 3P6HA 2YG2A 3Q6LA 1KGLA 2FTBA 1EPBA 2OVSA 3STNA 2AKQA 3CK6A 1DZMA 5DPQA 4ZR2A 5BYPA 3O2YA 4NW4A 2KD2A 4OS8A 2O62A 5D8JA 4Y0QA 1FELA 2F09A 3UEXA 5HCDC 4ZHCA 3LV4A 4K19A 3AKNA 3ZUIA 5FQ8E 4O4XA 5B27A 1T8VA 3ZW0B 5JR8A 4QGVA 3CR6A 2OZQA 4L3RA 3KFIA 2L9CA 3APUA 3BU9A 4I6SA 3RSWA 1G74A 3D96A 3NR3A 1MUPA 1LIBA 2JMBA 4GETA 1LPJA 2ANSA 4LKPA 1L6MA 5H9KA 2DM5A 4LQZA 1EALA 2ACOA 2AT8X 3IFBA 2ASNX 1DC9A 1X89A 4I9SA 3QKGA 4GDZA 5F6BA 2OVDA 3ZQ3A 3PP6A 5IO7A 4NLIA 4XMCA 2X8TA 4ARHA 5AEOA 4ML7B 2KT4B 4QYNA 1OBUA 2AT0X 4YGGA 2G7BA 1FE3A 2LBVA 1BSQA 3F9DA 4XMHA 1SA8A 2HZQA 1OEJA 1SXUA 3C76X 3JQOA 1Y9TA 2L68A 3JS1A 4MVLA 3T1DA 2RCQA 3NWIA 4EFGA 1X8PA 1X8NA 3FA7A 3U03A 2F73A 1BSOA 4ON1A 4A8ZA 1OEKA 1I05A 4YFPA 1DFVA 3NP1A 4IMOA 4BQUA 2QO4A 1ERBA 3FEPA 1GGLA 1FEMA 3EBWA 1PEEA 3VG4A 4QGWA 3UEWA 4NYQA 3ZW1B 3WJFA 1AVGI 3NQ9A 1E02A 4NLJA 3EYCA 2WQ9A 1E06A 4HPDA 3RWXA 1MVGA 2W2FA 3ZW0A 2GJ5A 3JSQA 4YKMA 5HTEA 4AW8A 4ZFXA 2YMSA 4LZVA 4I3CA 3P6CA 1JYJA 1QY0A 1O1UA 3GE2A 4QAEA 4ORXA 2BHVA 1SY0A 1IW2A 2FLJA 2MWHA 3VG3A 2WEXA 3VG7A 1BM5A 2Z4HA 4YGZA 1HQPA 4LKTA 1UREA 2KW1A 1RLBE 3NQ3A 4YKOA 3HWFA 1O8VA 1A2DA 1OPBA 4MVEA 1VYGA 3VU1A 2GTLO 1GT4A 3ZZVA 1KT7A 5HZ8A 1LIDA 1AELA 2WUTA 4XMDA 2P8GA 2QOSC 4WHIA 4AZPA 4HPAA 1DV9A 1X8UA 4WFVA 2AMMX 4ZGUA 1R0UA 1ERXA 1TOWA 3FR4A 4QZTA 4EGWA 3CWKA 4EDEA 2BBHA 3NADA 3WOVA 2CM9A 4KC7A 5KIDA 2R74A 2NP1A 5LJEA 2NNQA 1FTPA 3PH6A 3HWDA 4GE1A 5LKFA 4RUUA 2CZUA 1MDCA 5EPQA 5FENA 3STKA 4GK9A 2A13A 1BEBA 2OFMX 4ZHFA 3KFGA 2QO5A 1H91A 4ZH9A 3MBTA 4HPBA 1Z24A 1S2PA 1OPAA 1SXYA 2LA7A 3ZW1A 1MX7A 2ACPX 3UAQA 1B56A 3VG5A 4ORUA 5KICA 2QM9A 2MJIA 5BVSA 1KZWA 3CBCA 1OBPA 3B2HA 1S7DA 2OVEA 3PQUA 4YCEA 3TF6A 3V8UA 3FMZA 1AB0A 4OMWA 4XMEA 3PQSA 2FWVA 2IUBA 5H9LA 1ZNKA 4QRLA 3ZWEA 3FW4A 4ORWA 1EI5A 3NQKA 1NGLA 3EM0A 1I04A 2R73A 3PH5A 1XCAA 5DG4A 5IO6A 2CZTA 4M6SA 4KT5A 1QQSA 3D97A 5HCCC 4KH8A 3SAOA 2G78A 2BBJA 2BLGA 2X45A 3P6DA 1HMTA 1HBQA 3S5XA 1B0OA 4IB6A 4AZOA 2QO6A 5HZ9A 5LJGA 1IFCA 1OBQA 3CQNA 4FBVA 3TGCA 3EBKA 1EUOA 4BOEA 2FS6A 1LIEA 3JCFA 1GT5A 3FLLA 3ZUOA 3L4RA 5FAZA 1KZXA 5EEDA 1ZNGA 4YBUA 4O3ZA 1IKJA 3F6ZB 2HMBA 4IAWA 4TKJA 2HN2A 2Q39A 2JOZA 4EEBA 1T68X 2HYSA 4QZUA 1ZNLA 4GRJA 4GNYA 3RKGA 1PM1X 1A3YA 3HWEA 4O9SA 1TOUA 5CE4A 3P6FA 1O1VA 4INNA 4KCAA 3UEUA 3NVOA 1G7NA 4TKHA 5HCEC 3SOTA 1YWBA 4YCHA 2RCTA 1JZUA 5LJCA 5BVTA 4ZH6A 3STMX 1B4MA 1QG5A 3APXA 2FRSA 1MX8A 5L8IA 4A60A 1BSYA 1DZPA 5C0NA 1HMRA 2BS6A 1U0XA 1SY2A 3EMMA 1BLRA 1QY1A 5D45A 3FENA 1SY1A 3LHNA 1D3SA 5BVQA 1N0SA 4DQ4A 3NPOA 2EU7X 1ZNEA 3APWA 2MM3A 4TQ2A 3CQRA 5K06A 5EDBA 1X8QA 2FS7A 1VPRA 5EDCA 3PECA 3FW5A 2AT5X 1JJXA 1HN2A 4IAXA 1BJ7A 1GX8A 5D48A 3BX7A 1VYFA 3OBLA 1PBOA 3S60A 4IABA 4KC8A 1D2UA 1EW3A 2L67A 4GZVA 3WXQA 1KT3A 3ZI8A 4L1NA 1CJ5A 4LZUA 1FENA 2WSJA 3HOLA 5HWZA 1KT4A 2M4LA 4Y0RA 3P6GA 3FR2A 4AZMA 4YGHA 4R0BA 4YMYA 3BDRA 1X71A 2Q9SA 1JJJA 4FQBB 3B2LA 1B8EA 1GM6A 3BRNA 5HZ5A 4TKBA 1QABE 2K62A 2A3FX 5F6ZA 5HA0A 3BS2A 4QNIA 2RN4A 3KQ0A 4NNSA 1IKEA 1EIOA 4YDBA 4N7DA 1I06A 5KHPA 1LICA 1ACDA 2CBSA 3HTYA 1TVQA 1JIWI 5B29A 1A57A 4YFQA 5AJCA 1ALBA 1GKAB 4NYRA 3GAQA 5CYBA 4I0UA 3WJGA 1HBPA 4AYHA 1YWDA 5LJKA 1QFTA 4FGIB 2W2AA 4CSBA 3VE2A 1JYDA 2Q2MA 4MIRA 4EEJA 5HA1A 3OE3A 4ALOA 2GTFX 4TLJA 2OFRX 2KTSA 4IBAA 5F58A 5HTDA 1YUPA 1PMPA 2FR2A 3DSZA 2HNXA 3WJDA 2RA6A 3VG6A 2MO5A 1IFBA 1LF7A 4ID2A 5HAEA 1G5WA 3P6EA 3S5VA 5IO5A 2HN1A 3MVFA 3C77X 2HZRA 4AZNA 3N91A 1S44A 2RQ0A 1EIIA 1BBPA 4ZGFA 4FBOA 3NX1A 2NNDA 2A2UA 1ICMA 4XMGA 3VE1A 1BRQA 3PPTA 2GTLN 4FBRA 1NP1A 2LBAA 2LB6A 4OMXA 1GT1A 4YDAA 4ORSA 1LFOA 3BX8A 5AQ6A 5H9AA 4QGXA 3TGAA 1CBSA 1ML7A 3FA9A 3HK1A 1E5PA 2X46A 3PEDA 2L5PA 4I3BA 4N7CA 5FQ7E 5L8NA 3B2IA 4U8UN 4O3WA 4I95A 4AZRA 1KXOA 3FEKA 4EV6A 1LIFA 4TJZA 2WWPA 1AQBA 3C78X 3ZW2A 4A1HA 5LJDA 1GKAA 4ZHGA 3P24A 4HFOA 4Y0PA 1IIUA 1CBIA 4RUNA 3I17A 1KQXA 1QWDA 1KQWA 4D6BA 2ALLX 1SXWA 2HLVA 4NP1A 1I4UA 1ADLA 5FQ6E 1YIVA 1XKIA 2KTDA 2Z4IA 1BRPA 1ZNHA 4ORRA 2JU3A 2RD7C 4PSQA 4GKCA 1QFVA 3FA6A 1X8OA 4O4UA 2FR3A 2GTLM 1ZRYA 4DQ3A 4ZHHA 4U3QA 3WJBA 2JU8A 4YH0A 2WQAE 5LJBA 2A0AA 5EZ2A 3D4RA 2LKKA 1ZNDA 4U8UM 1Y9LA 4GNWA 1TW4A 4Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0U A;  3NVO A;  3JCF A;  2HN2 A;  2HN1 A;  3RKG A;  2IUB A;  4EED A;  4EV6 A;  4EEB A;  3NWI A;  2BBJ A;  4EGW A;  5JTG A;  3CK6 A;  2BBH A; 
#chains in the Genus database with same CATH topology
