3RKGA

Structural and functional characterization of the yeast mg2+ channel mrs2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
b'KQLLSLKPISASDSLFISCTVFNSKGNIISMSEKFPKWSFLTEHSLFPRDLRKIDNSSIDIIPTIMCKPNCIVINLLHIKALIERDKVYVFDTTNPSAAAKLSVLMYDLESKLSSTKNNSQFYEHRALESIFINVMSALETDFKLHSQICIQILNDLENEVNRLKLRHLLIKSKDLTLFYQKTLLIRDLLDELLENDDDLANMYLTVKKSPKDNFSDLEMLIETYYTQCDEYVQQSESLIQDIKSTEEIVNIILDANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transporter MRS2, mitochondrial
molecule tags Metal transport
source organism Saccharomyces cerevisiae
publication title Structural and functional characterization of the N-terminal domain of the yeast Mg(2+) channel Mrs2.
pubmed doi rcsb
total genus 89
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 3rkgA02
2.40.128.330 Mainly Beta Beta Barrel Lipocalin Lipocalin 3rkgA01
2BBJA 2BBHA 3JCFA 4I0UA 4EV6A 3CK6A 4EEDA 3RKGA 4EGWA 3NVOA 5JTGA 2IUBA 4EEBA 2HN1A 3NWIA 2HN2A
chains in the Genus database with same CATH superfamily
2OVEA 1Y01A 4I3CA 4FBRA 3L3PA 3AUMO 5M4YA 2CBRA 4HFEA 3PH6A 3S5XA 4ZZCA 3VPJE 1KQXA 3Q6LA 5FVLA 2CZUA 1KF6A 4EV6A 3RC8A 3BX8A 2XQ6A 5LJDA 3T6FA 5HZQA 2AT0X 1UX5A 1WUBA 1WYBA 1ZOYA 2VWAA 2RTKA 2XY8B 1DV9A 2X68A 3EC5A 3JSQA 3DP7A 1VWKB 3KBTA 4HFHA 4ASKA 3TLVA 4ZHQE 5LKFA 3N9LA 3MJXA 3GN5A 5JDLA 2RTGB 5H6RB 3ONLC 1NQNA 2OVSA 2FHNX 4I6SA 4BGFA 4DIDB 4KT5A 3VKGA 1AVGI 1VWFB 4TNWA 1KT4A 3PE0A 4YJ2E 4XBFB 2X0LB 2X56A 4AQFC 3VE2A 1VWRB 4LQZA 1UX4A 3O1HA 4XMFA 1HNXT 2MPKA 4ZGFA 2L9QA 5LGNB 1DZJA 2X46A 2W2BA 5C0NA 3FZKB 5AQUB 2OZQA 2YG2A 5F6BA 3TLWA 2RTBB 2IZKA 4X66T 2AE9A 2V6YB 1GT4A 3NQ3A 3P6HA 2DNXA 2WCAA 3B2IA 4YFPA 1M62A 4A8ZA 5AQLB 3TLTA 4FI5A 3WZOA 3FBZA 4ALOA 4FBVA 5IRAA 3PV0F 4HGAA 2G0UA 1CHUA 3H3IA 3NRYA 2QRXA 4CZZB 3EMMA 4YHJA 4FBOA 1MNEA 3LTWA 3EM0A 1LCZA 5DPQA 3CMLA 4D6AA 2R56A 3FA6A 4BQUA 5HTEA 3WVMA 3ZW1B 2A2GA 3WAJA 1YWCA 4YGGA 2RTCB 2ODVA 4ORUA 4BA9A 4H9QC 4DMWA 4ANJA 5B5FA 2GK9A 4TQ2A 1NENA 2UXBT 1UURA 4OS8A 5D47A 3PDFA 1YKHB 5FXVA 2OY5O 2WDVA 5BVSA 4B3MT 4ZH6A 5IXGA 1YWBA 4LZUA 3E22E 3JAFA 3CVRA 1GX8A 4X1IE 1J5WA 4TV8E 4PW8A 1L0VA 2VURA 3ZC0A 1YWDA 4ZCBA 3WJBA 2N1GA 5EZYE 3FYFA 3PUSA 2IZEB 4MVLA 3HI2A 1D1AA 3B2LA 3S5VA 4X62T 5JR9A 1UYNX 1VWGB 1S35A 1HFAA 2IZCB 4YBPA 2FS6A 2CLYB 4U8UN 4TKHA 3VG2A 1SWAA 3P4RA 2BDEA 2WP9A 5HXRA 3FIDA 3B5MA 2IW5B 1KT6A 3A8YC 5KDMC 2KTSA 3SLJA 4QQ1A 1T8BA 4IDZA 3PTRB 4IB9A 3SOTA 2H89A 4DUZT 2G78A 3MBTA 5LMNT 2GC9A 2I5VO 4U72A 2BKPA 3CMPA 2X66A 3P6CA 2VFCA 2GTLN 3UU5A 1IFCA 3LFMA 4NXMT 2OL7A 3D9WA 3B13A 3I9WA 5FYMA 1SLEB 1GT5A 3QNUA 1LF7A 4F6RC 2BS5A 4CI3B 3P02A 2VFBA 1JYDA 2IMLA 2CZTA 1E7PA 2HKDA 1N0SA 4JO6A 1G7NA 4C5PA 1KZXA 2A0AA 1R8IA 2ASNX 3NBXX 5FQ8E 3CQRA 2CA5A 3J7Yq 2B1EA 1SRGA 5AQIB 4GK0E 3APUA 5TAOA 5LJKA 5AFUL 3HWGA 1S94A 2CCQA 5LA6E 3D95A 3VG5A 3CIRA 4YFSA 2WUTA 4I55E 2FWVA 5B29A 2MTQA 1QG5A 4HFBA 3ZEFB 3P4QA 4K19A 3MZKB 1PTSA 2XAHB 1VWPB 4XMCA 2ACOA 4YMYA 4AQYT 1W9RA 2RTHB 2XAJB 3SLOA 4JNJA 1ZNDA 4N7CA 3E0ZA 2RP4A 3SZJA 5JR9B 2QO4A 4MVEA 2L8KA 1VWNB 2CWYA 1HBQA 5FMNA 2JQ9A 1S44A 3NX1A 2J1DG 3HL6A 4XAXB 4TLJA 1IAPA 4Z8XA 1G73A 3UUMA 4DR2T 3BK9A 1XWMA 3ZCJA 1SWEA 4Y5DA 4YFRA 3ZSSA 2FGSA 5FKYA 5K06A 2QOMA 4U2ZA 3FW4A 5K68A 4NPPA 3ZYKA 5LOVE 3QOFA 1BJ7A 1ZHCA 1B56A 3JCFA 3FR4A 5HCJA 3H3MA 3WJCA 4CPFA 5B27A 4QYNA 1N33T 1U18A 3AE7A 3ETUA 2XQ9A 5L3DB 3P4WA 2IZAA 3BLGA 4QGVA 5HXEA 2QVAA 4I60A 2UXNB 4U3CA 3EYCA 4JI8T 1J1JA 4KHZF 1X8QA 3B2JA 3ZMVB 2O62A 1PBOA 2QO6A 1CUNA 3FB2A 1ZNKA 3RBYA 4HWIB 1ADLA 1RSTB 1BRPA 1VCTA 4CDFA 3E08A 2WR6A 3AEFA 2VVSA 5JR9C 4OFZA 2W63A 1Y53X 1MIVA 2B76A 4JLEA 4MALA 1QFVA 2K23A 3ETVA 3F9DA 3HWFA 4BX7A 3Q9DA 1UYOX 3M65A 3N2OA 1SY3A 2WWUA 3A5XA 3OKQA 5HAEA 5FXZA 2E5VA 2HHHT 4A1HA 4HE8A 1LNMA 4ZZBA 2DLRA 2RTOB 2XQ3A 3O19A 2RPAA 5L8NA 1XDPA 1KL3A 1NGLA 1BR4A 2K24A 4EKVA 2DWKA 3AKNA 1WR6A 1NEKA 4NIQA 5FY0A 2HPLA 2PG8A 4LKPA 2F09A 2N93A 4D6BA 3BSZE 1Z0PA 1LPJA 4JI3T 1NQMA 2OL8O 2BS4A 1BR0A 4HEAA 2JMBA 2OY7A 3QUJA 4LF4T 5JTGA 3BQIA 1LCWA 4XMGA 2RTIB 4UVBB 3IFBA 4QX8B 1WLXA 4OK0A 2Q9QD 4BJNA 4CXXA 2HZQA 4ILBA 5CA1E 4UV8B 4AKIA 1J5ET 3U78A 2CXDA 2XPKA 4YSZA 2VKDA 5CFBA 3P6GA 3WYQA 4ARHA 1VYGA 2HNXA 3VE1A 5HCCC 2VK9A 3LDQB 4TWHA 3H37A 4IMOA 3C77X 2M67A 1QSDA 1NBXA 5AJCA 1GT3A 4AW8A 4YJ3E 4O9SA 5DQVA 2WEXA 3ZLIA 3PK2A 2XSBA 2X45A 4GRJA 3UEWA 2HH7A 1SWBA 4ILAA 3RDSA 2IFBA 1XNRT 1FEWA 2Q9SA 3RQUA 3BS2A 1WFDA 2QO5A 3CX6B 4NUUA 2F4VT 2LHRA 3FEKA 2J62A 1HS7A 5JH7E 2JU3A 4EEJA 2QA7A 5LJNA 1NDJA 2OVAA 2V6XA 3PUQA 2RTPB 4DBRA 4BCSA 2IIUA 5HBSA 5HCMA 2IZLB 1EALA 2CRBA 1WYCA 1QY1A 2UXXB 1RXHA 3UAQA 4IB8A 2PTFA 4GU8A 3QB5A 1XMQT 3C50A 1JYJA 4CDCA 1AJ3A 3EVYA 2H88A 1HY2A 2POAA 3PPTA 1E06A 1H7CA 3RI5A 2OV9A 2BKOA 2D2SA 1VPRA 4Y0PA 4ZHHA 5H9LA 3AEGA 1LCVA 1MEPA 5JDGA 1D2UA 5L3FB 4OYKA 3AE9A 4ZI2D 3KV4A 3ANWA 5JD2A 2CE7A 4L0RA 2XQ4A 1UK5A 2AT8X 5BVQA 5LG3A 5HZ9A 4AQFA 2FRSA 4HTEA 3EUHA 1MIYA 3STNA 5ABFB 2A5CA 2LOPA 3T6LA 3T1DA 2X0HA 4M1PA 5BVTA 3AAEB 4B3ST 4H9OC 1JJJA 4HN9A 1BR2A 4P1NA 1KFFA 4WZXA 4ILCA 3AEDA 4CSBA 4GH7A 1VWLB 2ZM8A 3LG7A 2Y3FA 5LJGA 1I04A 4Z91A 4ID2A 4EGWA 4LKTA 1OEDA 3FBLA 1YUPA 4YCEA 2E9XB 1EQDA 1ZRYA 5B5GA 4ZH9A 2V7MA 3ZT6A 3SFEA 3PUZF 4CDEA 4O8SA 2LSJA 3N9QA 3RZYA 2CBIA 2FUPA 4TKBA 5J2TE 2BKNA 1KOIA 1BWYA 1GX9A 2LBAA 4A5XA 1SLFB 2KT4B 1KK7A 3NR3A 5L47A 3FLLA 4A60A 2C5KT 4B3RT 2FR3A 4U2YA 1DZPA 3OVUA 2XASB 3GE2A 1WRDA 3HA4A 3IBPA 2ZMAA 5FY7A 4X64T 2VKJA 4HFDA 4HWMA 4FQBB 4ON1A 3RH3A 4QAEA 1BEBA 4G2AA 3CQXC 1OBQA 3U03A 1MVGA 3FA9A 5FXWA 2MJIA 3VR8A 1D3SA 3PUYF 3EBKA 3U0DA 3UU3A 4BX5A 4ZHCA 1DF8A 1GKAA 3P6FA 1U5PA 4KIIA 3TF6A 1O1UA 3FZFB 3K3QC 1E02A 3LV4A 1JBHA 5FAZA 4C90A 3JQOA 3NPOA 2YINA 4LF7T 2CBJA 4TV9E 2Q2MA 3NQ9A 3T2WA 3ZQ3A 2BVLA 2LOSA 2VQET 3CKGA 1W09A 4M6SA 4AZNA 4BJ8A 3N9OA 1SMPI 4EOZB 4I9SA 4Z27A 4NLJA 5ABHA 3RY1A 5AQ6A 4XMHA 1FTPA 2GTLO 4YTMA 3MX7A 5DQWA 4KH8A 5K67A 3CWKA 2R74A 3C78X 3AE5A 2NWBA 5AQHB 3C4WA 4ZXLA 3R84B 1IBLT 5IRUA 1MMNA 4DMVA 4DNDA 4OS0A 2YMSA 4YFQA 1OEDB 5F1EA 1GM6A 4JI4T 3ONXA 5HTDA 4AXPA 3JS1A 4IBAA 2X8SA 4ZJ0A 4KI0F 3N9MA 4M7MA 1UUSA 2BHVA 2IHR1 3LHNA 3KFIA 