 4QQ1 A;  3SRZ A;  3JAF A;  5J1G A;  1J5E T;  4ZJ0 A;  3OD9 A;  2VWA A;  1CBQ A;  2W2B A;  2OF9 A;  5AQJ B;  1VYO A;  1HCI A;  5HEH A;  3DTQ A;  2RTO B;  5LBM A;  1W0A A;  3C64 A;  1LKE A;  4JGL A;  3NBX X;  4UU3 A;  3KBU A;  5AQF B;  2QGS A;  4MVK A;  4GDA A;  5LMN T;  4PW8 A;  1HMS A;  2C4I A;  1YQ3 A;  2E5V A;  4EXZ A;  3BQK A;  2NNE A;  2KT9 A;  4O49 A;  2POA A;  3ETV A;  2UXD T;  1YXR A;  2WR6 A;  4X1I E;  3B2K A;  2UUB T;  1D0X A;  4O3Y A;  3AUM O;  4CDD A;  3HKD E;  5HXR A;  1XNQ T;  2Q4N A;  4GK0 E;  2WEW A;  3ZCI A;  1KOI A;  1RXH A;  2C1Q A;  5AQH B;  2AL0 X;  4X65 T;  4MLK A;  2EHO B;  3UTK A;  2VDF A;  1P6P A;  3LK3 B;  2YDS A;  3KFF A;  1SWT A;  4JNJ A;  3PUG A;  4X1K E;  3KVA A;  1VWM B;  2BVL A;  3ONX A;  3FYF A;  1GXA A;  3FR5 A;  4ALB A;  2GK9 A;  1NEN A;  2K23 A;  4AIS A;  1VWE B;  2V7L A;  4O2B E;  3HWG A;  3Q9D A;  4U7I A;  5FXV A;  5H9N A;  4EQA C;  1CRB A;  1O3X A;  3ONL C;  3RBY A;  2PI3 O;  2L3L A;  4BA9 A;  3H3I A;  2JMK A;  4PAG A;  3S26 A;  2XKL A;  1IJ5 A;  1DZJ A;  3TZS A;  1WR6 A;  3VRB A;  3PJA J;  1BWY A;  2Q9Q D;  1MMA A;  2JGS A;  2EHO C;  1KT6 A;  1KT5 A;  3ELX A;  1MM9 A;  1LNM A;  4JUY A;  3W15 B;  3PUW F;  2AH7 X;  4HGA A;  1RBP A;  4I43 B;  1UCU A;  3CKG A;  1YWC A;  3CMP A;  4PJ2 A;  3WVM A;  2HPL A;  2QYW A;  3P6H A;  2YG2 A;  3Q6L A;  4P09 A;  1N36 T;  3STN A;  2IAK A;  3CK6 A;  5B2A O;  4TV8 E;  4NW4 A;  3CWZ B;  5FKY A;  4ZHC A;  1SUM B;  3ZUI A;  4KHP T;  1KFY A;  5B5F A;  1T8V A;  4QGV A;  4CPH B;  2KSR A;  3UU8 A;  2BG9 A;  3CR6 A;  2W0G A;  5LG3 A;  3AVR A;  2RTB B;  4L3R A;  2L9C A;  1LRZ A;  2W67 A;  3L09 A;  3APU A;  5H6R B;  1JJU A;  2SPC A;  3L3P A;  5FVL A;  3D96 A;  2A72 A;  4LKP A;  3VHI A;  1JMZ A;  2ANS A;  2M67 A;  2DM5 A;  4U3C A;  2CHN A;  2AT8 X;  3OYX A;  2ASN X;  3HKB E;  1SWQ A;  4I9S A;  3QKG A;  4GDZ A;  1ZKE A;  1YKE B;  4ZXL A;  4UIG A;  4ARH A;  4ML7 B;  2FBW A;  2KT4 B;  2H7V C;  3Q5D A;  1BSQ A;  4XMH A;  1W5R A;  2CBJ A;  2RA1 A;  3R84 B;  3JQO A;  1Y9T A;  2VL0 A;  1T72 A;  2RCQ A;  4CDF A;  4BX6 A;  5AQM B;  2JPF A;  1X8N A;  2BC3 A;  3OBV E;  2KLQ A;  4A8Z A;  2WWV A;  4GIW A;  2H3R A;  2G8C O;  2QO4 A;  3EBW A;  1PEE A;  4NYQ A;  1AVG I;  1E02 A;  2WQ9 A;  3LK2 B;  3ZW0 A;  5HTE A;  4KMC A;  1T7S A;  1ZEE A;  3ZYM A;  3HKE E;  4H9N C;  3K3O A;  3GE2 A;  4QAE A;  4TWD A;  1YQ4 A;  3FHN A;  2DWG A;  5L3B B;  1SY0 A;  1ZHC A;  2XQ8 A;  3T1Y T;  2WEX A;  3VG7 A;  2Z4H A;  1M62 A;  2NR4 A;  1KNP A;  1RLB E;  3NQ3 A;  1OPB A;  5DQV A;  4MVE A;  1SA0 E;  4YJ3 E;  1KT7 A;  1LID A;  2PTF A;  4Z90 A;  3ZMZ B;  1JQP A;  2WUT A;  4AIU A;  2P8G A;  5AQR B;  5L47 A;  4HPA A;  2AMM X;  4GK5 E;  1R0U A;  3BK9 A;  3FR4 A;  1SWE A;  3WOV A;  1SWB A;  4KC7 A;  4OFZ A;  2CA5 A;  3RY2 A;  2IDO B;  4CN1 A;  1KFF A;  4LFC T;  4K0K T;  1X79 A;  1BEB A;  2XQ4 A;  2C5I T;  2RTP B;  4ZH9 A;  3MBT A;  1SXY A;  2ACP X;  4U46 A;  3GN5 B;  2QM9 A;  3RGL A;  2V5C A;  1WUB A;  1OBP A;  4UVC B;  5AQQ B;  4DV0 T;  1W6F A;  2RTQ B;  1Y01 A;  2DJF A;  1AB0 A;  2IZK A;  3O4X E;  5H9L A;  4ILC A;  3GA8 A;  3AE8 A;  1VRB A;  1I04 A;  4WBN E;  2CXD A;  4PJM A;  5IRW A;  4J2C A;  1Y52 X;  2R73 A;  4GGT A;  4M6S A;  5ETW A;  4KT5 A;  1QQS A;  5HCC C;  1U5P A;  5L3E B;  3MKD A;  1SWC A;  2IIU A;  2LOS A;  3CQN A;  3QQ2 A;  1EUO A;  4BOE A;  3AEE A;  2A2F X;  3AAA B;  1GT5 A;  1HNW T;  2XZE A;  2WU2 A;  5EED A;  2DLR A;  3KBT A;  1HX1 B;  1IKJ A;  2Q39 A;  3RE5 A;  1WR0 A;  3A8Y C;  5LNK A;  4IDQ A;  5AQP B;  2CRB A;  3KV6 A;  1PM1 X;  3RF1 A;  3P6F A;  2LSY A;  2XQ9 A;  4TKH A;  5HCE C;  2XHE B;  2Y6X A;  4A5X A;  2ZM8 A;  2E8I A;  3HKC E;  1SRH A;  3APX A;  1MX8 A;  4ZZB A;  4YTN A;  4H9S E;  3EVY A;  1U0X A;  5HXS A;  1HNX T;  3RQW A;  4CQI A;  5D45 A;  3FEN A;  4JI3 T;  4YSZ A;  2IML A;  4BX5 B;  4DQ4 A;  4JI0 T;  1SWA A;  4A56 A;  5K06 A;  1X8Q A;  3FW5 A;  1XDP A;  3UUL A;  2XQ5 A;  4UF0 A;  3N9L A;  3QC9 A;  3PK2 A;  1SLD B;  3QUJ A;  3F31 A;  1EW3 A;  4HE8 A;  3LBX A;  5ADX L;  1LCV A;  4L1N A;  2V7K A;  3PUZ F;  4QXH B;  2WY2 A;  5HWZ A;  2VL8 A;  4YLH A;  3P6G A;  2G5L A;  2CEA A;  3AE5 A;  4YMY A;  1JJJ A;  4ILU A;  1GM6 A;  2LKG A;  1HFA A;  3N9N A;  4TKB A;  3CKD A;  2K62 A;  5DQW A;  3LJC A;  2VFB A;  4QNI A;  3KQ0 A;  1G73 A;  4NNS A;  4IRE A;  3Q5W A;  3V5U A;  4YDB A;  3KVN A;  1I06 A;  4N7D A;  1ACD A;  5AQL B;  2CBS A;  1TVQ A;  1JIW I;  4YFQ A;  2LSI A;  4FI5 A;  2IC9 A;  2IZF B;  3B57 A;  5FVK A;  3GAQ A;  3IF8 B;  5IUX A;  4I0U A;  2UXB T;  5LJK A;  2X51 A;  4CSB A;  1JYD A;  1OWA A;  2OFR X;  3AE4 A;  4DR3 T;  3UUN A;  1PMP A;  3WZO A;  2HNX A;  2XAF B;  2LHN A;  2LT3 A;  4EOZ B;  3C77 X;  5ABH A;  2HZR A;  4AZN A;  5ABF A;  4KUM B;  2RQ0 A;  3RDX A;  1EII A;  2FJB A;  2NND A;  5FP3 A;  2A2U A;  4GD9 A;  4Z2P A;  2ZSC A;  3AEF A;  5EZY E;  2LBA A;  4OMX A;  5F8P A;  1T8B A;  2VVS A;  3K3Q C;  5H9A A;  2C1S A;  5JDF A;  3RE6 A;  4AQF A;  3IEE A;  3FA9 A;  5AQN B;  1E2A A;  1BR1 A;  1E5P A;  5HYA A;  4ZI2 C;  1KXO A;  2XSB A;  2FGS A;  3ZW2 A;  2W61 A;  2NW9 A;  4JLE A;  2X68 A;  4ZHG A;  5EK2 A;  4Y0P A;  4UXN B;  4AKI A;  4RUN A;  4O4I E;  4O4H E;  2WWU A;  5FXX A;  1XWM A;  4D6B A;  4JI7 T;  5JRC A;  4LFB T;  4OYK A;  1AJ3 A;  1LKX A;  3SFE A;  1XKI A;  4U7Y A;  2RTG B;  1BRP A;  3A7M A;  4BJ8 A;  5F2B A;  1HX8 A;  1X8O A;  2FJD A;  2FR3 A;  4PJL A;  1J1J A;  4AQY T;  4AKR B;  5LGU B;  3C50 A;  2KND A;  5LA6 E;  4JI5 T;  3X1D A;  4TWF A;  2WDR A;  3N2K E;  4EKV A;  2R56 A;  1U17 A;  2BS5 A;  2ZM0 A;  2IZH B;  3ZMV B;  2C5K T;  3EDV A;  2LFO A;  2VKJ A;  4WFU A;  4U2Z A;  3RZY A;  2FJA A;  2RPA A;  1VCT A;  4YBP A;  1EQD A;  1OXZ A;  4ORY A;  4MHC A;  2FT9 A;  4I60 A;  4XBF B;  2CM0 A;  4NXM T;  4TNW A;  5LKE A;  3FA8 A;  3D95 A;  2IZJ A;  3E3C A;  3ZT7 A;  3AKM A;  2BT9 A;  3PUX F;  2RTH B;  1UX4 A;  2CCQ A;  2LM2 A;  5HZQ A;  2AE9 A;  1SWJ A;  2CM4 A;  3WJE A;  3AE1 A;  2N9D A;  5LP6 E;  1NQM A;  2JW1 A;  3MM0 A;  5AJB A;  4IDN A;  1YP7 A;  4DUY T;  4JI8 T;  3FID A;  3JAD A;  5H8T A;  4TNN A;  3RYH E;  5FXZ A;  4JBW F;  2X8F A;  4C90 A;  4IE4 A;  1BR0 A;  3KFH A;  3OJY C;  4OS0 A;  4HFE A;  3ANW A;  2XUE A;  5L2L A;  5L8O A;  1SWK A;  2BS2 A;  1OEE A;  2K48 A;  3SZJ A;  4ZOL E;  3MK7 C;  2HH7 A;  2ODU A;  2PJQ A;  4ES7 A;  2UXN B;  1MMG A;  3B2J A;  4U8U O;  4MBQ A;  1TXL A;  2A8G A;  4O3X B;  4DBQ A;  3CBS A;  4HPC A;  1YP6 A;  1J5W A;  3CX8 B;  1US7 B;  4LF7 T;  4BCS A;  3F8A A;  2PFV A;  1N33 T;  4IDZ A;  4Z8X A;  2Y3F A;  1FDQ A;  2AT3 X;  1D1B A;  1QY2 A;  5FNV E;  2WDQ A;  3RH3 A;  1EPA A;  3BY0 A;  5KX5 E;  1ZV4 X;  2RTA A;  3AE3 A;  3UEV A;  1JBH A;  2PY1 A;  2EHO A;  3CKF A;  5B10 O;  2N1G A;  3UUB A;  1VWJ B;  3IA8 A;  2RTR B;  3E0Z A;  2G79 A;  3PU3 A;  1IBL T;  3P4Q A;  1RAV A;  5DPQ A;  2LEH A;  4LF9 T;  3AKN A;  2CLY B;  5JDM A;  4O4X A;  1XMO T;  1MNE A;  2VUR A;  5JDL A;  5JDN A;  1KNR A;  2QRX A;  3FZL B;  3BU9 A;  4I6S A;  1HF8 A;  4CXW A;  1I78 A;  2YIN A;  2VQE T;  3NR3 A;  2YU1 A;  4GET A;  1L6M A;  4UEL A;  4LQZ A;  4JV5 T;  3IFB A;  2FJE A;  2C5J A;  4HWC A;  3ZQ3 A;  2JRK A;  2W00 A;  4B3S T;  3PP6 A;  5IO7 A;  3VHL A;  4XMC A;  1UYN X;  4ZI3 D;  5LYJ E;  2X8T A;  1HG5 A;  4KHZ F;  2MBG A;  4ZS2 A;  2X9H A;  1VWR B;  2LBV A;  1SA8 A;  3RY1 A;  3C76 X;  2WBL A;  3T1D A;  1W4T A;  1K3B A;  4TX5 A;  4EFG A;  4ILB A;  3SOL A;  1X8P A;  3FA7 A;  1RST B;  1SRJ A;  5E0O A;  5KMG P;  5AQK B;  2XQ3 A;  4BQU A;  3FEP A;  3VG4 A;  1W0B A;  2CLY C;  5JR9 A;  3UEW A;  3UUM A;  2KZ7 B;  1LEL A;  3WJF A;  3NQ9 A;  3Q34 A;  2V6X A;  2IZA A;  2XSA A;  4CXX A;  2N2N A;  3OTO T;  2F01 A;  1MVG A;  2GJ5 A;  1KL5 A;  4CPH A;  2ZMA A;  2YMS A;  1VWC B;  4I3C A;  2OYB O;  1WRD A;  3VHH A;  5IXG A;  2FLJ A;  2MWH A;  3VG3 A;  2LSK A;  1BM5 A;  4YGZ A;  1HQP A;  1URE A;  2KW1 A;  2NW8 A;  1NEK A;  4YKO A;  3HWF A;  5GON E;  1RSU B;  1MIW A;  1AEL A;  4WHI A;  1DV9 A;  1NWM X;  4WFV A;  4ZGU A;  3I0O A;  3KFW X;  2E9X D;  4EGW A;  2FHN X;  2NNQ A;  2WU5 A;  4L9I A;  4GE1 A;  4RUU A;  5FEN A;  3STK A;  4GK9 A;  2OL6 O;  2RTJ A;  3LG7 A;  1KF6 A;  3ETU A;  3EW1 A;  3NZQ A;  2V26 A;  3PU8 A;  4AI6 A;  2CWO A;  2YDQ A;  4YHJ A;  2NW7 A;  1B56 A;  1MX7 A;  3UAQ A;  4PJJ A;  2VAS A;  1UUS A;  2XPK A;  2I6H A;  4HN9 A;  2X56 A;  1S7D A;  4AKG A;  4YCE A;  3TF6 A;  3V8U A;  4ZI3 C;  4OMW A;  2LRL A;  3PQS A;  2FWV A;  5CHK A;  1EI5 A;  3I1A A;  3AEB A;  5LOV E;  1VWL B;  3AVS A;  4DV7 T;  3A5X A;  2G0U A;  4DID B;  5IO6 A;  2E9X B;  1SRI A;  4G63 A;  1W9R A;  4KH8 A;  2BBJ A;  2KWH A;  2X45 A;  2MAW A;  3S5X A;  1B0O A;  2X4M A;  4OKA A;  2CHO A;  1WYB A;  4PK6 A;  5LJG A;  4FBV A;  3TGC A;  2L9Q A;  4U72 A;  4ILA A;  2FHL A;  3JCF A;  3WI3 A;  3FLL A;  5FAZ A;  2Q9Q B;  4YBU A;  1BR2 A;  1NAF A;  4Z28 A;  2JQQ A;  3K8P C;  2LJL A;  2JMH A;  1VWH B;  5LHI B;  1T68 X;  2HYS A;  4Z91 A;  4YJ2 E;  1ZNL A;  3RLF F;  4F8H A;  3HWE A;  3GN5 A;  4NV8 A;  4O9S A;  4P1N A;  2WAU