2A2FX 4MEEA 3CX7B 5FXXA 2AT6X 1NAFA 4O4UA 1HCIA 4P0BA 2BBHA 3T2XA 2DL1A 4U9CA 3D96A 3SAOA 2LFOA 3EW2A 2JPFA 3Q5DA 4OMWA 3AEHA 3RDXA 3FR2A 4EXTA 5AQKB 2KWIB 2UXDT 1DZKA 2FHLA 3AE4A 5FENA 1HTJF 2R6GF 5LMUT 2E9XA 1Y52X 4EQAC 2V7LA 1QUUA 1O1VA 2AVIA 4P09A 1KQWA 4GDAA 1VWMB 3OYZA 4YGZA 2RA6A 1I9HA 4JEHB 1JNRA 3RYFE 4QH1A 1NC9A 1GX3A 4QZUA 4CN6A 4HPDA 2C1QA 4MBQA 2P9BA 2Y6XA 5IRWA 1GQEA 3GA8A 5LGUB 1PEEA 4CDDA 1KEYA 3ZWEA 2RTMA 4AZOA 1Y0GA 3O22A 4GDZA 1CBRA 1Y9TA 2RTRB 4GZVA 5IO5A 4TN7B 3EABA 4A56A 3WJGA 1JMZA 2I0MA 5AQMB 1VWAB 2X55A 3N9NA 3I0QA 5JDFA 1SWPA 1BLRA 4OKAA 1YIVA 2IAKA 2ACXA 4DV1T 1KGLA 4O49A 2K48A 4EYYR 1LKXA 5HXHA 4YCHA 2C5IT 3S60A 1HR0T 2JGSA 1Z8UA 4JI6T 4GNYA 3X1DA 2GJ5A 2LSGA 3UU6A 2MWHA 5EDBA 4HWFA 3UEUA 5KX5E 3APWA 5D48A 1YWAA 3IEEA 3I1AA 4ZI2C 4WHIA 5JREA 2D0TA 4EZ4A 4DO0A 2WMNA 3BX7A 4IREA 3RIUC 3O9XA 1HQPA 3F8AA 2V1DB 2Q9QA 4O2BE 2L9CA 3ANWB 3VHMA 3FEPA 2IZFB 4BOEA 3SRZA 2WQYA 3I0OA 2CXLA 5CE4A 3ZN0B 1OSPO 1BSYA 2QM9A 4ZI3D 5F6ZA 4EXZA 3B2HA 5HWYA 3KFGA 2JW1A 3CBCA 4YSXA 2V7KA 4DV2T 2RQ0A 4DR5T 4Q25A 2YU2A 2YDQA 4K0UA 3FHNA 1KNZA 3RE5A 1W0AA 1HX1B 1SWSA 5B10O 2E9XD 3L4RA 4ZI3C 1HX8A 2JIWA 3EI0A 1JJXA 1ZNGA 3KVBA 5CYBA 3VG6A 3TGBA 2V5DA 2LHNA 3D4RA 3WBGA 1QQSA 1E5PA 2W62A 5L8IA 1SWCA 1OXZA 5AQOB 3SWHA 1NWMX 2JQKA 1HBPA 5LBQB 1N7YA 2K9AA 5JRCB 1STRB 5L3BB 1X89A 2WBLA 3F57A 5LJCA 3AB3B 5IO6A 3MM0A 4INNA 4GD9A 3K3NA 2YKSA 4AISA 4NYRA 2M6IA 1QWDA 1TOUA 2FS7A 2UZ2A 1SY0A 1ZEEA 1EPAA 3APVA 4CI1B 3FW5A 4JHQA 2VASA 2EU7X 4TNNA 3RE6A 4PJMA 2QGSA 1W6FA 4I4TE 2BS3A 5AQTB 1IJ8A 1GXAA 3WXQA 4BX7B 5LKEA 3P8CD 1E00A 2QYWA 4B3TT 2W2AA 4YTPA 5C8YE 4L9IA 3UFEA 5B3MO 3HWDA 4AKGA 4YKOA 1VRBA 4E7ZA 4PFPA 3RF1A 5B2AO 3C64A 5LHIB 1ZP0A 1HXZA 4K0KT 2AT5X 4MFRA 3AVRA 5DABA 2FTBA 1MM9A 2XHEB 5LP6E 4CV7A 5J1GA 3VG4A 3AA1B 4YVBA 4NNTA 3LBXB 4ORXA 1ZNLA 3NZQA 5EZ2A 1IBMT 1XMOT 4GIWA 1IW2A 4EEDA 3HKDE 2LM2A 2A3FX 3OE3A 2M6BA 3V5UA 5HXSA 2BZBA 4H63V 3RY2A 2OYBO 2OVDA 4JI0T 2NW9A 1I94T 5HA0A 4NP1A 4U74A 1OEKA 3RC3A 2UUCT 2RTEB 3RDQA 3UTKA 4ORRA 4X20E 3JADA 4IGUA 3VGWA 5JDNA 1OEDE 4HFIA 1DZMA 3ZW0B 3T8OA 4GKJT 1IBKT 2XJ7A 4TUYE 1OBPA 3ZC1A 4ZGUA 3OJAA 5FNVE 5FP3A 5L4HA 5ABEA 3RSWA 1BSQA 4PJLA 1QY2A 1N34T 4IE4A 5L3CB 4AKLA 2AMMX 1KNPA 4GETA 5HEUA 1EIIA 4QHOA 2LA7A 4FJOA 1D0YA 4U7IA 2XSTA 1VWJB 4GGZA 4DR6T 3D97A 1XZYA 2ACPX 4PJJA 2AKQA 3KV5A 2EHOA 1VWQB 4U8UO 3UUBA 3BY0A 2C4IA 1YQ3A 3IHRA 4DR7T 2LJLA 3VHLA 4UU2A 3KBUA 2ACZA 3WZNA 2RTJA 2V7IA 3NQKA 3RQWA 1A18A 1IKEA 3PUWF 2OFMX 4O4XA 2XQ5A 2LSYA 3BU1A 3F2EA 1I6ZA 3PUAA 3TKLB 4AKHA 4KUMB 1LFOA 5HYAA 2N2NA 3UULA 2EHOC 3LBXA 4DNEA 4HWDA 3P6DA 4LFBT 2OF9A 3LK3B 1O8VA 1RLBE 2BG9B 4MIRA 4ZS3A 2FJDA 5FFHA 1W5RA 3B2KA 1UCUA 3SS1A 2D0UA 2XTLA 4IAXA 4BVMA 4COTA 4Z2VA 2IUBA 2ALLX 5FQ6E 4UVCB 3VR9A 4GK5E 1MX7A 3PUVF 1HMSA 2YU1A 4UEMA 5CB4E 3RYHE 3BU9A 1VWCB 3QK6A 2AXDS 2YDRA 4YLHA 4JI5T 2YN6A 3TZSA 2OA5A 4QKNA 1IZNB 2RTDB 5LJMA 1X8PA 2Y3EA 3O4XE 2FKJA 2L5PA 3AA7B 2Y48B 4PFOA 3FZHB 1BSOA 3PECA 4NNSA 4OMXA 4QWNB 2H7VC 1VWDB 2OY1O 3Q5XA 3AEAA 2A72A 1FELA 3DTOA 4EEBA 5F8PA 5HZ8A 3C51A 1FDQA 5AQQB 1T8VA 2UYWA 4LMJA 1UZ2X 4UIGA 5B11O 3EBWA 4O4OA 1G85A 4ZEYA 4O4JE 4CQIA 1X79A 3CX8B 3LK2B 4YSYA 2AT3X 4RUUA 5EDCA 3HTYA 1ZV4X 3N9PA 4BX6A 1MMGA 1VWOB 4WBNE 2IZHB 4IB6A 1SXYA 3NWIA 2VB6A 3B57A 4X65T 1JJUA 3FDCA 3AKMA 3G06A 2CPTA 1NP1A 3QQ2A 2DM5A 3FENA 3ZW2A 2Q39A 4R0BA 3RWXA 4CPHA 1SE7A 3PU8A 2HMBA 1MNDA 1K24A 3C98B 1VWBB 5HCDC 1SWQA 4GNWA 1YP6A 2V8SV 1U17A 3UQ7A 3TLSA 5JR8A 3ZPOA 4IDNA 2FJBA 4LF8T 4DV5T 2YEVC 2KXPB 4DV7T 2XSAA 2WDRA 4AIUA 5L4EA 5LHGB 2C1SA 4KP3C 5D8JA 2ZM0A 5IWAT 2SPCA 3GMIA 2KINB 1K3BA 1AVEA 3FXEB 1E1HB 2NNQA 4IDQA 5AQVB 1OPAA 1US7B 5LGTB 1PMPA 2HN1A 1SWRA 4I50E 2ES0A 4JBWF 2RD7C 1G5WA 5HEGA 4CXYA 4QYPA 1YXRA 3LJCA 1JIWI 1LVKA 5F7GA 4YKMA 3EW1A 3U3IA 5LB7B 1SLDB 3ZJ1A 2W0GA 3CQGB 4EZHA 1AB0A 3V5SA 5LJEA 3OTOT 5L8OA 1I05A 3CQCB 5IUXA 4U8UM 1FMWA 1TXLA 1OPBA 4O2AE 3OBVE 3APXA 3STMX 3GAQA 4QRLA 1LIEA 2AF5A 1SRHA 4GUZA 4IMNA 2WQ9A 3OBLA 4QXBB 1A3YA 2LBVA 3TGAA 1YW0A 2QOSC 1LDQA 4G63A 2N9DA 4H9SE 2HPJA 5D45A 3RIUA 3HOLA 1LICA 3UQ4A 3WJEA 4O3ZA 2OFBA 4TX5A 3I0AA 3HKEE 1S7DA 4JGLA 5EK3A 5AQFB 2WS3A 5ABFA 2IZGB 2KLQA 2DCFA 3NRXA 2AH7X 4WYVA 1BM5A 5L3YA 5EK2A 5HZ6A 1AELA 5E0OA 3AA6B 2F01A 1IJ5A 3HOEA 5LG4A 1XKIA 4AZPA 2E2AA 1R0UA 4LF6T 1SWHA 2L67A 3AEEA 1FEMA 2FT9A 1ZKEA 2KT9A 1SREA 4WW0A 4GGTA 3PQSA 1MOYA 4GJVA 5AJBA 2XM1A 1L6MA 2LSIA 1SHZC 4UU3A 4QX7B 4JI7T 3UU4A 4Z6JA 1MK5A 2A2UA 1LIBA 2YK0A 4ZOLE 3K3OA 4UF0A 4IE5A 1ZNEA 4WBKA 1FENA 5FL1A 3VG7A 4DUYT 3LSVA 5FQ7E 1LELA 4DCBA 2LRLA 2CM9A 3K8PC 1LVFA 3TGCA 3FZLB 2LM9A 2XAGB 5HWZA 5AEOA 1D0XA 2LE8A 1RXJA 3PP6A 5JDQA 2BLGA 2KNDA 5DJQC 4YY3T 4PK6A 2UUBT 4LF5T 2ODUA 1N4JA 1SXWA 4UVAB 2C5JA 3VRBA 1TOWA 1OEDC 4I3BA 4UELA 1HF8A 3HWEA 2OF8A 4ILUA 1B0OA 3DSZA 1YKEB 3NX2A 2NR4A 1SLGB 2KW1A 2WB5A 1CJ5A 3HK1A 4Z28A 4J2CA 3RLFF 1Y9LA 4MVKA 5H9AA 1VWHB 5D4AA 3KFWX 1RAVA 3ELZA 3FIQA 4ZHGA 2UU9T 2WMOA 3SLTA 3IF8B 1PM1X 3KINB 1D0ZA 3P4SA 2RTNB 3N91A 4PNIA 2NNDA 4ML7B 5L3GB 1HNZT 2NW7A 3ZKRA 3ZJ2A 1KFYA 1MMDA 4NUVA 3U9PC 3RIFA 1N9YA 1PBYA 1KT3A 1DF3A 2AL0X 3ZUIA 3RX6A 1KT5A 1XCAA 1RXKA 4TNVA 2CWOA 5C2TA 1IFBA 4Y59A 2IZJA 3FZMB 4ORWA 2OLTA 1SWOA 1OEEA 2CHNA 2X9WA 1SRJA 3AAAB 3AE2A 2HLVA 2LRKA 4H9PC 1RBPA 3KV6A 3RGLA 2DJGA 2NTXA 5AQPB 2OY8A 2WZHA 2CBSA 3JC6D 4E7SA 3TLUA 3CK6A 3RKOA 2BVMA 4Y0QA 2LT3A 4ADZA 1LIDA 1ACDA 2Q4NA 1H91A 2YOEA 4CN1A 2MAWA 1DU2A 2CLYC 3NP1A 2NP1A 3Q5WA 1EUOA 3S26A 2IC6A 1WCRA 3BQLA 1X9BA 3WAKA 3ONJA 4WNKA 1MMAA 1LKEA 4AZMA 1T72A 5H9KA 3ZUOA 1QABE 2MBGA 2E9XC 1KNRA 1ZNHA 4HFCA 4HPAA 5JDHA 1OBUA 2BC3A 4ALBA 3AXJB 3CPZA 2LLYA 3MXZA 4PAGA 4XMDA 3F6ZB 5BR8T 1E2TA 1MIWA 4JUYA 2Y32A 3RDUA 5L3EB 2RCQA 3CWZB 2X32A 5HAXA 2PY1A 3FA7A 3QB5K 3MA9A 5CSEA 5AQJB 2ZSCA 2ANSA 4OX9T 5LJHA 3SZIA 2W61A 3P7IA 2QMIA 4EIWA 4DV6T 2RTAA 3AE1A 3FELA 4EAHA 4DVDA 1HQQA 4QZTA 4NXNT 1TW4A 2W00A 2MF6A 3UT5E 3RDMA 2FBWA 4BX6B 2CEAA 2OFRX 2CM0A 4I0UA 3STKA 1CBIA 1MUPA 1ICNA 3J9X1 4AI6A 2RA1A 2JQQA 5LHHB 4GJSA 3EHZA 1XNQT 4O3XB 1X8OA 4ODDA 4B6XA 4WBOA 4I43B 4N7DA 2PBIA 1HG5A 