A;  4LF5 T;  2LHR A;  3UEU A;  4P0B A;  1G7N A;  2J4G A;  1AVE A;  2CMR A;  3G06 A;  1K24 A;  1E1H B;  2RCT A;  1JZU A;  3STM X;  2FRS A;  3RIF A;  2K5B B;  4A60 A;  2E9X C;  4TWH A;  2BZB A;  4EYY R;  3O1J A;  1R8I A;  3PDF A;  3WAJ A;  3ABV A;  4O4L E;  3P4R A;  3ZT6 A;  5BVQ A;  1WCR A;  4ZS3 A;  3OJA A;  1SHZ C;  4DR6 T;  2MM3 A;  3E22 E;  1LDO A;  2NP9 A;  2FS7 A;  3PEC A;  1PTS A;  3S4U A;  3AXJ B;  2RTC B;  3PUY F;  5CSE A;  2Q9Q C;  1VYF A;  4H63 H;  3OBL A;  1PBO A;  3S60 A;  2L67 A;  3WXQ A;  1Y64 B;  2V8S V;  5L3F B;  4LFA T;  2OY1 O;  5JDG A;  2M6B A;  3VR9 A;  3FR2 A;  2X9W A;  4YFS A;  3IBP A;  1LUQ A;  5LHH B;  2IC6 A;  4O4J E;  1X71 A;  4FQB B;  3B2L A;  4YVB A;  2LLY A;  2A3F X;  5F6Z A;  3BS2 A;  4TUY E;  3LTW A;  4X66 T;  1S35 A;  5KHP A;  4IE5 A;  5B29 A;  1A57 A;  4DNE A;  5CYB A;  3RDM A;  4GUZ A;  1QFT A;  2MOZ A;  2W2A A;  3VE2 A;  4EEJ A;  3PJA A;  3OE3 A;  4BX5 A;  4DUZ T;  4IBA A;  3PUQ A;  2OFA A;  4G2A A;  1WBI A;  3N9M A;  3D0T A;  2MO5 A;  4ID2 A;  5HAE A;  1G5W A;  3P6E A;  3S5V A;  5IO5 A;  2HN1 A;  3MVF A;  3N91 A;  1S44 A;  4FBO A;  3NX1 A;  3ZT5 A;  3PUV F;  4XMG A;  3SLJ A;  3PPT A;  3KV9 A;  1B7T A;  1HG2 A;  3RDU A;  1NP1 A;  2LB6 A;  2WS3 A;  4GJV A;  4YDA A;  3SFD A;  1LFO A;  3BX8 A;  3TGA A;  1CBS A;  1ML7 A;  2UUC T;  4QH1 A;  4YTP A;  2L5P A;  5L8N A;  4N7C A;  2HHH T;  2R6G F;  5J2U E;  5FL1 A;  4O3W A;  4EV6 A;  3FXD B;  4L5G A;  4B55 A;  2WWP A;  2YN6 A;  3MXZ A;  1I9H A;  2E2A A;  4U2Y A;  4DVD A;  4EB6 E;  2KWI B;  1D0Y A;  5F3J A;  3I17 A;  1QWD A;  3QB5 A;  2WMN A;  1YIV A;  2CXL A;  3MG5 A;  3ZSS A;  2Y3E A;  1ZNH A;  4GKC A;  5CA1 E;  2WQY A;  5AQT B;  5BMV E;  4O4U A;  5LGN B;  2A5C A;  1N7Y A;  4DQ3 A;  4ZHH A;  4ZEY A;  3ZC1 A;  1UYO X;  2WQA E;  2A0A A;  4HWH A;  4IST A;  3CML A;  2LKK A;  2JQK A;  1TW4 A;  4Y0S A;  2ZAG A;  1QLB A;  5FY7 A;  4GJS A;  4AZQ A;  3NRY A;  1JNZ A;  3CQG B;  2P9B A;  2XQ7 A;  5EK4 A;  2QCB A;  1ICN A;  3T6L A;  2RTI B;  2ZM2 A;  2X55 A;  3O19 A;  3OKQ A;  5FMN A;  5FXW A;  1VWP B;  3FBZ A;  3RHW A;  4HWM A;  3VU7 H;  5JRE A;  4WBK A;  4CK4 A;  3RIU C;  2YOE A;  4JI1 T;  3CX7 B;  5EEE A;  2LRK A;  1SMP I;  5HCM A;  2DI4 A;  1EXS A;  4X62 T;  4HFV A;  1UGO A;  4UU2 A;  4KBM B;  4O2A E;  1G8X A;  1UX5 A;  1SWP A;  2D0U A;  3EHZ A;  1HQQ A;  2E4J A;  3WJC A;  1KEY A;  3ZJ2 A;  4UEM A;  3UFE A;  3WYQ A;  5FY0 A;  1VWD B;  3T2W A;  4ZHD A;  4CN6 A;  4U74 A;  5H6Q B;  3VR8 A;  5HBS A;  3KZA A;  4DO0 A;  3KV5 A;  4GGR A;  4CV7 A;  3FB2 A;  3P4P A;  2ES0 A;  1UZ2 X;  2RTD B;  2WCA A;  2JN3 A;  2CPT A;  4I9R A;  1DZK A;  1SY3 A;  4CPF A;  1LVK A;  4ZI7 E;  1UK5 A;  2JU7 A;  4GOU A;  4Y59 A;  5HZ6 A;  4YFR A;  4X64 T;  4MVI A;  1GX9 A;  1SLE B;  4MIS A;  1PBY A;  1CBR A;  3GWH A;  3CVR A;  2OVA A;  2N93 A;  1YW0 A;  3C51 A;  5F1E A;  2QMI A;  2OV9 A;  4Z27 A;  4B3T T;  2V7I A;  3ONJ A;  1SXX A;  4EAH A;  1E2T A;  3KVB A;  3MX7 A;  5AQG B;  4EIW A;  4QH4 A;  2HPJ A;  1DF8 A;  3VG2 A;  1E00 A;  2OFB A;  2X9X A;  3AE9 A;  3UU6 A;  2RTM A;  4IB8 A;  4LMJ A;  2Q2P A;  2D2S A;  3FZH B;  2V6Y B;  3AAE B;  4DR5 T;  2W4X A;  4KII A;  2OLT A;  3K1S A;  1U4Q A;  4L0R A;  3VKG A;  1SWD A;  4DV5 T;  4COT A;  1D1C A;  4XMF A;  4GU8 A;  3U0D A;  2D5U A;  4WYV A;  2D0T A;  4M7M A;  2VKD A;  1VWO B;  3K3L A;  3FIQ A;  1G85 A;  1SWO A;  2VKO A;  5J0Z A;  1WLX A;  2OVS A;  5BYP A;  2X67 A;  1IJ8 A;  3C4Z A;  3O2Y A;  3ZMU B;  5L3Y A;  1M7K A;  3QK6 A;  4YHH T;  4Y0Q A;  1FEL A;  2F09 A;  3LSV A;  5HCD C;  5AQI B;  3LV4 A;  1Z0P A;  2LE8 A;  5FQ8 E;  2CAM A;  5B27 A;  3PTR B;  4NPP A;  2OY5 O;  5JR8 A;  3UQ4 A;  3FBL A;  4JHQ A;  4NIQ A;  4TZ4 C;  3KFI A;  1V9D A;  3C98 B;  2WZH A;  4OHF A;  4ANJ A;  1HR0 T;  1G74 A;  2JMB A;  2RTF B;  2YEV C;  1N34 T;  1ZOY A;  2ACO A;  2AXD S;  3V5S A;  1X89 A;  3AEG A;  3SS1 A;  2C0S A;  4N78 D;  4QXC B;  2OVD A;  5F6B A;  4NLI A;  4IL4 A;  3BQL A;  5AEO A;  2AT0 X;  2XAG B;  1FE3 A;  1OEJ A;  1SXU A;  3JS1 A;  2L68 A;  2XM1 A;  2I0M A;  4YY3 T;  1HXL A;  3WZQ A;  3NZP A;  3U03 A;  3SZI A;  2F73 A;  1OEK A;  1I05 A;  2K24 A;  2WSS V;  2X34 A;  5LJM A;  1NQN A;  4QGW A;  1YD8 G;  4DCB A;  3ZW1 B;  3EYC A;  3QOF A;  1E06 A;  2KIN B;  2W2F A;  3JSQ A;  5B5G A;  4LZV A;  2YK0 A;  4JI6 T;  4BX7 B;  1QY0 A;  1MOY A;  1O1U A;  5BR8 T;  2BHV A;  1IW2 A;  3VHM A;  3TLW A;  4YSX A;  1HXZ A;  4LKT A;  4TNV A;  3SZH A;  2WPU A;  4P0A A;  5J2T E;  4HFB A;  4WW0 A;  1O8V A;  1VYG A;  3VU1 A;  2GTL O;  4HFI A;  3P4W A;  1N9M A;  4NXN T;  3SWH A;  2QOS C;  3H3M A;  5JVD E;  4AZP A;  4MFR A;  2BVM A;  3UT5 E;  1ERX A;  4C5P A;  4QZT A;  2IZC B;  4EDE A;  2I5Z O;  2DHR A;  2FUP A;  3NAD A;  2CM9 A;  5KID A;  4GKJ T;  2R74 A;  5LJE A;  4DR7 T;  2FKJ A;  2NTX A;  4ZZC A;  5EPQ A;  2CZU A;  1MDC A;  4ASK A;  4K0U A;  5JH7 E;  4ZHF A;  1VWG B;  2OY7 A;  2CE7 A;  3KFG A;  5LXT E;  2QO5 A;  3UU4 A;  1H91 A;  4KP3 C;  2OY8 A;  5JRC B;  5HEJ A;  2LA7 A;  4WNK A;  3VG5 A;  4ORU A;  5KIC A;  3CQC B;  5BVS A;  4IE7 A;  3LK4 2;  3EC5 A;  4DBR A;  2UXX B;  2IZE B;  4CI3 B;  1E7P A;  2OVE A;  1LCW A;  4XME A;  4GGZ A;  2IUB A;  4QRL A;  3KDS E;  3FW4 A;  4OX9 T;  4ORW A;  1OED B;  3P4S A;  5LB7 B;  1SWU A;  2XJ7 A;  3PH5 A;  4XAX B;  5DG4 A;  2Y48 B;  3HR0 A;  3D97 A;  3WZP A;  4OEL A;  2G78 A;  1HS7 A;  3P6D A;  1HMT A;  2VVN A;  2RTL A;  2QO6 A;  2BS4 A;  3RRW A;  1SWL A;  2ACX A;  2V5D A;  3EBK A;  4I55 E;  4NUV A;  5IYZ E;  1FEW A;  4DV2 T;  1LIE A;  3EDU A;  5FL0 A;  3ZUO A;  1VWK B;  1KZX A;  3IHR A;  3F6Z B;  2HMB A;  5LCY A;  2HN2 A;  4HFD A;  4LF6 T;  1XNR T;  2JOZ A;  4EEB A;  1T98 A;  4COF A;  2AVI A;  2UXC T;  3AEH A;  4GRJ A;  4Q25 A;  4GNY A;  3RKG A;  1IAP A;  4FJO A;  3UQ7 A;  1TOU A;  5CE4 A;  1O1V A;  3ZST A;  4PFP A;  2WM9 A;  1YWB A;  1OED C;  3AA1 B;  2CXF A;  4OEM A;  5LJC A;  3EAB A;  1B4M A;  4OYJ A;  1DZP A;  1HMR A;  1SY2 A;  3N5L A;  2EHO D;  3EMM A;  1BLR A;  1QY1 A;  3LHN A;  2X32 A;  1HNZ T;  3FDC A;  2E9X A;  2LSG A;  4CI2 B;  1N0S A;  1N43 A;  5KXJ A;  2JQH A;  1XDO A;  4LML A;  4XZC A;  5HEU A;  2EU7 X;  3CQR A;  2IZG B;  5EDC A;  2IZI A;  4BJN A;  1RXK A;  1VCS A;  4PFO A;  4HWD A;  4IAX A;  1VOM A;  5JQG E;  4F6R C;  1GX8 A;  5D48 A;  4I4T E;  3MAC A;  4GZV A;  1KT3 A;  1CJ5 A;  2WZI A;  2Q9Q A;  2UUA T;  1FEN A;  2WSJ A;  3HOL A;  5C3J A;  4UVA B;  5HWX A;  1FMV A;  2NWB A;  3DP7 A;  4U31 A;  3O1I A;  4R0B A;  2W66 A;  4EZ4 A;  1MK5 A;  2Q9S A;  2DCF A;  3UUX B;  3M3Z B;  1B8E A;  3MZK B;  4ADZ A;  3FZF B;  1Y55 X;  5HA0 A;  2RN4 A;  2Z6E A;  3B5M A;  4PNI A;  1IKE A;  1EIO A;  3I9W A;  4QH5 A;  2WB5 A;  5HXE A;  2IZL B;  4GKK T;  4PK5 A;  1SWN A;  5AJC A;  1ALB A;  1GKA B;  2WP9 A;  4NYR A;  4UV9 B;  3PE0 A;  3WJG A;  4AYH A;  1YWD A;  1MIV A;  4LF8 T;  2YU2 A;  2ZLY A;  3L8R A;  5HA1 A;  2GTF X;  4TLJ A;  4NUU A;  5L3C B;  2KTS A;  1Z8U A;  3ZPO A;  4IT4 A;  5HEG A;  5LHG B;  5F58 A;  1YUP A;  5HTD A;  2FR2 A;  3DSZ A;  4DMV A;  3WJD A;  4YSY A;  3RDO A;  3AXJ A;  5FYM A;  3J7Y q;  2OF8 A;  3H3A A;  5AQO B;  1BBP A;  2LKH A;  3RDS A;  4ZGF A;  3PUS A;  4YTM A;  1ICM A;  4Z6J A;  4WBO A;  1XMQ T;  3VE1 A;  4YT0 A;  1H7C A;  3CX6 B;  5AFU L;  4QX8 B;  2GTL N;  2PG8 A;  3L39 A;  4B3R T;  3N9P A;  4DV6 T;  1GT1 A;  2H89 A;  2PBI A;  3T8O A;  4QGX A;  3I0Q A;  3C4W A;  5CA0 E;  4I3B A;  4QXB B;  3OYZ A;  1RXJ A;  2CWY A;  3ZYL A;  4TV9 E;  1OED E;  1I6Z A;  4U8U N;  3ZCJ A;  4AZR A;  3GMI A;  4BAY B;  1LVF A;  5L3D B;  4BGF A;  3CIR A;  3Q5E A;  3C78 X;  1VWA B;  5L4E A;  1LCZ A;  4M1P A;  2XAS B;  1VWB B;  4DND A;  3RPU A;  5JR9 B;  2HKD A;  2OA5 A;  2XTL A;  2ALL X;  2VB6 A;  2HLV A;  2IW5 B;  1ADL A;  4X1Y E;  2OL8 O;  5FQ6 E;  1FJ1 E;  2KTD A;  5ABG A;  2Z4I A;  2JU3 A;  4PSQ A;  2XQY A;  1SLF B;  3B13 A;  4EZH A;  2GTL M;  2J1D G;  2BS3 A;  1SRE A;  3O1H A;  3SLO A;  2W63 A;  4GYS A;  3ZC0 A;  4C91 A;  3P50 A;  4LMK A;  2JU8 A;  4YH0 A;  5HWY A;  5LJB A;  1W09 A;  5EZ2 A;  3ESL A;  1ZND A;  4U8U M;  2J47 A;  4A97 A;  1SWS A;  1Y9L A;  5TAO A;  3JAE A;  2YDR A;  1AVD A;  5AQV B;  1T0V A;  2LSJ A;  1STR B;  3I0A A;  1U18 A;  4I3D A;  2A3D A;  1SWR A;  5ABE A;  2IFB A;  3APV A;  5HAX A;  1NP4 A;  3AA7 B;  2I59 A;  2KXP B;  3RDQ A;  4CDE A;  1ZP0 A;  5JR9 C;  1YWA A;  2VK9 A;  2AT6 X;  4QYP A;  5F7G A;  3EAM A;  3ZYK A;  2MHD A;  4GH7 A;  3JC6 D;  3U9P C;  3RIU A;  3O9X A;  4BBO A;  5D47 A;  3BU1 A;  3F2E A;  2XAJ B;  3ZKR A;  2CBR A;  2IZD B;  1S94 A;  3TKL B;  4U9C A;  2XST A;  2RP4 A;  4CN4 A;  3BLG A;  3WBG A;  5LG4 A;  4CZZ B;  3MJX A;  4JEU B;  4NNT A;  1SRG A;  3P02 A;  1DF3 A;  5JTG A;  2A5B A;  4ZCB A;  5JDQ A;  3O22 A;  4IL9 A;  2MYS A;  4JI4 T;  3RYF E;  4HEA A;  1A18 A;  5JD2 A;  2A2G A;  4IMN A;  5FFH A;  4BVM A;  1IBM T;  1D0Z A;  3ELZ A;  4A1Y A;  1FMW A;  1HY2 A;  1GT3 A;  2QA7 A;  1SWG A;  3AA6 B;  4EED A;  