2V7JA 3P6EA 3AE3A 3ZYLA 2CMRA 3BRNA 3CQNA 1LDOA 4YDBA 3AE6A 5L2LA 4P0AA 4ORSA 4GYSA 4A98A 4O4IE 3RDOA 2JU7A 2LKHA 5CA0E 1G74A 1EI5A 4ZHFA 2L68A 2HN2A 3HKBE 3I17A 2A3DA 3N2KE 1D1BA 1T0VA 3W15B 2YDSA 3A7MA 2EHOB 1UREA 1SRFA 1QFTA 2BG9E 2UXCT 1SRIA 4HWHA 4Z90A 2EHOD 2BSZA 2X4MA 1AVDA 2GH7A 4AZQA 2X9HA 1HXLA 2W4XA 3VHIA 4QXHB 4IL4A 2I5ZO 5J2UE 3RRCA 1SWNA 2K5BB 3P50A 3KV9A 2BS2A 3ESLA 3NKZA 4A97A 2H3RA 4ZHDA 1N43A 2DJFA 3P4PA 2KTDA 2WDQA 4HFVA 1QY0A 5AQNB 1YP7A 1B4MA 4DV0T 5AQRB 5BMVE 5HEJA 2RTFB 2VKOA 1VYFA 4OS3A 4L3RA 3RYCE 1Z24A 1CBQA 1NP4A 2Z6EA 3X00A 1TVQA 4HKAA 1VCSA 4X1KE 3L8RA 4YTNA 1T68X 1Y55X 1EXSA 3RIAA 2A8GA 1OEJA 3FMZA 5KMGP 3PJAA 4TZ4C 3OYXA 5JRCA 4GKCA 4OHFA 1SA0E 1M7KA 3EDVA 2JJ9A 2GTLM 1EIOA 2IDOB 2RTLA 1STSB 5LNKA 1ML7A 4DR3T 3KDSE 5HEOA 2K3WA 2KZ7B 1GT1A 2I59A 2FR2A 4JV5T 1LUQA 2BS6A 2FLJA 2XM2A 1IIUA 2LB6A 2WU2A 3HPEA 4I9RA 3T1YT 5JDMA 4GGRA 3ZT7A 2VL0A 2NTYA 1BBPA 2KWHA 4IE7A 1SWGA 1SWFA 1VWIB 2G79A 3PH5A 3PJAJ 3ZMTB 2W2UA 3UU8A 1A2DA 2FKGA 1SWUA 4LZVA 4YGHA 3GN5B 4Y0SA 4CPIA 5F58A 3VU7H 4OYJA 4GOUA 2JQHA 5LXTE 4OELA 1SY1A 2V5CA 3AA0B 2A13A 3WZPA 2JOZA 2K62A 2WWPA 1O3XA 1LRZA 4UXNB 4N78D 5KXJA 2IZDB 3UEXA 4CPHB 4YT0A 3T1HT 3UUNA 1EPBA 4LMKA 3ZSTA 3MKDA 2BT9A 5IO7A 3VG3A 3F31A 4AZRA 1SUMB 2Y8DA 2P8GA 1G8XA 1JZUA 1EZ3A 2A5BA 2Q9QC 2X34A 4ZFXA 4DV3T 2VQFT 3MACA 2MOZA 1B8EA 1VWEB 5HCEC 5EPQA 3ZMUB 3AE8A 2IZIA 5H8TA 3RPUA 2PJQA 2WWVA 2ZAGA 4QGWA 2X67A 4YH0A 3DTQA 3N5LA 4U46A 3C76X 2XQ7A 5IYZE 2CHOA 4DBQA 4DR4T 1IKJA 4NLIA 4ZR2A 3ZW0A 3QC9A 3KVAA 4LFAT 4FGIB 4NW4A 4DQ4A 1BRQA 3ZZVA 3ZW1A 3NADA 5C3JA 2XQ8A 5H9NA 3ZI8A 4CI2B 4KBMB 3PEDA 4QXCB 2DHRA 2HZRA 4IABA 4MISA 1AQBA 4IHJE 1W4TA 4JYAT 2MYSA 1SY2A 1KL5A 2X9XA 4H9NC 2RN4A 4GK9A 5H6QB 4KHPT 3KZAA 2BG9C 1GKAB 3I9YA 2ZAIA 1KZWA 4QH5A 4X5TA 4IDPA 1MX8A 4UR9A 3O1IA 4PK4A 3AAIA 2VVNA 5ADXL 4NV7A 3S4UA 2PFVA 3WJFA 2HYSA 2PI3O 2JRKA 5CGMA 2MO5A 4U33A 1YQ4A 2IZBA 3PUXF 1SWKA 5HZ5A 3OPCA 2NOXA 3HKCE 3PDYA 4ORYA 4O4HE 5IHYA 3VRAA 5FL0A 3AXJA 2BBJA 3P24A 4ES7A 4DV4T 3GWHA 3RRWA 4KC7A 4UV9B 4IE6A 2E4JA 4ERRA 3Q2MA 2MHDA 3KVNA 4AQGA 4TKJA 1SA8A 2VL8A 4BJMA 2Z4IA 2Z4HA 1HN2A 4IDOA 1HNWT 4BX5B 4ZS2A 4IT4A 4DR1T 4PJNA 4YXDA 3V8UA 4ZI7E 5F3JA 4GKKT 2I6HA 2C0SA 3EDUA 5CJ5A 3CKFA 2WSJA 4MLKA 3L09A 4OEMA 2J4GA 1JV4A 3E3CA 3KFFA 4IL9A 4COFA 2VKHA 3IA3A 3BDRA 5GONE 4I95A 2H7OA 1SWTA 5LYJE 4HPCA 4Z2PA 1SXUA 3MVFA 5HEHA 2RTQB 4U31A 3SFDA 3D0TA 3EAMA 2L3LA 4XZCA 3K1SA 4BBOA 3KQ0A 1KT7A 1D1CA 2LSKA 5HXCA 3OJYC 3WI3A 2OL6O 1STPA 4QH4A 2IC9A 3OD9A 3H3AA 3RYIE 1XDOA 2CAMA 4QNIA 4KCAA 5KIDA 2G5LA 1X8NA 4CN4A 1S2PA 1W0BA 4Y0RA 2D9DA 3VKHA 3C4ZA 3PUGA 4IIJE 2WM9A 3Q5EA 4IAWA 2WZIA 2FJAA 1ALBA 2ZM2A 1I4UA 2NW8A 3PU3A 4AKRB 2Q2PA 4IE0A 4WFUA 2LKGA 3UFGA 1P6PA 4LMLA 2JU8A 5EEEA 3PQUA 4ISTA 2QCBA 3CBSA 2FJEA 1FIOA 3ZMZB 2VDFA 4NYQA 2XAQB 3FR5A 4O4LE 2OFAA 4PSQA 3MG5A 5BYPA 1FMVA 1VYOA 2XKLA 1QLBA 2WSSV 2X9YA 4TWFA 5ETWA 2J47A 1MDCA 3WJDA 2XAFB 1Y64B 4ISSA 3ABVA 1SWJA 5ABGA 1N9MA 4Z2OA 5HWXA 1EW3A 1FE3A 4PJ2A 4TJZA 3C4XA 2DWGA 3UUXB 4DQ3A 4EYUA 1ERXA 1IJ6A 4O3YA 2XZEA 2JN3A 4O4SA 4WFVA 1HMTA 2MM3A 1LIFA 2LKKA 4JI2T 1JMXA 1HMRA 5DG4A 3ZMSB 1U4QA 2WEWA 5EK4A 5JQGE 3WOVA 1E2AA 2UUAT 4KMCA 1N36T 4IRWA 1HG2A 3VHHA 1YD8G 2JMKA 1SXXA 1X71A 1SWDA 3ELXA 4AYHA 2ZM6T 3HR0A 2XQAA 2BG9A 2XQYA 1FJGT 2V26A 4CK4A 5A1LA 1U0XA 5AQGB 3WYPA 2WU5A 5J0ZA 4O3WA 5CHKA 4L5GA 2E8IA 4BAYB 1SWLA 5JVDE 2X0YA 3LK42 2LEHA 2RCTA 2ZLYA 4EDEA 3ZN1B 3M3ZB 4PK5A 2XUEA 4NV8A 2DI4A 4YHHT 3DJBA 2G7BA 2M4LA 2X8TA 1ERBA 4V1Av 4EFGA 1KXOA 1I06A 2NP9A 4XMEA 1UGOA 4H9RC 3SZHA 3WZQA 5KICA 4U7YA 2W2FA 4X1YE 3KFHA 4H63H 4MVIA 3FA8A 4A1YA 1JQPA 2Q9QB 5HA1A 3O2YA 2E5LT 5LBMA 4GE1A 4YDAA 2W67A 4MHCA 1WBIA 2A9UA 2JMHA 3SOLA 2WAUA 3RHWA 5F2BA 3NVOA 4I3DA 3ZYMA 3CR6A 4L1NA 3ZT5A 1FJ1E 3FXDB 4EB6E 2KMFA 3UEVA 1GGLA 4HPBA 1X8UA 1KL4A 3IA8A 2CM4A 2KSRA 1CRBA 2KD2A 3CKDA 3Q34A 3BQKA 1CBSA 1RSUB 2V6YA 1V9DA 4UF0B 4IB7A 3AVSA 1DFVA 4RUNA 4QGXA 1DC9A 3QKGA 5AQSB 2NNEA 5LJBA 1A57A 2R73A 1I78A 4HWCA 5F5WA 2X51A 1T98A 3JAEA 4CXWA 3ZCIA 4JI1T 5EEDA 2WPUA 3VU1A 2D5UA 1ICMA 3PURA 4KX6A 1N32T 2F73A 4HFOA 4KC8A 4LF9T 3K3LA 3L39A 3AEBA 3G7XA 3NZPA 1VOMA 1JNZA 2GTFX 1B7TA 2X8FA 1BR1A 3O1JA 3R6NA 4GYRA 4U3QA 4B55A 2CXFA 2W66A 5FY1A 4CPEA 4TWDA 3JC6C 1T7SA 5FVKA 3N2GE 1WR0A 2WQAE 3RKGA 4YBUA 2G8CO 5LCYA 4C91A 3AECA 2WY2A 5KHPA 3MK7C 4JEUB 4LFCT 1OWAA 4F8HA
chains in the Genus database with same CATH topology
4GH7A 2OVEA 4I3CA 4IAXA 4BVMA 4FBRA 4COTA 2IUBA 2ALLX 4GKCA 5LJGA 5FQ6E 1I04A 1MX7A 2CBRA 1HMSA 4ID2A 4EGWA 4LKTA 2GTLM 3BU9A 3PH6A 1YUPA 3S5XA 1EIOA 4YCEA 1EQDA 1ZRYA 4ZH9A 3VPJE 1ML7A 3TZSA 1KQXA 3Q6LA 1X8PA 3RZYA 2CZUA 4EV6A 3BX8A 4TKBA 5LJDA 5HZQA 1GT1A 2L5PA 1KOIA 2AT0X 2FR2A 1BWYA 1GX9A 2BS6A 2LBAA 2KT4B 2FLJA 1DV9A 1BSOA 3PECA 1IIUA 3NR3A 3JSQA 3FLLA 4NNSA 4OMXA 2LB6A 4A60A 2FR3A 4I9RA 5LKFA 1DZPA 1BBPA 3GE2A 1FELA 4EEBA 5HZ8A 1FDQA 1T8VA 2G79A 3PH5A 2OVSA 4HWMA 1UZ2X 4I6SA 1A2DA 4KT5A 4FQBB 3EBWA 4LZVA 1AVGI 4ON1A 4O4OA 4QAEA 1G85A 4YGHA 1BEBA 1KT4A 4Y0SA 1OBQA 5F58A 3U03A 1MVGA 3FA9A 4RUUA 5EDCA 2AT3X 3VE2A 2MJIA 3HTYA 1D3SA 3EBKA 1SY1A 3U0DA 4LQZA 4XMFA 4ZHCA 2A13A 1GKAA 3P6FA 4KIIA 3TF6A 4ZGFA 2JOZA 1O1UA 2K62A 2WWPA 1DZJA 1E02A 2X46A 3LV4A 2W2BA 5C0NA 1JBHA 4IB6A 1SXYA 2OZQA 2YG2A 3JQOA 3NWIA 5F6BA 3NPOA 5FAZA 3UEXA 1EPBA 3NQ9A 2Q2MA 3AKMA 3ZQ3A 1NP1A 1GT4A 2BT9A 2DM5A 4M6SA 4AZNA 3FENA 3NQ3A 1SMPI 5IO7A 3ZW2A 3P6HA 3B2IA 4I9SA 4YFPA 2Q39A 3VG3A 4R0BA 4NLJA 3RWXA 4A8ZA 4AZRA 5AQ6A 2P8GA 4ALOA 4XMHA 1FTPA 2HMBA 2GTLO 1JZUA 3MX7A 4ZFXA 4KH8A 4FBVA 3CWKA 1B8EA 2R74A 3H3IA 5HCDC 3C78X 3EMMA 4FBOA 4GNWA 1YP6A 5HCEC 5EPQA 1U17A 3EM0A 5JR8A 4OS0A 5H8TA 2YMSA 5DPQA 4D6AA 4YFQA 5F1EA 1GM6A 2ZAGA 4QGWA 2R56A 5HTDA 3JS1A 3FA6A 4IBAA 4BQUA 5HTEA 2X8SA 3WVMA 4YH0A 4ZJ0A 5D8JA 3ZW1B 3DTQA 2A2GA 3C76X 1YWCA 4M7MA 4YGGA 1IKJA 4ZR2A 4NLIA 4ORUA 3ZW0A 2BHVA 3LHNA 3KFIA 2NNQA 4FGIB 4NW4A 4DQ4A 4TQ2A 1BRQA 1OPAA 4OS8A 3ZZVA 2AT6X 4O4UA 3NADA 5D47A 1PMPA 2HN1A 3ZW1A 5H9NA 3ZI8A 2BBHA 5BVSA 3PEDA 4ZH6A 2HZRA 4U9CA 1YWBA 4LZUA 2RD7C 1G5WA 3D96A 3SAOA 2LFOA 4IABA 