5LJN A;  2GH7 A;  4Z2O A;  4ODD A;  4HFC A;  3FEL A;  2BG9 B;  2NOX A;  2ZAI A;  2H7O A;  4OS3 A;  3ZLI A;  2M6I A;  3AE6 A;  3BQI A;  4E7S A;  2FKG A;  3LFM A;  4U33 A;  3G7X A;  4LF4 T;  1SWH A;  3HOE A;  4NV7 A;  3LDQ B;  4QWN B;  3NRX A;  1JV4 A;  3T1H T;  1KK7 A;  2XAH B;  3OVU A;  5D4A A;  1N4J A;  4O4O A;  4D6A A;  4IB9 A;  2X66 A;  1MMN A;  4ZHQ E;  2DJG A;  2X8S A;  4IB7 A;  5LJH A;  5L4H A;  4HWI B;  5L3G B;  1GQE A;  3NX2 A;  2A9U A;  2H88 A;  3BSZ E;  2KMF A;  3TGB A;  4HFH A;  3RYI E;  3VPJ E;  2GC9 A;  2B1E A;  3D9W A;  4BX6 B;  2BKP A;  4QKN A;  2OL7 A;  1FJG T;  4O4S A;  3C4X A;  2DL1 A;  4IDO A;  4IRW A;  1KGL A;  5CJ5 A;  2FTB A;  4E7Z A;  1EPB A;  2AKQ A;  1DZM A;  2RTK A;  4ZR2 A;  3HA4 A;  2RTN B;  2KD2 A;  3WYP A;  4OS8 A;  2O62 A;  5D8J A;  3UEX A;  3UU3 A;  2BG9 C;  2MTQ A;  4DR4 T;  3JC6 C;  4K19 A;  1IZN B;  1SE7 A;  3TLV A;  3VRA A;  3ZW0 B;  3MA9 A;  5HEO A;  3R6N A;  2YKS A;  2VQF T;  3H37 A;  2JIW A;  2OZQ A;  5HCJ A;  5F5W A;  5C8Y E;  1OSP O;  3RSW A;  2DWK A;  4YXD A;  1MUP A;  5DAB A;  1LIB A;  2X0H A;  4QX7 B;  1LPJ A;  5H9K A;  4QHO A;  1EAL A;  3PUA A;  1DC9 A;  3CQX C;  2W2U A;  1BR4 A;  3N9Q A;  1HTJ F;  3EW2 A;  2V6Y A;  1VWF B;  3RYC E;  4DV1 T;  2F4V T;  4QYN A;  3PDY A;  4EXT A;  1NDJ A;  1OBU A;  4YGG A;  2G7B A;  3F9D A;  2HZQ A;  4MVL A;  2L8K A;  5IRA A;  3RQU A;  3NWI A;  3IA3 A;  5A1L A;  4CI1 B;  2LOP A;  1GX3 A;  2BSZ A;  1BSO A;  4ON1 A;  4YFP A;  3NP1 A;  2XY8 B;  4IMO A;  4ZI2 D;  4UVB B;  1ERB A;  1GGL A;  1FEM A;  2UYW A;  2X9Y A;  3I9Y A;  4IDP A;  4NLJ A;  1UUR A;  4UV8 B;  4HPD A;  3RWX A;  3UFG A;  4YKM A;  2LM9 A;  4AW8 A;  4ZFX A;  3P6C A;  2D9D A;  1JYJ A;  1MMD A;  5LBQ B;  4JEH B;  2NTY A;  4ORX A;  3TLS A;  4MAL A;  4AQG A;  3RC8 A;  3ZN0 B;  2XQ6 A;  4AXP A;  4O8S A;  4PK4 A;  5IWA T;  5IHY A;  1A2D A;  1STP A;  3N9O A;  1GT4 A;  3RRC A;  3ZZV A;  5HZ8 A;  2WDV A;  4XMD A;  1X8U A;  2QOM A;  1TOW A;  2DNX A;  1L0V A;  3P8C D;  1X9B A;  2J62 A;  3CWK A;  2BBH A;  5K68 A;  2NP1 A;  1FTP A;  3PH6 A;  3HWD A;  5LKF A;  2A13 A;  4H9O C;  2OFM X;  4HWF A;  3T6F A;  1NC9 A;  2BG9 E;  4HPB A;  1Z24 A;  1S2P A;  1OPA A;  3RI5 A;  3ZW1 A;  2XM2 A;  2VFC A;  1XZY A;  4DR1 T;  4IE6 A;  4KX6 A;  2UU9 T;  4B3M T;  2MJI A;  1KZW A;  3CBC A;  3HL6 A;  3ZMT B;  3B2H A;  1KNZ A;  1JMX A;  3AED A;  3PQU A;  3SLT A;  4BX7 A;  3FMZ A;  4OK0 A;  2BDE A;  1CUN A;  4GYR A;  1ZNK A;  3ZWE A;  4X5T A;  3NQK A;  2V7M A;  1NGL A;  3EM0 A;  2K3W A;  2BKN A;  1XCA A;  2JJ9 A;  2CZT A;  3U3I A;  3KV4 A;  1IBK T;  4JO6 A;  1I94 T;  3VKH A;  3SAO A;  3PUR A;  5EK3 A;  2BLG A;  1HBQ A;  3T2X A;  1N32 T;  4IB6 A;  4AZO A;  2IZB A;  4UF0 B;  2W62 A;  3EI0 A;  3ZMS B;  1IFC A;  1OBQ A;  1Y53 X;  4CPI A;  5HZ9 A;  3N2O A;  1YKH B;  2FS6 A;  5DJQ C;  4WZX A;  3LBX B;  1SRF A;  3L4R A;  2MF6 A;  1ZNG A;  3CPZ A;  2BKO A;  4O3Z A;  2K9A A;  2V1D B;  5LMU T;  4BJM A;  2RTE B;  4IAW A;  1MND A;  4TKJ A;  3FZM B;  3AEA A;  3FZK B;  4QZU A;  2VKH A;  1QUU A;  4IHJ E;  4DV3 T;  3EUH A;  3DJB A;  3E08 A;  4DMW A;  1A3Y A;  1STS B;  5JDH A;  2ACZ A;  5HXC A;  4INN A;  4KCA A;  3NVO A;  4ERR A;  3SOT A;  4H9P C;  3ZEF B;  4YCH A;  5CFB A;  4CDC A;  5BVT A;  1JNR A;  4ZH6 A;  1QG5 A;  5L8I A;  5CGM A;  1OED A;  1BSY A;  5C0N A;  2BS6 A;  1CHU A;  4IGU A;  4HTE A;  5K67 A;  2E5L T;  5AQS B;  1SY1 A;  1D3S A;  5CB4 E;  2WMO A;  3NPO A;  1ZNE A;  3APW A;  5FY1 A;  4TQ2 A;  5EDB A;  1VPR A;  2AT5 X;  1JJX A;  4ISS A;  3TLU A;  3QB5 K;  2XQA A;  4TN7 B;  1HN2 A;  3PV0 F;  4H63 V;  4IIJ E;  3RX6 A;  1BJ7 A;  1KL3 A;  3UU5 A;  3BX7 A;  5ABF B;  4H9R C;  4IAB A;  4KC8 A;  3N2G E;  1D2U A;  4Z2V A;  1QSD A;  2AF5 A;  3ZI8 A;  5AQU B;  4LZU A;  2I5V O;  5B11 O;  1KT4 A;  3J9X 1;  2M4L A;  4Y0R A;  1MIY A;  4X20 E;  4AKL A;  5B3M O;  4AZM A;  3RKO A;  4YGH A;  3BDR A;  1SWF A;  3BRN A;  5HZ5 A;  1QAB E;  3AE7 A;  5C2T A;  1EZ3 A;  2CBI A;  4B6X A;  1LIC A;  1WYC A;  1WFD A;  3HTY A;  1LDQ A;  1VWN B;  3RIA A;  1HBP A;  2Y32 A;  4FGI B;  3OPC A;  2Q2M A;  4MIR A;  4ALO A;  3AAI A;  3RC3 A;  1VWI B;  2RA6 A;  4A98 A;  3VG6 A;  1IFB A;  3DTO A;  3HI2 A;  1LF7 A;  3HPE A;  3AB3 B;  1VWQ B;  4AKH A;  3TLT A;  4KI0 F;  3K3N A;  2MPK A;  5HXH A;  1N9Y A;  3Q2M A;  3F57 A;  4IE0 A;  2JQ9 A;  1BRQ A;  2Y8D A;  4FBR A;  4AQF C;  1D1A A;  2QVA A;  3KIN B;  3WAK A;  3FXE B;  4ORS A;  5AQ6 A;  3AE2 A;  3AEC A;  3HK1 A;  2X46 A;  4PJN A;  3PED A;  4JYA T;  5FQ7 E;  4CPE A;  3B2I A;  3U78 A;  2X0Y A;  4I95 A;  3FEK A;  3AA0 B;  4Y5D A;  3QNU A;  2ZM6 T;  1LIF A;  4DV4 T;  4TJZ A;  3WZN A;  5IRU A;  1AQB A;  4A1H A;  4JI2 T;  3ZN1 B;  4DR2 T;  1NBX A;  5LJD A;  1GKA A;  4CXY A;  3P24 A;  4HFO A;  1IIU A;  3M65 A;  1CBI A;  1KQX A;  5M4Y A;  3ZJ1 A;  1KQW A;  3Q5X A;  3X00 A;  1Y0G A;  2ODV A;  1SXW A;  4NP1 A;  4EYU A;  1I4U A;  4MEE A;  3NKZ A;  2XAQ B;  4V1A v;  3P7I A;  1DU2 A;  4ORR A;  2RD7 C;  1QFV A;  3FA6 A;  4HKA A;  1ZRY A;  1SLG B;  1KL4 A;  4U3Q A;  3WJB A;  1FIO A;  2B76 A;  1IJ6 A;  4H9Q C;  2IHR 1;  4UR9 A;  1MEP A;  3D4R A;  4I50 E;  5LGT B;  2V7J A;  2UZ2 A;  3ANW B;  5KDM C;  4GNW A;  2X0L B;  3VGW A;  1DFV A; 
#chains in the Genus database with same CATH homology
 2ZAG A;  1T0V A;  4QQ1 A;  2R56 A;  1U17 A;  2BS5 A;  3I0A A;  1U18 A;  4AZQ A;  2LFO A;  3RZY A;  4I3D A;  4WFU A;  4ZJ0 A;  3OD9 A;  1ICN A;  1CBQ A;  2IFB A;  2W2B A;  3APV A;  3DTQ A;  1EQD A;  4YBP A;  3O19 A;  1LKE A;  4JGL A;  3NBX X;  4ORY A;  2FT9 A;  4HWM A;  4MVK A;  4UU3 A;  1NP4 A;  1HMS A;  4WBK A;  5LKE A;  4CK4 A;  3FA8 A;  3D95 A;  3E3C A;  3AKM A;  2BT9 A;  1YWA A;  5EEE A;  4EXZ A;  2AT6 X;  4QYP A;  5F7G A;  2NNE A;  1SMP I;  4O49 A;  2MHD A;  2POA A;  4GH7 A;  1EXS A;  3U9P C;  5HZQ A;  2WR6 A;  5D47 A;  3B2K A;  3BU1 A;  2CM4 A;  4UU2 A;  3WJE A;  4O3Y A;  5AJB A;  2JW1 A;  2CBR A;  2Q4N A;  2WEW A;  1YP7 A;  4U9C A;  2E4J A;  2XST A;  3WJC A;  1KOI A;  2AL0 X;  5H8T A;  4TNN A;  3BLG A;  4ZHD A;  3WBG A;  5HBS A;  3KZA A;  1P6P A;  4NNT A;  2X8F A;  3KFF A;  3P02 A;  3KFH A;  1DF3 A;  4CV7 A;  5JTG A;  4ZCB A;  3OJY C;  4OS0 A;  1UZ2 X;  2JN3 A;  3O22 A;  3FYF A;  4I9R A;  1DZK A;  1GXA A;  5L8O A;  3FR5 A;  4ALB A;  1A18 A;  1OEE A;  1SY3 A;  2A2G A;  4IMN A;  5FFH A;  4BVM A;  2JU7 A;  5HZ6 A;  2K23 A;  3ELZ A;  4A1Y A;  4YFR A;  3HWG A;  1GT3 A;  4MVI A;  1GX9 A;  5H9N A;  4EQA C;  4EED A;  4ES7 A;  4MIS A;  3B2J A;  1CBR A;  4ODD A;  4U8U O;  3FEL A;  1TXL A;  1CRB A;  2OVA A;  2N93 A;  3RBY A;  4O3X B;  2ZAI A;  3CBS A;  4HPC A;  1YP6 A;  4OS3 A;  5F1E A;  2QMI A;  3H3I A;  3F8A A;  3G7X A;  3S26 A;  2XKL A;  3HOE A;  1SXX A;  1DZJ A;  3MX7 A;  1FDQ A;  2AT3 X;  3TZS A;  1JV4 A;  1BWY A;  5D4A A;  1QY2 A;  4O4O A;  4D6A A;  4IB9 A;  1E00 A;  3VG2 A;  4IB8 A;  1EPA A;  3BY0 A;  1KT6 A;  1KT5 A;  2X8S A;  2Q2P A;  4IB7 A;  3ELX A;  5LJH A;  4KII A;  1LNM A;  3UEV A;  3NX2 A;  1JBH A;  2PY1 A;  4COT A;  3BSZ E;  3TGB A;  4XMF A;  4GU8 A;  3U0D A;  3VPJ E;  3IA8 A;  2GC9 A;  1RBP A;  2AH7 X;  4M7M A;  3K3L A;  3FIQ A;  1YWC A;  3CMP A;  4PJ2 A;  1G85 A;  2G79 A;  3WVM A;  4O4S A;  3P6H A;  2YG2 A;  3Q6L A;  1KGL A;  2FTB A;  1EPB A;  2OVS A;  3STN A;  2AKQ A;  3CK6 A;  1DZM A;  5DPQ A;  4ZR2 A;  5BYP A;  3O2Y A;  4NW4 A;  2KD2 A;  4OS8 A;  2O62 A;  5D8J A;  4Y0Q A;  1FEL A;  2F09 A;  3UEX A;  5HCD C;  4ZHC A;  3LV4 A;  4K19 A;  3AKN A;  3ZUI A;  5FQ8 E;  4O4X A;  5B27 A;  1T8V A;  3ZW0 B;  5JR8 A;  4QGV A;  3CR6 A;  2OZQ A;  4L3R A;  3KFI A;  2L9C A;  3APU A;  3BU9 A;  4I6S A;  3RSW A;  1G74 A;  3D96 A;  3NR3 A;  1MUP A;  1LIB A;  2JMB A;  4GET A;  1LPJ A;  2ANS A;  4LKP A;  1L6M A;  5H9K A;  2DM5 A;  4LQZ A;  1EAL A;  2ACO A;  2AT8 X;  3IFB A;  2ASN X;  1DC9 A;  1X89 A;  4I9S A;  3QKG A;  4GDZ A;  5F6B A;  2OVD A;  3ZQ3 A;  3PP6 A;  5IO7 A;  4NLI A;  4XMC A;  2X8T A;  4ARH A;  5AEO A;  4ML7 B;  2KT4 B;  4QYN A;  1OBU A;  2AT0 X;  4YGG A;  2G7B A;  1FE3 A;  2LBV A;  1BSQ A;  3F9D A;  4XMH A;  1SA8 A;  2HZQ A;  1OEJ A;  1SXU A;  3C76 X;  3JQO A;  1Y9T A;  2L68 A;  3JS1 A;  4MVL A;  3T1D A;  2RCQ A;  3NWI A;  4EFG A;  1X8P A;  1X8N A;  3FA7 A;  3U03 A;  2F73 A;  1BSO A;  4ON1 A;  4A8Z A;  1OEK A;  1I05 A;  4YFP A;  1DFV A;  3NP1 A;  4IMO A;  4BQU A;  2QO4 A;  1ERB A;  3FEP A;  1GGL A;  1FEM A;  3EBW A;  1PEE A;  3VG4 A;  4QGW A;  3UEW A;  4NYQ A;  3ZW1 B;  3WJF A;  1AVG I;  3NQ9 A;  1E02 A;  4NLJ A;  3EYC A;  2WQ9 A;  1E06 A;  4HPD A;  3RWX A;  1MVG A;  2W2F A;  3ZW0 A;  2GJ5 A;  3JSQ A;  4YKM A;  5HTE A;  4AW8 A;  4ZFX A;  2YMS A;  4LZV A;  4I3C A;  3P6C A;  1JYJ A;  1QY0 A;  1O1U A;  3GE2 A;  4QAE A;  4ORX A;  2BHV A;  1SY0 A;  1IW2 A;  2FLJ A;  2MWH A;  3VG3 A;  2WEX A;  3VG7 A;  1BM5 A;  2Z4H A;  4YGZ A;  1HQP A;  4LKT A;  1URE A;  2KW1 A;  1RLB E;  3NQ3 A;  4YKO A;  3HWF A;  1O8V A;  1A2D A;  1OPB A;  4MVE A;  1VYG A;  3VU1 