4MISA 1AQBA 1GX8A 4QYPA 1JIWI 4OMWA 5F7GA 3FR2A 4YKMA 4ZCBA 1YWDA 3WJBA 1DZKA 3FYFA 1SY2A 5FENA 4MVLA 1AB0A 5LJEA 2RN4A 4GK9A 3B2LA 5L8OA 3S5VA 1I05A 4U8UM 3KZAA 4EQAC 1GKAB 2ZAIA 1TXLA 1OPBA 1KZWA 1O1VA 4YBPA 2FS6A 1MX8A 4U8UN 4TKHA 3VG2A 3APXA 1KQWA 3STMX 3GAQA 4YGZA 3WJFA 2HYSA 4QRLA 1LIEA 1KT6A 2MO5A 4IMNA 2RA6A 2KTSA 2WQ9A 4QQ1A 3OBLA 4IB9A 3SOTA 5HZ5A 2LBVA 1A3YA 3TGAA 2QOSC 2G78A 3MBTA 4QZUA 5D45A 2GC9A 3HOLA 4HPDA 4ORYA 3CMPA 1LICA 3WJEA 4O3ZA 3I0AA 3P6CA 1S7DA 4JGLA 1PEEA 2GTLN 2BBJA 1IFCA 3P24A 4ES7A 4KC7A 3ZWEA 4AZOA 2E4JA 3O22A 2MHDA 2AH7X 1GT5A 4GDZA 1CBRA 1SA8A 1Y9TA 4TKJA 4GZVA 1BM5A 5IO5A 2Z4IA 1LF7A 2BS5A 2Z4HA 3WJGA 5HZ6A 1AELA 3P02A 1HN2A 3HOEA 1JYDA 2CZTA 1N0SA 1XKIA 3V8UA 2L67A 1R0UA 4AZPA 1G7NA 1KZXA 1BLRA 2A0AA 1FEMA 2FT9A 1YIVA 2ASNX 3NBXX 5FQ8E 3CQRA 2WSJA 1KGLA 3PQSA 4O49A 5AJBA 3APUA 1L6MA 5LJKA 4UU3A 1JV4A 3E3CA 3KFFA 3BDRA 3HWGA 2A2UA 1LIBA 4I95A 3D95A 4YCHA 3VG5A 3S60A 4HPCA 1ZNEA 4WBKA 1SXUA 3MVFA 2WUTA 1FENA 4GNYA 3VG7A 2FWVA 2GJ5A 5EDBA 2MWHA 5FQ7E 3UEUA 5B29A 3APWA 2CM9A 1QG5A 3TGCA 5HWZA 4K19A 1YWAA 5D48A 5AEOA 3PP6A 4XMCA 2ACOA 4YMYA 2BLGA 3KQ0A 1KT7A 4WHIA 1ZNDA 4N7CA 3BX7A 1SXWA 2QO4A 4MVEA 1TOWA 4I3BA 3OJYC 1HQPA 1HBQA 3HWEA 3F8AA 1B0OA 1S44A 3DSZA 3NX1A 3NX2A 2KW1A 2L9CA 1CJ5A 3HK1A 4TLJA 1Y9LA 4MVKA 5H9AA 3OD9A 3FEPA 5D4AA 4BOEA 3ELZA 3FIQA 4QNIA 4ZHGA 4KCAA 5KIDA 1X8NA 1PM1X 4YFRA 1S2PA 3N91A 5CE4A 4Y0RA 1BSYA 2NNDA 4ML7B 2QM9A 5K06A 5F6ZA 4EXZA 3B2HA 3FW4A 4IAWA 3U9PC 1ALBA 1I4UA 3KFGA 2JW1A 1BJ7A 2Q2PA 3CBCA 1B56A 4WFUA 1KT3A 2RQ0A 1DF3A 1P6PA 3JCFA 2AL0X 2JU8A 3FR4A 5EEEA 3ZUIA 1KT5A 3WJCA 5B27A 1XCAA 3PQUA 4QYNA 3CBSA 1IFBA 1U18A 4NYQA 3FR5A 4PSQA 3BLGA 3L4RA 4ORWA 4QGVA 1OEEA 5BYPA 2XKLA 3EYCA 1JJXA 1X8QA 1MDCA 2HLVA 3B2JA 1ZNGA 2O62A 1PBOA 2QO6A 3WJDA 3TGBA 5CYBA 3VG6A 1ZNKA 3RBYA 1RBPA 1ADLA 1BRPA 3D4RA 3WBGA 1EW3A 1QQSA 1E5PA 1FE3A 4PJ2A 4TJZA 5L8IA 2WR6A 4DQ3A 2CBSA 1ERXA 3CK6A 4O3YA 4Y0QA 1HBPA 1LIDA 2JN3A 4O4SA 1ACDA 2Q4NA 4WFVA 1QFVA 1H91A 2K23A 1X89A 5LJCA 3F9DA 5IO6A 3HWFA 1HMTA 2MM3A 1LIFA 2LKKA 3NP1A 5DG4A 4INNA 1HMRA 2NP1A 1SY3A 5HAEA 1EUOA 3S26A 2WEWA 4NYRA 1QWDA 1TOUA 2FS7A 4A1HA 3WOVA 1SY0A 3APVA 1EPAA 1LNMA 1LKEA 3FW5A 4AZMA 1SXXA 1X71A 2EU7X 3ELXA 1QABE 3O19A 1NGLA 4TNNA 5H9KA 3ZUOA 1ZNHA 4AYHA 5L8NA 3AKNA 4CK4A 4HPAA 1GXAA 1OBUA 1U0XA 3WXQA 4ALBA 5LKEA 4LKPA 1E00A 2F09A 2N93A 4XMDA 3BSZE 3F6ZB 4D6BA 2W2AA 4O3WA 1LPJA 3HWDA 4YKOA 2JMBA 2RCQA 2PY1A 5JTGA 2RCTA 4EDEA 3FA7A 4XMGA 3IFBA 2ANSA 2G7BA 2M4LA 2X8TA 1ERBA 2HZQA 5LJHA 2AT5X 2QMIA 4EFGA 3FELA 1KXOA 2FTBA 1I06A 4XMEA 4QZTA 5KICA 1TW4A 3P6GA 4ARHA 4CV7A 3VG4A 1VYGA 2HNXA 3VE1A 5HCCC 2W2FA 2OFRX 3KFHA 4I0UA 3STKA 1CBIA 1MUPA 3FA8A 4MVIA 4NNTA 1ICNA 4A1YA 4ORXA 1ZNLA 4IMOA 3C77X 5EZ2A 1IW2A 5AJCA 4EEDA 1GT3A 4AW8A 5HA1A 4O9SA 2A3FX 2WEXA 3O2YA 3OE3A 2X45A 4GRJA 4GE1A 3UEWA 4O3XB 1X8OA 4ODDA 2OVDA 4N7DA 4YDAA 2IFBA 2Q9SA 3P6EA 3BS2A 3BRNA 3CQNA 4YDBA 2QO5A 4NP1A 5HA0A 3NVOA 1OEKA 3FEKA 4ORRA 4I3DA 3ZW0B 4ORSA 3CR6A 4L1NA 1DZMA 2JU3A 3UEVA 4EEJA 2JU7A 1G74A 1EI5A 1OBPA 2OVAA 4ZHFA 2L68A 2HN2A 4ZGUA 3I17A 1GGLA 4HPBA 1X8UA 3IA8A 2CM4A 3RSWA 1BSQA 1CRBA 1T0VA 2KD2A 5HBSA 1QY2A 1EALA 2AMMX 1CBSA 4GETA 1QY1A 1UREA 3UAQA 4IB8A 1EIIA 4GU8A 1QFTA 2LA7A 4RUNA 4IB7A 1DFVA 2XSTA 1JYJA 4QGXA 1DC9A 3QKGA 3D97A 2ACPX 2AKQA 2NNEA 2POAA 5LJBA 3PPTA 4U8UO 1E06A 1A57A 3BY0A 2R73A 4AZQA 1VPRA 4UU2A 4Y0PA 3NQKA 4ZHHA 5EEDA 1A18A 1IKEA 2OFMX 3VU1A 5H9LA 1ICMA 2F73A 4HFOA 4O4XA 4KC8A 1D2UA 3BU1A 3K3LA 4ZHDA 3G7XA 2KTDA 2GTFX 1QY0A 2X8FA 1YP7A 4U3QA 1LFOA 2AT8X 1B4MA 5BVQA 5HZ9A 1VYFA 2WQAE 2FRSA 3P6DA 4L3RA 4OS3A 3RKGA 1Z24A 3STNA 1CBQA 4YBUA 1NP4A 3T1DA 1O8VA 1RLBE 1TVQA 5BVTA 1T68X 5KHPA 4MIRA 1JJJA 5FFHA 1EXSA 3B2KA 4CSBA 1OEJA 3FMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBJ A;  2BBH A;  3JCF A;  4I0U A;  4EV6 A;  3CK6 A;  4EED A;  3RKG A;  4EGW A;  3NVO A;  5JTG A;  2IUB A;  4EEB A;  2HN1 A;  3NWI A;  2HN2 A; 
#chains in the Genus database with same CATH topology
 2OVE A;  1Y01 A;  4I3C A;  4FBR A;  3L3P A;  3AUM O;  5M4Y A;  2CBR A;  4HFE A;  3PH6 A;  3S5X A;  4ZZC A;  3VPJ E;  1KQX A;  3Q6L A;  5FVL A;  2CZU A;  1KF6 A;  4EV6 A;  3RC8 A;  3BX8 A;  2XQ6 A;  5LJD A;  3T6F A;  5HZQ A;  2AT0 X;  1UX5 A;  1WUB A;  1WYB A;  1ZOY A;  2VWA A;  2RTK A;  2XY8 B;  1DV9 A;  2X68 A;  3EC5 A;  3JSQ A;  3DP7 A;  1VWK B;  3KBT A;  4HFH A;  4ASK A;  3TLV A;  4ZHQ E;  5LKF A;  3N9L A;  3MJX A;  3GN5 A;  5JDL A;  2RTG B;  5H6R B;  3ONL C;  1NQN A;  2OVS A;  2FHN X;  4I6S A;  4BGF A;  4DID B;  4KT5 A;  3VKG A;  1AVG I;  1VWF B;  4TNW A;  1KT4 A;  3PE0 A;  4YJ2 E;  4XBF B;  2X0L B;  2X56 A;  4AQF C;  3VE2 A;  1VWR B;  4LQZ A;  1UX4 A;  3O1H A;  4XMF A;  1HNX T;  2MPK A;  4ZGF A;  2L9Q A;  5LGN B;  1DZJ A;  2X46 A;  2W2B A;  5C0N A;  3FZK B;  5AQU B;  2OZQ A;  2YG2 A;  5F6B A;  3TLW A;  2RTB B;  2IZK A;  4X66 T;  2AE9 A;  2V6Y B;  1GT4 A;  3NQ3 A;  3P6H A;  2DNX A;  2WCA A;  3B2I A;  4YFP A;  1M62 A;  4A8Z A;  5AQL B;  3TLT A;  4FI5 A;  3WZO A;  3FBZ A;  4ALO A;  4FBV A;  5IRA A;  3PV0 F;  4HGA A;  2G0U A;  1CHU A;  3H3I A;  3NRY A;  2QRX A;  4CZZ B;  3EMM A;  4YHJ A;  4FBO A;  1MNE A;  3LTW A;  3EM0 A;  1LCZ A;  5DPQ A;  3CML A;  4D6A A;  2R56 A;  3FA6 A;  4BQU A;  5HTE A;  3WVM A;  3ZW1 B;  2A2G A;  3WAJ A;  1YWC A;  4YGG A;  2RTC B;  2ODV A;  4ORU A;  4BA9 A;  4H9Q C;  4DMW A;  4ANJ A;  5B5F A;  2GK9 A;  4TQ2 A;  1NEN A;  2UXB T;  1UUR A;  4OS8 A;  5D47 A;  3PDF A;  1YKH B;  5FXV A;  2OY5 O;  2WDV A;  5BVS A;  4B3M T;  4ZH6 A;  5IXG A;  1YWB A;  4LZU A;  3E22 E;  3JAF A;  3CVR A;  1GX8 A;  4X1I E;  1J5W A;  4TV8 E;  4PW8 A;  1L0V A;  2VUR A;  3ZC0 A;  1YWD A;  4ZCB A;  3WJB A;  2N1G A;  5EZY E;  3FYF A;  3PUS A;  2IZE B;  4MVL A;  3HI2 A;  1D1A A;  3B2L A;  3S5V A;  4X62 T;  5JR9 A;  1UYN X;  1VWG B;  1S35 A;  1HFA A;  2IZC B;  4YBP A;  2FS6 A;  2CLY B;  4U8U N;  4TKH A;  3VG2 A;  1SWA A;  3P4R A;  2BDE A;  2WP9 A;  5HXR A;  3FID A;  3B5M A;  2IW5 B;  1KT6 A;  3A8Y C;  5KDM C;  2KTS A;  3SLJ A;  4QQ1 A;  1T8B A;  4IDZ A;  3PTR B;  4IB9 A;  3SOT A;  2H89 A;  4DUZ T;  2G78 A;  3MBT A;  5LMN T;  2GC9 A;  2I5V O;  4U72 A;  2BKP A;  3CMP A;  2X66 A;  3P6C A;  2VFC A;  2GTL N;  3UU5 A;  1IFC A;  3LFM A;  4NXM T;  2OL7 A;  3D9W A;  3B13 A;  3I9W A;  5FYM A;  1SLE B;  1GT5 A;  3QNU A;  1LF7 A;  4F6R C;  2BS5 A;  4CI3 B;  3P02 A;  2VFB A;  1JYD A;  2IML A;  2CZT A;  1E7P A;  2HKD A;  1N0S A;  4JO6 A;  1G7N A;  4C5P A;  1KZX A;  2A0A A;  1R8I A;  2ASN X;  3NBX X;  5FQ8 E;  3CQR A;  2CA5 A;  3J7Y q;  2B1E A;  1SRG A;  5AQI B;  4GK0 E;  3APU A;  5TAO A;  5LJK A;  5AFU L;  3HWG A;  1S94 A;  2CCQ A;  5LA6 E;  3D95 A;  3VG5 A;  3CIR A;  4YFS A;  2WUT A;  4I55 E;  2FWV A;  5B29 A;  2MTQ A;  1QG5 A;  4HFB A;  3ZEF B;  3P4Q A;  4K19 A;  3MZK B;  1PTS A;  2XAH B;  1VWP B;  4XMC A;  2ACO A;  4YMY A;  4AQY T;  1W9R A;  2RTH B;  2XAJ B;  3SLO A;  4JNJ A;  1ZND A;  4N7C A;  3E0Z A;  2RP4 A;  3SZJ A;  5JR9 B;  2QO4 A;  4MVE A;  2L8K A;  1VWN B;  2CWY A;  1HBQ A;  5FMN A;  2JQ9 A;  1S44 A;  3NX1 A;  2J1D G;  3HL6 A;  4XAX B;  4TLJ A;  1IAP A;  4Z8X A;  1G73 A;  3UUM A;  4DR2 T;  3BK9 A;  1XWM A;  3ZCJ A;  1SWE A;  4Y5D A;  4YFR A;  3ZSS A;  2FGS A;  5FKY A;  5K06 A;  2QOM A;  4U2Z A;  3FW4 A;  5K68 A;  4NPP A;  3ZYK A;  5LOV E;  3QOF A;  1BJ7 A;  1ZHC A;  1B56 A;  3JCF A;  3FR4 A;  5HCJ A;  3H3M A;  3WJC A;  4CPF A;  5B27 A;  4QYN A;  1N33 T;  1U18 A;  3AE7 A;  3ETU A;  2XQ9 A;  5L3D B;  3P4W A;  2IZA A;  3BLG A;  4QGV A;  5HXE A;  2QVA A;  4I60 A;  2UXN B;  4U3C A;  3EYC A;  4JI8 T;  1J1J A;  4KHZ F;  1X8Q A;  3B2J A;  3ZMV B;  2O62 A;  1PBO A;  2QO6 A;  1CUN A;  3FB2 A;  1ZNK A;  3RBY A;  4HWI B;  1ADL A;  1RST B;  1BRP A;  1VCT A;  4CDF A;  3E08 A;  2WR6 A;  3AEF A;  2VVS A;  5JR9 C;  4OFZ A;  2W63 A;  1Y53 X;  1MIV A;  2B76 A;  4JLE A;  4MAL A;  1QFV A;  2K23 A;  3ETV A;  3F9D A;  3HWF A;  4BX7 A;  3Q9D A;  1UYO X;  3M65 A;  3N2O A;  1SY3 A;  2WWU A;  3A5X A;  3OKQ A;  5HAE A;  5FXZ A;  2E5V A;  2HHH T;  4A1H A;  4HE8 A;  1LNM A;  4ZZB A;  2DLR A;  2RTO B;  2XQ3 A;  3O19 A;  2RPA A;  5L8N A;  1XDP A;  1KL3 A;  1NGL A;  1BR4 A;  2K24 A;  4EKV A;  2DWK A;  3AKN A;  1WR6 A;  1NEK A;  4NIQ A;  5FY0 A;  2HPL A;  2PG8 A;  4LKP A;  2F09 A;  2N93 A;  4D6B A;  3BSZ E;  1Z0P A;  1LPJ A;  4JI3 T;  1NQM A;  2OL8 O;  2BS4 A;  1BR0 A;  4HEA A;  2JMB A;  2OY7 A;  3QUJ A;  4LF4 T;  5JTG A;  3BQI A;  1LCW A;  4XMG A;  2RTI B;  4UVB B;  3IFB A;  4QX8 B;  1WLX A;  4OK0 A;  2Q9Q D;  4BJN A;  4CXX A;  2HZQ A;  4ILB A;  5CA1 E;  4UV8 B;  4AKI A;  1J5E T;  3U78 A;  2CXD A;  2XPK A;  4YSZ A;  2VKD A;  5CFB A;  3P6G A;  3WYQ A;  4ARH A;  1VYG A;  2HNX A;  3VE1 A;  5HCC C;  2VK9 A;  3LDQ B;  4TWH A;  3H37 A;  4IMO A;  3C77 X;  2M67 A;  1QSD A;  1NBX A;  5AJC A;  1GT3 A;  4AW8 A;  4YJ3 E;  4O9S A;  5DQV A;  2WEX A;  3ZLI A;  3PK2 A;  2XSB A;  2X45 A;  4GRJ A;  3UEW A;  2HH7 A;  1SWB A;  4ILA A;  3RDS A;  2IFB A;  1XNR T;  1FEW A;  2Q9S A;  3RQU A;  3BS2 A;  1WFD A;  2QO5 A;  3CX6 B;  4NUU A;  2F4V T;  2LHR A;  3FEK A;  2J62 A;  1HS7 A;  5JH7 E;  2JU3 A;  4EEJ A;  2QA7 A;  5LJN A;  1NDJ A;  2OVA A;  2V6X A;  3PUQ A;  2RTP B;  4DBR A;  4BCS A;  2IIU A;  5HBS A;  5HCM A;  2IZL B;  1EAL A;  2CRB A;  1WYC A;  1QY1 A;  2UXX B;  1RXH A;  3UAQ A;  4IB8 A;  2PTF A;  4GU8 A;  3QB5 A;  1XMQ T;  3C50 A;  1JYJ A;  4CDC A;  1AJ3 A;  3EVY A;  2H88 A;  1HY2 A;  2POA A;  3PPT A;  1E06 A;  1H7C A;  3RI5 A;  2OV9 A;  2BKO A;  2D2S A;  1VPR A;  4Y0P A;  4ZHH A;  5H9L A;  3AEG A;  1LCV A;  1MEP A;  5JDG A;  1D2U A;  5L3F B;  4OYK A;  3AE9 A;  4ZI2 D;  3KV4 A;  3ANW A;  5JD2 A;  2CE7 A;  4L0R A;  2XQ4 A;  1UK5 A;  2AT8 X;  5BVQ A;  5LG3 A;  5HZ9 A;  4AQF A;  2FRS A;  4HTE A;  3EUH A;  1MIY A;  3STN A;  5ABF B;  2A5C A;  2LOP A;  3T6L A;  3T1D A;  2X0H A;  4M1P A;  5BVT A;  3AAE B;  4B3S T;  4H9O C;  1JJJ A;  4HN9 A;  1BR2 A;  4P1N A;  1KFF A;  4WZX A;  4ILC A;  3AED A;  4CSB A;  4GH7 A;  1VWL B;  2ZM8 A;  3LG7 A;  2Y3F A;  5LJG A;  1I04 A;  4Z91 A;  4ID2 A;  4EGW A;  4LKT A;  1OED A;  3FBL A;  1YUP A;  4YCE A;  2E9X B;  1EQD A;  1ZRY A;  5B5G A;  4ZH9 A;  2V7M A;  3ZT6 A;  3SFE A;  3PUZ F;  4CDE A;  4O8S A;  2LSJ A;  3N9Q A;  3RZY A;  2CBI A;  2FUP A;  4TKB A;  5J2T E;  2BKN A;  1KOI A;  1BWY A;  1GX9 A;  2LBA A;  4A5X A;  1SLF B;  2KT4 B;  1KK7 A;  3NR3 A;  5L47 A;  3FLL A;  4A60 A;  2C5K T;  4B3R T;  2FR3 A;  4U2Y A;  1DZP A;  3OVU A;  2XAS B;  3GE2 A;  1WRD A;  3HA4 A;  3IBP A;  2ZMA A;  5FY7 A;  4X64 T;  2VKJ A;  4HFD A;  4HWM A;  4FQB B;  4ON1 A;  3RH3 A;  4QAE A;  1BEB A;  4G2A A;  3CQX C;  1OBQ A;  3U03 A;  1MVG A;  3FA9 A;  5FXW A;  2MJI A;  3VR8 A;  1D3S A;  3PUY F;  3EBK A;  3U0D A;  3UU3 A;  4BX5 A;  4ZHC A;  1DF8 A;  1GKA A;  3P6F A;  1U5P A;  4KII A;  3TF6 A;  1O1U A;  3FZF B;  3K3Q C;  1E02 A;  3LV4 A;  1JBH A;  5FAZ A;  4C90 A;  3JQO A;  3NPO A;  2YIN A;  4LF7 T;  2CBJ A;  4TV9 E;  2Q2M A;  3NQ9 A;  3T2W A;  3ZQ3 A;  2BVL A;  2LOS A;  2VQE T;  3CKG A;  1W09 A;  4M6S A;  4AZN A;  4BJ8 A;  3N9O A;  1SMP I;  4EOZ B;  4I9S A;  4Z27 A;  4NLJ A;  5ABH A;  3RY1 A;  5AQ6 A;  4XMH A;  1FTP A;  2GTL O;  4YTM A;  3MX7 A;  5DQW A;  4KH8 A;  5K67 A;  3CWK A;  2R74 A;  3C78 X;  3AE5 A;  2NWB A;  5AQH B;  3C4W A;  4ZXL A;  3R84 B;  1IBL T;  5IRU A;  1MMN A;  4DMV A;  4DND A;  4OS0 A;  2YMS A;  4YFQ A;  1OED B;  5F1E A;  1GM6 A;  4JI4 T;  3ONX A;  5HTD A;  4AXP A;  3JS1 A;  4IBA A;  2X8S A;  4ZJ0 A;  4KI0 F;  3N9M A;  4M7M A;  1UUS A;  2BHV A;  2IHR 1;  3LHN A;  3KFI A;  2A2F X;  4MEE A;  3CX7 B;  5FXX A;  2AT6 X;  1NAF A;  4O4U A;  1HCI A;  4P0B A;  2BBH A;  3T2X A;  2DL1 A;  4U9C A;  3D96 A;  3SAO A;  2LFO A;  3EW2 A;  2JPF A;  3Q5D A;  4OMW A;  3AEH A;  3RDX A;  3FR2 A;  4EXT A;  5AQK B;  2KWI B;  2UXD T;  1DZK A;  2FHL A;  3AE4 A;  5FEN A;  1HTJ F;  2R6G F;  5LMU T;  2E9X A;  1Y52 X;  4EQA C;  2V7L A;  1QUU A;  1O1V A;  2AVI A;  4P09 A;  1KQW A;  4GDA A;  1VWM B;  3OYZ A;  4YGZ A;  2RA6 A;  1I9H A;  4JEH B;  1JNR A;  3RYF E;  4QH1 A;  1NC9 A;  1GX3 A;  4QZU A;  4CN6 A;  4HPD A;  2C1Q A;  4MBQ A;  