A;  2GTL O;  1GT4 A;  3ZZV A;  1KT7 A;  5HZ8 A;  1LID A;  1AEL A;  2WUT A;  4XMD A;  2P8G A;  2QOS C;  4WHI A;  4AZP A;  4HPA A;  1DV9 A;  1X8U A;  4WFV A;  2AMM X;  4ZGU A;  1R0U A;  1ERX A;  1TOW A;  3FR4 A;  4QZT A;  4EGW A;  3CWK A;  4EDE A;  2BBH A;  3NAD A;  3WOV A;  2CM9 A;  4KC7 A;  5KID A;  2R74 A;  2NP1 A;  5LJE A;  2NNQ A;  1FTP A;  3PH6 A;  3HWD A;  4GE1 A;  5LKF A;  4RUU A;  2CZU A;  1MDC A;  5EPQ A;  5FEN A;  3STK A;  4GK9 A;  2A13 A;  1BEB A;  2OFM X;  4ZHF A;  3KFG A;  2QO5 A;  1H91 A;  4ZH9 A;  3MBT A;  4HPB A;  1Z24 A;  1S2P A;  1OPA A;  1SXY A;  2LA7 A;  3ZW1 A;  1MX7 A;  2ACP X;  3UAQ A;  1B56 A;  3VG5 A;  4ORU A;  5KIC A;  2QM9 A;  2MJI A;  5BVS A;  1KZW A;  3CBC A;  1OBP A;  3B2H A;  1S7D A;  2OVE A;  3PQU A;  4YCE A;  3TF6 A;  3V8U A;  3FMZ A;  1AB0 A;  4OMW A;  4XME A;  3PQS A;  2FWV A;  2IUB A;  5H9L A;  1ZNK A;  4QRL A;  3ZWE A;  3FW4 A;  4ORW A;  1EI5 A;  3NQK A;  1NGL A;  3EM0 A;  1I04 A;  2R73 A;  3PH5 A;  1XCA A;  5DG4 A;  5IO6 A;  2CZT A;  4M6S A;  4KT5 A;  1QQS A;  3D97 A;  5HCC C;  4KH8 A;  3SAO A;  2G78 A;  2BBJ A;  2BLG A;  2X45 A;  3P6D A;  1HMT A;  1HBQ A;  3S5X A;  1B0O A;  4IB6 A;  4AZO A;  2QO6 A;  5HZ9 A;  5LJG A;  1IFC A;  1OBQ A;  3CQN A;  4FBV A;  3TGC A;  3EBK A;  1EUO A;  4BOE A;  2FS6 A;  1LIE A;  3JCF A;  1GT5 A;  3FLL A;  3ZUO A;  3L4R A;  5FAZ A;  1KZX A;  5EED A;  1ZNG A;  4YBU A;  4O3Z A;  1IKJ A;  3F6Z B;  2HMB A;  4IAW A;  4TKJ A;  2HN2 A;  2Q39 A;  2JOZ A;  4EEB A;  1T68 X;  2HYS A;  4QZU A;  1ZNL A;  4GRJ A;  4GNY A;  3RKG A;  1PM1 X;  1A3Y A;  3HWE A;  4O9S A;  1TOU A;  5CE4 A;  3P6F A;  1O1V A;  4INN A;  4KCA A;  3UEU A;  3NVO A;  1G7N A;  4TKH A;  5HCE C;  3SOT A;  1YWB A;  4YCH A;  2RCT A;  1JZU A;  5LJC A;  5BVT A;  4ZH6 A;  3STM X;  1B4M A;  1QG5 A;  3APX A;  2FRS A;  1MX8 A;  5L8I A;  4A60 A;  1BSY A;  1DZP A;  5C0N A;  1HMR A;  2BS6 A;  1U0X A;  1SY2 A;  3EMM A;  1BLR A;  1QY1 A;  5D45 A;  3FEN A;  1SY1 A;  3LHN A;  1D3S A;  5BVQ A;  1N0S A;  4DQ4 A;  3NPO A;  2EU7 X;  1ZNE A;  3APW A;  2MM3 A;  4TQ2 A;  3CQR A;  5K06 A;  5EDB A;  1X8Q A;  2FS7 A;  1VPR A;  5EDC A;  3PEC A;  3FW5 A;  2AT5 X;  1JJX A;  1HN2 A;  4IAX A;  1BJ7 A;  1GX8 A;  5D48 A;  3BX7 A;  1VYF A;  3OBL A;  1PBO A;  3S60 A;  4IAB A;  4KC8 A;  1D2U A;  1EW3 A;  2L67 A;  4GZV A;  3WXQ A;  1KT3 A;  3ZI8 A;  4L1N A;  1CJ5 A;  4LZU A;  1FEN A;  2WSJ A;  3HOL A;  5HWZ A;  1KT4 A;  2M4L A;  4Y0R A;  3P6G A;  3FR2 A;  4AZM A;  4YGH A;  4R0B A;  4YMY A;  3BDR A;  1X71 A;  2Q9S A;  1JJJ A;  4FQB B;  3B2L A;  1B8E A;  1GM6 A;  3BRN A;  5HZ5 A;  4TKB A;  1QAB E;  2K62 A;  2A3F X;  5F6Z A;  5HA0 A;  3BS2 A;  4QNI A;  2RN4 A;  3KQ0 A;  4NNS A;  1IKE A;  1EIO A;  4YDB A;  4N7D A;  1I06 A;  5KHP A;  1LIC A;  1ACD A;  2CBS A;  3HTY A;  1TVQ A;  1JIW I;  5B29 A;  1A57 A;  4YFQ A;  5AJC A;  1ALB A;  1GKA B;  4NYR A;  3GAQ A;  5CYB A;  4I0U A;  3WJG A;  1HBP A;  4AYH A;  1YWD A;  5LJK A;  1QFT A;  4FGI B;  2W2A A;  4CSB A;  3VE2 A;  1JYD A;  2Q2M A;  4MIR A;  4EEJ A;  5HA1 A;  3OE3 A;  4ALO A;  2GTF X;  4TLJ A;  2OFR X;  2KTS A;  4IBA A;  5F58 A;  5HTD A;  1YUP A;  1PMP A;  2FR2 A;  3DSZ A;  2HNX A;  3WJD A;  2RA6 A;  3VG6 A;  2MO5 A;  1IFB A;  1LF7 A;  4ID2 A;  5HAE A;  1G5W A;  3P6E A;  3S5V A;  5IO5 A;  2HN1 A;  3MVF A;  3C77 X;  2HZR A;  4AZN A;  3N91 A;  1S44 A;  2RQ0 A;  1EII A;  1BBP A;  4ZGF A;  4FBO A;  3NX1 A;  2NND A;  2A2U A;  1ICM A;  4XMG A;  3VE1 A;  1BRQ A;  3PPT A;  2GTL N;  4FBR A;  1NP1 A;  2LBA A;  2LB6 A;  4OMX A;  1GT1 A;  4YDA A;  4ORS A;  1LFO A;  3BX8 A;  5AQ6 A;  5H9A A;  4QGX A;  3TGA A;  1CBS A;  1ML7 A;  3FA9 A;  3HK1 A;  1E5P A;  2X46 A;  3PED A;  2L5P A;  4I3B A;  4N7C A;  5FQ7 E;  5L8N A;  3B2I A;  4U8U N;  4O3W A;  4I95 A;  4AZR A;  1KXO A;  3FEK A;  4EV6 A;  1LIF A;  4TJZ A;  2WWP A;  1AQB A;  3C78 X;  3ZW2 A;  4A1H A;  5LJD A;  1GKA A;  4ZHG A;  3P24 A;  4HFO A;  4Y0P A;  1IIU A;  1CBI A;  4RUN A;  3I17 A;  1KQX A;  1QWD A;  1KQW A;  4D6B A;  2ALL X;  1SXW A;  2HLV A;  4NP1 A;  1I4U A;  1ADL A;  5FQ6 E;  1YIV A;  1XKI A;  2KTD A;  2Z4I A;  1BRP A;  1ZNH A;  4ORR A;  2JU3 A;  2RD7 C;  4PSQ A;  4GKC A;  1QFV A;  3FA6 A;  1X8O A;  4O4U A;  2FR3 A;  2GTL M;  1ZRY A;  4DQ3 A;  4ZHH A;  4U3Q A;  3WJB A;  2JU8 A;  4YH0 A;  2WQA E;  5LJB A;  2A0A A;  5EZ2 A;  3D4R A;  2LKK A;  1ZND A;  4U8U M;  1Y9L A;  4GNW A;  1TW4 A;  4Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...