2P9B A;  2Y6X A;  5IRW A;  1GQE A;  3GA8 A;  5LGU B;  1PEE A;  4CDD A;  1KEY A;  3ZWE A;  2RTM A;  4AZO A;  1Y0G A;  3O22 A;  4GDZ A;  1CBR A;  1Y9T A;  2RTR B;  4GZV A;  5IO5 A;  4TN7 B;  3EAB A;  4A56 A;  3WJG A;  1JMZ A;  2I0M A;  5AQM B;  1VWA B;  2X55 A;  3N9N A;  3I0Q A;  5JDF A;  1SWP A;  1BLR A;  4OKA A;  1YIV A;  2IAK A;  2ACX A;  4DV1 T;  1KGL A;  4O49 A;  2K48 A;  4EYY R;  1LKX A;  5HXH A;  4YCH A;  2C5I T;  3S60 A;  1HR0 T;  2JGS A;  1Z8U A;  4JI6 T;  4GNY A;  3X1D A;  2GJ5 A;  2LSG A;  3UU6 A;  2MWH A;  5EDB A;  4HWF A;  3UEU A;  5KX5 E;  3APW A;  5D48 A;  1YWA A;  3IEE A;  3I1A A;  4ZI2 C;  4WHI A;  5JRE A;  2D0T A;  4EZ4 A;  4DO0 A;  2WMN A;  3BX7 A;  4IRE A;  3RIU C;  3O9X A;  1HQP A;  3F8A A;  2V1D B;  2Q9Q A;  4O2B E;  2L9C A;  3ANW B;  3VHM A;  3FEP A;  2IZF B;  4BOE A;  3SRZ A;  2WQY A;  3I0O A;  2CXL A;  5CE4 A;  3ZN0 B;  1OSP O;  1BSY A;  2QM9 A;  4ZI3 D;  5F6Z A;  4EXZ A;  3B2H A;  5HWY A;  3KFG A;  2JW1 A;  3CBC A;  4YSX A;  2V7K A;  4DV2 T;  2RQ0 A;  4DR5 T;  4Q25 A;  2YU2 A;  2YDQ A;  4K0U A;  3FHN A;  1KNZ A;  3RE5 A;  1W0A A;  1HX1 B;  1SWS A;  5B10 O;  2E9X D;  3L4R A;  4ZI3 C;  1HX8 A;  2JIW A;  3EI0 A;  1JJX A;  1ZNG A;  3KVB A;  5CYB A;  3VG6 A;  3TGB A;  2V5D A;  2LHN A;  3D4R A;  3WBG A;  1QQS A;  1E5P A;  2W62 A;  5L8I A;  1SWC A;  1OXZ A;  5AQO B;  3SWH A;  1NWM X;  2JQK A;  1HBP A;  5LBQ B;  1N7Y A;  2K9A A;  5JRC B;  1STR B;  5L3B B;  1X89 A;  2WBL A;  3F57 A;  5LJC A;  3AB3 B;  5IO6 A;  3MM0 A;  4INN A;  4GD9 A;  3K3N A;  2YKS A;  4AIS A;  4NYR A;  2M6I A;  1QWD A;  1TOU A;  2FS7 A;  2UZ2 A;  1SY0 A;  1ZEE A;  1EPA A;  3APV A;  4CI1 B;  3FW5 A;  4JHQ A;  2VAS A;  2EU7 X;  4TNN A;  3RE6 A;  4PJM A;  2QGS A;  1W6F A;  4I4T E;  2BS3 A;  5AQT B;  1IJ8 A;  1GXA A;  3WXQ A;  4BX7 B;  5LKE A;  3P8C D;  1E00 A;  2QYW A;  4B3T T;  2W2A A;  4YTP A;  5C8Y E;  4L9I A;  3UFE A;  5B3M O;  3HWD A;  4AKG A;  4YKO A;  1VRB A;  4E7Z A;  4PFP A;  3RF1 A;  5B2A O;  3C64 A;  5LHI B;  1ZP0 A;  1HXZ A;  4K0K T;  2AT5 X;  4MFR A;  3AVR A;  5DAB A;  2FTB A;  1MM9 A;  2XHE B;  5LP6 E;  4CV7 A;  5J1G A;  3VG4 A;  3AA1 B;  4YVB A;  4NNT A;  3LBX B;  4ORX A;  1ZNL A;  3NZQ A;  5EZ2 A;  1IBM T;  1XMO T;  4GIW A;  1IW2 A;  4EED A;  3HKD E;  2LM2 A;  2A3F X;  3OE3 A;  2M6B A;  3V5U A;  5HXS A;  2BZB A;  4H63 V;  3RY2 A;  2OYB O;  2OVD A;  4JI0 T;  2NW9 A;  1I94 T;  5HA0 A;  4NP1 A;  4U74 A;  1OEK A;  3RC3 A;  2UUC T;  2RTE B;  3RDQ A;  3UTK A;  4ORR A;  4X20 E;  3JAD A;  4IGU A;  3VGW A;  5JDN A;  1OED E;  4HFI A;  1DZM A;  3ZW0 B;  3T8O A;  4GKJ T;  1IBK T;  2XJ7 A;  4TUY E;  1OBP A;  3ZC1 A;  4ZGU A;  3OJA A;  5FNV E;  5FP3 A;  5L4H A;  5ABE A;  3RSW A;  1BSQ A;  4PJL A;  1QY2 A;  1N34 T;  4IE4 A;  5L3C B;  4AKL A;  2AMM X;  1KNP A;  4GET A;  5HEU A;  1EII A;  4QHO A;  2LA7 A;  4FJO A;  1D0Y A;  4U7I A;  2XST A;  1VWJ B;  4GGZ A;  4DR6 T;  3D97 A;  1XZY A;  2ACP X;  4PJJ A;  2AKQ A;  3KV5 A;  2EHO A;  1VWQ B;  4U8U O;  3UUB A;  3BY0 A;  2C4I A;  1YQ3 A;  3IHR A;  4DR7 T;  2LJL A;  3VHL A;  4UU2 A;  3KBU A;  2ACZ A;  3WZN A;  2RTJ A;  2V7I A;  3NQK A;  3RQW A;  1A18 A;  1IKE A;  3PUW F;  2OFM X;  4O4X A;  2XQ5 A;  2LSY A;  3BU1 A;  3F2E A;  1I6Z A;  3PUA A;  3TKL B;  4AKH A;  4KUM B;  1LFO A;  5HYA A;  2N2N A;  3UUL A;  2EHO C;  3LBX A;  4DNE A;  4HWD A;  3P6D A;  4LFB T;  2OF9 A;  3LK3 B;  1O8V A;  1RLB E;  2BG9 B;  4MIR A;  4ZS3 A;  2FJD A;  5FFH A;  1W5R A;  3B2K A;  1UCU A;  3SS1 A;  2D0U A;  2XTL A;  4IAX A;  4BVM A;  4COT A;  4Z2V A;  2IUB A;  2ALL X;  5FQ6 E;  4UVC B;  3VR9 A;  4GK5 E;  1MX7 A;  3PUV F;  1HMS A;  2YU1 A;  4UEM A;  5CB4 E;  3RYH E;  3BU9 A;  1VWC B;  3QK6 A;  2AXD S;  2YDR A;  4YLH A;  4JI5 T;  2YN6 A;  3TZS A;  2OA5 A;  4QKN A;  1IZN B;  2RTD B;  5LJM A;  1X8P A;  2Y3E A;  3O4X E;  2FKJ A;  2L5P A;  3AA7 B;  2Y48 B;  4PFO A;  3FZH B;  1BSO A;  3PEC A;  4NNS A;  4OMX A;  4QWN B;  2H7V C;  1VWD B;  2OY1 O;  3Q5X A;  3AEA A;  2A72 A;  1FEL A;  3DTO A;  4EEB A;  5F8P A;  5HZ8 A;  3C51 A;  1FDQ A;  5AQQ B;  1T8V A;  2UYW A;  4LMJ A;  1UZ2 X;  4UIG A;  5B11 O;  3EBW A;  4O4O A;  1G85 A;  4ZEY A;  4O4J E;  4CQI A;  1X79 A;  3CX8 B;  3LK2 B;  4YSY A;  2AT3 X;  4RUU A;  5EDC A;  3HTY A;  1ZV4 X;  3N9P A;  4BX6 A;  1MMG A;  1VWO B;  4WBN E;  2IZH B;  4IB6 A;  1SXY A;  3NWI A;  2VB6 A;  3B57 A;  4X65 T;  1JJU A;  3FDC A;  3AKM A;  3G06 A;  2CPT A;  1NP1 A;  3QQ2 A;  2DM5 A;  3FEN A;  3ZW2 A;  2Q39 A;  4R0B A;  3RWX A;  4CPH A;  1SE7 A;  3PU8 A;  2HMB A;  1MND A;  1K24 A;  3C98 B;  1VWB B;  5HCD C;  1SWQ A;  4GNW A;  1YP6 A;  2V8S V;  1U17 A;  3UQ7 A;  3TLS A;  5JR8 A;  3ZPO A;  4IDN A;  2FJB A;  4LF8 T;  4DV5 T;  2YEV C;  2KXP B;  4DV7 T;  2XSA A;  2WDR A;  4AIU A;  5L4E A;  5LHG B;  2C1S A;  4KP3 C;  5D8J A;  2ZM0 A;  5IWA T;  2SPC A;  3GMI A;  2KIN B;  1K3B A;  1AVE A;  3FXE B;  1E1H B;  2NNQ A;  4IDQ A;  5AQV B;  1OPA A;  1US7 B;  5LGT B;  1PMP A;  2HN1 A;  1SWR A;  4I50 E;  2ES0 A;  4JBW F;  2RD7 C;  1G5W A;  5HEG A;  4CXY A;  4QYP A;  1YXR A;  3LJC A;  1JIW I;  1LVK A;  5F7G A;  4YKM A;  3EW1 A;  3U3I A;  5LB7 B;  1SLD B;  3ZJ1 A;  2W0G A;  3CQG B;  4EZH A;  1AB0 A;  3V5S A;  5LJE A;  3OTO T;  5L8O A;  1I05 A;  3CQC B;  5IUX A;  4U8U M;  1FMW A;  1TXL A;  1OPB A;  4O2A E;  3OBV E;  3APX A;  3STM X;  3GAQ A;  4QRL A;  1LIE A;  2AF5 A;  1SRH A;  4GUZ A;  4IMN A;  2WQ9 A;  3OBL A;  4QXB B;  1A3Y A;  2LBV A;  3TGA A;  1YW0 A;  2QOS C;  1LDQ A;  4G63 A;  2N9D A;  4H9S E;  2HPJ A;  5D45 A;  3RIU A;  3HOL A;  1LIC A;  3UQ4 A;  3WJE A;  4O3Z A;  2OFB A;  4TX5 A;  3I0A A;  3HKE E;  1S7D A;  4JGL A;  5EK3 A;  5AQF B;  2WS3 A;  5ABF A;  2IZG B;  2KLQ A;  2DCF A;  3NRX A;  2AH7 X;  4WYV A;  1BM5 A;  5L3Y A;  5EK2 A;  5HZ6 A;  1AEL A;  5E0O A;  3AA6 B;  2F01 A;  1IJ5 A;  3HOE A;  5LG4 A;  1XKI A;  4AZP A;  2E2A A;  1R0U A;  4LF6 T;  1SWH A;  2L67 A;  3AEE A;  1FEM A;  2FT9 A;  1ZKE A;  2KT9 A;  1SRE A;  4WW0 A;  4GGT A;  3PQS A;  1MOY A;  4GJV A;  5AJB A;  2XM1 A;  1L6M A;  2LSI A;  1SHZ C;  4UU3 A;  4QX7 B;  4JI7 T;  3UU4 A;  4Z6J A;  1MK5 A;  2A2U A;  1LIB A;  2YK0 A;  4ZOL E;  3K3O A;  4UF0 A;  4IE5 A;  1ZNE A;  4WBK A;  1FEN A;  5FL1 A;  3VG7 A;  4DUY T;  3LSV A;  5FQ7 E;  1LEL A;  4DCB A;  2LRL A;  2CM9 A;  3K8P C;  1LVF A;  3TGC A;  3FZL B;  2LM9 A;  2XAG B;  5HWZ A;  5AEO A;  1D0X A;  2LE8 A;  1RXJ A;  3PP6 A;  5JDQ A;  2BLG A;  2KND A;  5DJQ C;  4YY3 T;  4PK6 A;  2UUB T;  4LF5 T;  2ODU A;  1N4J A;  1SXW A;  4UVA B;  2C5J A;  3VRB A;  1TOW A;  1OED C;  4I3B A;  4UEL A;  1HF8 A;  3HWE A;  2OF8 A;  4ILU A;  1B0O A;  3DSZ A;  1YKE B;  3NX2 A;  2NR4 A;  1SLG B;  2KW1 A;  2WB5 A;  1CJ5 A;  3HK1 A;  4Z28 A;  4J2C A;  3RLF F;  1Y9L A;  4MVK A;  5H9A A;  1VWH B;  5D4A A;  3KFW X;  1RAV A;  3ELZ A;  3FIQ A;  4ZHG A;  2UU9 T;  2WMO A;  3SLT A;  3IF8 B;  1PM1 X;  3KIN B;  1D0Z A;  3P4S A;  2RTN B;  3N91 A;  4PNI A;  2NND A;  4ML7 B;  5L3G B;  1HNZ T;  2NW7 A;  3ZKR A;  3ZJ2 A;  1KFY A;  1MMD A;  4NUV A;  3U9P C;  3RIF A;  1N9Y A;  1PBY A;  1KT3 A;  1DF3 A;  2AL0 X;  3ZUI A;  3RX6 A;  1KT5 A;  1XCA A;  1RXK A;  4TNV A;  2CWO A;  5C2T A;  1IFB A;  4Y59 A;  2IZJ A;  3FZM B;  4ORW A;  2OLT A;  1SWO A;  1OEE A;  2CHN A;  2X9W A;  1SRJ A;  3AAA B;  3AE2 A;  2HLV A;  2LRK A;  4H9P C;  1RBP A;  3KV6 A;  3RGL A;  2DJG A;  2NTX A;  5AQP B;  2OY8 A;  2WZH A;  2CBS A;  3JC6 D;  4E7S A;  3TLU A;  3CK6 A;  3RKO A;  2BVM A;  4Y0Q A;  2LT3 A;  4ADZ A;  1LID A;  1ACD A;  2Q4N A;  1H91 A;  2YOE A;  4CN1 A;  2MAW A;  1DU2 A;  2CLY C;  3NP1 A;  2NP1 A;  3Q5W A;  1EUO A;  3S26 A;  2IC6 A;  1WCR A;  3BQL A;  1X9B A;  3WAK A;  3ONJ A;  4WNK A;  1MMA A;  1LKE A;  4AZM A;  1T72 A;  5H9K A;  3ZUO A;  1QAB E;  2MBG A;  2E9X C;  1KNR A;  1ZNH A;  4HFC A;  4HPA A;  5JDH A;  1OBU A;  2BC3 A;  4ALB A;  3AXJ B;  3CPZ A;  2LLY A;  3MXZ A;  4PAG A;  4XMD A;  3F6Z B;  5BR8 T;  1E2T A;  1MIW A;  4JUY A;  2Y32 A;  3RDU A;  5L3E B;  2RCQ A;  3CWZ B;  2X32 A;  5HAX A;  2PY1 A;  3FA7 A;  3QB5 K;  3MA9 A;  5CSE A;  5AQJ B;  2ZSC A;  2ANS A;  4OX9 T;  5LJH A;  3SZI A;  2W61 A;  3P7I A;  2QMI A;  4EIW A;  4DV6 T;  2RTA A;  3AE1 A;  3FEL A;  4EAH A;  4DVD A;  1HQQ A;  4QZT A;  4NXN T;  1TW4 A;  2W00 A;  2MF6 A;  3UT5 E;  3RDM A;  2FBW A;  4BX6 B;  2CEA A;  2OFR X;  2CM0 A;  4I0U A;  3STK A;  1CBI A;  1MUP A;  1ICN A;  3J9X 1;  4AI6 A;  2RA1 A;  2JQQ A;  5LHH B;  4GJS A;  3EHZ A;  1XNQ T;  4O3X B;  1X8O A;  4ODD A;  4B6X A;  4WBO A;  4I43 B;  4N7D A;  2PBI A;  1HG5 A;  2V7J A;  3P6E A;  3AE3 A;  3ZYL A;  2CMR A;  3BRN A;  3CQN A;  1LDO A;  4YDB A;  3AE6 A;  5L2L A;  4P0A A;  4ORS A;  4GYS A;  4A98 A;  4O4I E;  3RDO A;  2JU7 A;  2LKH A;  5CA0 E;  1G74 A;  1EI5 A;  4ZHF A;  2L68 A;  2HN2 A;  3HKB E;  3I17 A;  2A3D A;  3N2K E;  1D1B A;  1T0V A;  3W15 B;  2YDS A;  3A7M A;  2EHO B;  1URE A;  1SRF A;  1QFT A;  2BG9 E;  2UXC T;  1SRI A;  4HWH A;  4Z90 A;  2EHO D;  2BSZ A;  2X4M A;  1AVD A;  2GH7 A;  4AZQ A;  2X9H A;  1HXL A;  2W4X A;  3VHI A;  4QXH B;  4IL4 A;  2I5Z O;  5J2U E;  3RRC A;  1SWN A;  2K5B B;  3P50 A;  3KV9 A;  2BS2 A;  3ESL A;  3NKZ A;  4A97 A;  2H3R A;  4ZHD A;  1N43 A;  2DJF A;  3P4P A;  2KTD A;  2WDQ A;  4HFV A;  1QY0 A;  5AQN B;  1YP7 A;  1B4M A;  4DV0 T;  5AQR B;  5BMV E;  5HEJ A;  2RTF B;  2VKO A;  1VYF A;  4OS3 A;  4L3R A;  3RYC E;  1Z24 A;  1CBQ A;  1NP4 A;  2Z6E A;  3X00 A;  1TVQ A;  4HKA A;  1VCS A;  4X1K E;  3L8R A;  4YTN A;  1T68 X;  1Y55 X;  1EXS A;  3RIA A;  2A8G A;  1OEJ A;  3FMZ A;  5KMG P;  3PJA A;  4TZ4 C;  3OYX A;  5JRC A;  4GKC A;  4OHF A;  1SA0 E;  1M7K A;  3EDV A;  2JJ9 A;  2GTL M;  1EIO A;  2IDO B;  2RTL A;  1STS B;  5LNK A;  1ML7 A;  4DR3 T;  3KDS E;  5HEO A;  2K3W A;  2KZ7 B;  1GT1 A;  2I59 A;  2FR2 A;  4JV5 T;  1LUQ A;  2BS6 A;  2FLJ A;  2XM2 A;  1IIU A;  2LB6 A;  2WU2 A;  3HPE A;  4I9R A;  3T1Y T;  5JDM A;  4GGR A;  3ZT7 A;  2VL0 A;  2NTY A;  1BBP A;  2KWH A;  4IE7 A;  1SWG A;  1SWF A;  1VWI B;  2G79 A;  3PH5 A;  3PJA J;  3ZMT B;  2W2U A;  3UU8 A;  1A2D A;  2FKG A;  1SWU A;  4LZV A;  4YGH A;  3GN5 B;  4Y0S A;  4CPI A;  5F58 A;  3VU7 H;  4OYJ A;  4GOU A;  2JQH A;  5LXT E;  4OEL A;  1SY1 A;  2V5C A;  3AA0 B;  2A13 A;  3WZP A;  2JOZ A;  2K62 A;  2WWP A;  1O3X A;  1LRZ A;  4UXN B;  4N78 D;  5KXJ A;  2IZD B;  3UEX A;  4CPH B;  4YT0 A;  3T1H T;  3UUN A;  1EPB A;  4LMK A;  3ZST A;  3MKD A;  2BT9 A;  5IO7 A;  3VG3 A;  3F31 A;  4AZR A;  1SUM B;  2Y8D A;  2P8G A;  1G8X A;  1JZU A;  1EZ3 A;  2A5B A;  2Q9Q C;  2X34 A;  4ZFX A;  4DV3 T;  2VQF T;  3MAC A;  2MOZ A;  1B8E A;  1VWE B;  5HCE C;  5EPQ A;  3ZMU B;  3AE8 A;  2IZI A;  5H8T A;  3RPU A;  2PJQ A;  2WWV A;  2ZAG A;  4QGW A;  2X67 A;  4YH0 A;  3DTQ A;  3N5L A;  4U46 A;  3C76 X;  2XQ7 A;  5IYZ E;  2CHO A;  4DBQ A;  4DR4 T;  1IKJ A;  4NLI A;  4ZR2 A;  3ZW0 A;  3QC9 A;  3KVA A;  4LFA T;  4FGI B;  4NW4 A;  4DQ4 A;  1BRQ A;  3ZZV A;  3ZW1 A;  3NAD A;  5C3J A;  2XQ8 A;  5H9N A;  3ZI8 A;  4CI2 B;  4KBM B;  3PED A;  4QXC B;  2DHR A;  2HZR A;  4IAB A;  4MIS A;  1AQB A;  4IHJ E;  1W4T A;  4JYA T;  2MYS A;  1SY2 A;  1KL5 A;  2X9X A;  4H9N C;  2RN4 A;  4GK9 A;  5H6Q B;  4KHP T;  3KZA A;  2BG9 C;  1GKA B;  3I9Y A;  2ZAI A;  1KZW A;  4QH5 A;  4X5T A;  4IDP A;  1MX8 A;  4UR9 A;  3O1I A;  4PK4 A;  3AAI A;  2VVN A;  5ADX L;  4NV7 A;  3S4U A;  2PFV A;  3WJF A;  2HYS A;  2PI3 O;  2JRK A;  5CGM A;  2MO5 A;  4U33 A;  1YQ4 A;  2IZB A;  3PUX F;  1SWK A;  5HZ5 A;  3OPC A;  2NOX A;  3HKC E;  3PDY A;  4ORY A;  4O4H E;  5IHY A;  3VRA A;  5FL0 A;  3AXJ A;  2BBJ A;  3P24 A;  4ES7 A;  4DV4 T;  3GWH A;  3RRW A;  4KC7 A;  4UV9 B;  4IE6 A;  2E4J A;  4ERR A;  3Q2M A;  2MHD A;  3KVN A;  4AQG A;  4TKJ A;  1SA8 A;  2VL8 A;  4BJM A;  2Z4I A;  2Z4H A;  1HN2 A;  4IDO A;  1HNW T;  4BX5 B;  4ZS2 A;  4IT4 A;  4DR1 T;  4PJN A;  4YXD A;  3V8U A;  4ZI7 E;  5F3J A;  4GKK T;  2I6H A;  2C0S A;  3EDU A;  5CJ5 A;  3CKF A;  2WSJ A;  4MLK A;  3L09 A;  4OEM A;  2J4G A;  1JV4 A;  3E3C A;  3KFF A;  4IL9 A;  4COF A;  2VKH A;  3IA3 A;  3BDR A;  5GON E;  4I95 A;  2H7O A;  1SWT A;  5LYJ E;  4HPC A;  4Z2P A;  1SXU A;  3MVF A;  5HEH A;  2RTQ B;  4U31 A;  3SFD A;  3D0T A;  3EAM A;  2L3L A;  4XZC A;  3K1S A;  4BBO A;  3KQ0 A;  1KT7 A;  1D1C A;  2LSK A;  5HXC A;  3OJY C;  3WI3 A;  2OL6 O;  1STP A;  4QH4 A;  2IC9 A;  3OD9 A;  3H3A A;  3RYI E;  1XDO A;  2CAM A;  4QNI A;  4KCA A;  5KID A;  2G5L A;  1X8N A;  4CN4 A;  1S2P A;  1W0B A;  4Y0R A;  2D9D A;  3VKH A;  3C4Z A;  3PUG A;  4IIJ E;  2WM9 A;  3Q5E A;  4IAW A;  2WZI A;  2FJA A;  1ALB A;  2ZM2 A;  1I4U A;  2NW8 A;  3PU3 A;  4AKR B;  2Q2P A;  4IE0 A;  4WFU A;  2LKG A;  3UFG A;  1P6P A;  4LML A;  2JU8 A;  5EEE A;  3PQU A;  4IST A;  2QCB A;  3CBS A;  2FJE A;  1FIO A;  3ZMZ B;  2VDF A;  4NYQ A;  2XAQ B;  3FR5 A;  4O4L E;  2OFA A;  4PSQ A;  3MG5 A;  5BYP A;  1FMV A;  1VYO A;  2XKL A;  1QLB A;  2WSS V;  2X9Y A;  4TWF A;  5ETW A;  2J47 A;  1MDC A;  3WJD A;  2XAF B;  1Y64 B;  4ISS A;  3ABV A;  1SWJ A;  5ABG A;  1N9M A;  4Z2O A;  5HWX A;  1EW3 A;  1FE3 A;  4PJ2 A;  4TJZ A;  3C4X A;  2DWG A;  3UUX B;  4DQ3 A;  4EYU A;  1ERX A;  1IJ6 A;  4O3Y A;  2XZE A;  2JN3 A;  4O4S A;  4WFV A;  1HMT A;  2MM3 A;  1LIF A;  2LKK A;  4JI2 T;  1JMX A;  1HMR A;  5DG4 A;  3ZMS B;  1U4Q A;  2WEW A;  5EK4 A;  5JQG E;  3WOV A;  1E2A A;  2UUA T;  4KMC A;  1N36 T;  4IRW A;  1HG2 A;  3VHH A;  1YD8 G;  2JMK A;  1SXX A;  1X71 A;  1SWD A;  3ELX A;  4AYH A;  2ZM6 T;  3HR0 A;  2XQA A;  2BG9 A;  2XQY A;  1FJG T;  2V26 A;  4CK4 A;  5A1L A;  1U0X A;  5AQG B;  3WYP A;  2WU5 A;  5J0Z A;  4O3W A;  5CHK A;  4L5G A;  2E8I A;  4BAY B;  1SWL A;  5JVD E;  2X0Y A;  3LK4 2;  2LEH A;  2RCT A;  2ZLY A;  4EDE A;  3ZN1 B;  3M3Z B;  4PK5 A;  2XUE A;  4NV8 A;  2DI4 A;  4YHH T;  3DJB A;  2G7B A;  2M4L A;  2X8T A;  1ERB A;  4V1A v;  4EFG A;  1KXO A;  1I06 A;  2NP9 A;  4XME A;  1UGO A;  4H9R C;  3SZH A;  3WZQ A;  5KIC A;  4U7Y A;  2W2F A;  4X1Y E;  3KFH A;  4H63 H;  4MVI A;  3FA8 A;  4A1Y A;  1JQP A;  2Q9Q B;  5HA1 A;  3O2Y A;  2E5L T;  5LBM A;  4GE1 A;  4YDA A;  2W67 A;  4MHC A;  1WBI A;  2A9U A;  2JMH A;  3SOL A;  2WAU A;  3RHW A;  5F2B A;  3NVO A;  4I3D A;  3ZYM A;  3CR6 A;  4L1N A;  3ZT5 A;  1FJ1 E;  3FXD B;  4EB6 E;  2KMF A;  3UEV A;  1GGL A;  4HPB A;  1X8U A;  1KL4 A;  3IA8 A;  2CM4 A;  2KSR A;  1CRB A;  2KD2 A;  3CKD A;  3Q34 A;  3BQK A;  1CBS A;  1RSU B;  2V6Y A;  1V9D A;  4UF0 B;  4IB7 A;  3AVS A;  1DFV A;  4RUN A;  4QGX A;  1DC9 A;  3QKG A;  5AQS B;  2NNE A;  5LJB A;  1A57 A;  2R73 A;  1I78 A;  4HWC A;  5F5W A;  2X51 A;  1T98 A;  3JAE A;  4CXW A;  3ZCI A;  4JI1 T;  5EED A;  2WPU A;  3VU1 A;  2D5U A;  1ICM A;  3PUR A;  4KX6 A;  1N32 T;  2F73 A;  4HFO A;  4KC8 A;  4LF9 T;  3K3L A;  3L39 A;  3AEB A;  3G7X A;  3NZP A;  1VOM A;  1JNZ A;  2GTF X;  1B7T A;  2X8F A;  1BR1 A;  3O1J A;  3R6N A;  4GYR A;  4U3Q A;  4B55 A;  2CXF A;  2W66 A;  5FY1 A;  4CPE A;  4TWD A;  3JC6 C;  1T7S A;  5FVK A;  3N2G E;  1WR0 A;  2WQA E;  3RKG A;  4YBU A;  2G8C O;  5LCY A;  4C91 A;  3AEC A;  2WY2 A;  5KHP A;  3MK7 C;  4JEU B;  4LFC T;  1OWA A;  4F8H A; 
#chains in the Genus database with same CATH homology
 4GH7 A;  2OVE A;  4I3C A;  4IAX A;  4BVM A;  4FBR A;  4COT A;  2IUB A;  2ALL X;  4GKC A;  5LJG A;  5FQ6 E;  1I04 A;  1MX7 A;  2CBR A;  1HMS A;  4ID2 A;  4EGW A;  4LKT A;  2GTL M;  3BU9 A;  3PH6 A;  1YUP A;  3S5X A;  1EIO A;  4YCE A;  1EQD A;  1ZRY A;  4ZH9 A;  3VPJ E;  1ML7 A;  3TZS A;  1KQX A;  3Q6L A;  1X8P A;  3RZY A;  2CZU A;  4EV6 A;  3BX8 A;  4TKB A;  5LJD A;  5HZQ A;  1GT1 A;  2L5P A;  1KOI A;  2AT0 X;  2FR2 A;  1BWY A;  1GX9 A;  2BS6 A;  2LBA A;  2KT4 B;  2FLJ A;  1DV9 A;  1BSO A;  3PEC A;  1IIU A;  3NR3 A;  3JSQ A;  3FLL A;  4NNS A;  4OMX A;  2LB6 A;  4A60 A;  2FR3 A;  4I9R A;  5LKF A;  1DZP A;  1BBP A;  3GE2 A;  1FEL A;  4EEB A;  5HZ8 A;  1FDQ A;  1T8V A;  2G79 A;  3PH5 A;  2OVS A;  4HWM A;  1UZ2 X;  4I6S A;  1A2D A;  4KT5 A;  4FQB B;  3EBW A;  4LZV A;  1AVG I;  4ON1 A;  4O4O A;  4QAE A;  1G85 A;  4YGH A;  1BEB A;  1KT4 A;  4Y0S A;  1OBQ A;  5F58 A;  3U03 A;  1MVG A;  3FA9 A;  4RUU A;  5EDC A;  2AT3 X;  3VE2 A;  2MJI A;  3HTY A;  1D3S A;  3EBK A;  1SY1 A;  3U0D A;  4LQZ A;  4XMF A;  4ZHC A;  2A13 A;  1GKA A;  3P6F A;  4KII A;  3TF6 A;  4ZGF A;  2JOZ A;  1O1U A;  2K62 A;  2WWP A;  1DZJ A;  1E02 A;  2X46 A;  3LV4 A;  2W2B A;  5C0N A;  1JBH A;  4IB6 A;  1SXY A;  2OZQ A;  2YG2 A;  3JQO A;  3NWI A;  5F6B A;  3NPO A;  5FAZ A;  3UEX A;  1EPB A;  3NQ9 A;  2Q2M A;  3AKM A;  3ZQ3 A;  1NP1 A;  1GT4 A;  2BT9 A;  2DM5 A;  4M6S A;  4AZN A;  3FEN A;  3NQ3 A;  1SMP I;  5IO7 A;  3ZW2 A;  3P6H A;  3B2I A;  4I9S A;  4YFP A;  2Q39 A;  3VG3 A;  4R0B A;  4NLJ A;  3RWX A;  4A8Z A;  4AZR A;  5AQ6 A;  2P8G A;  4ALO A;  4XMH A;  1FTP A;  2HMB A;  2GTL O;  1JZU A;  3MX7 A;  4ZFX A;  4KH8 A;  4FBV A;  3CWK A;  1B8E A;  2R74 A;  3H3I A;  5HCD C;  3C78 X;  3EMM A;  4FBO A;  4GNW A;  1YP6 A;  5HCE C;  5EPQ A;  1U17 A;  3EM0 A;  5JR8 A;  4OS0 A;  5H8T A;  2YMS A;  5DPQ A;  4D6A A;  4YFQ A;  5F1E A;  1GM6 A;  2ZAG A;  4QGW A;  2R56 A;  5HTD A;  3JS1 A;  3FA6 A;  4IBA A;  4BQU A;  5HTE A;  2X8S A;  3WVM A;  4YH0 A;  4ZJ0 A;  5D8J A;  3ZW1 B;  3DTQ A;  2A2G A;  3C76 X;  1YWC A;  4M7M A;  4YGG A;  1IKJ A;  4ZR2 A;  4NLI A;  4ORU A;  3ZW0 A;  2BHV A;  3LHN A;  3KFI A;  2NNQ A;  4FGI B;  4NW4 A;  4DQ4 A;  4TQ2 A;  1BRQ A;  1OPA A;  4OS8 A;  3ZZV A;  2AT6 X;  4O4U A;  3NAD A;  5D47 A;  1PMP A;  2HN1 A;  3ZW1 A;  5H9N A;  3ZI8 A;  2BBH A;  5BVS A;  3PED A;  4ZH6 A;  2HZR A;  4U9C A;  1YWB A;  4LZU A;  2RD7 C;  1G5W A;  3D96 A;  3SAO A;  2LFO A;  4IAB A;  4MIS A;  1AQB A;  1GX8 A;  4QYP A;  1JIW I;  4OMW A;  5F7G A;  3FR2 A;  4YKM A;  4ZCB A;  1YWD A;  3WJB A;  1DZK A;  3FYF A;  1SY2 A;  5FEN A;  4MVL A;  1AB0 A;  5LJE A;  2RN4 A;  4GK9 A;  3B2L A;  5L8O A;  3S5V A;  1I05 A;  4U8U M;  3KZA A;  4EQA C;  1GKA B;  2ZAI A;  1TXL A;  1OPB A;  1KZW A;  1O1V A;  4YBP A;  2FS6 A;  1MX8 A;  4U8U N;  4TKH A;  3VG2 A;  3APX A;  1KQW A;  3STM X;  3GAQ A;  4YGZ A;  3WJF A;  2HYS A;  4QRL A;  1LIE A;  1KT6 A;  2MO5 A;  4IMN A;  2RA6 A;  2KTS A;  2WQ9 A;  4QQ1 A;  3OBL A;  4IB9 A;  3SOT A;  5HZ5 A;  2LBV A;  1A3Y A;  3TGA A;  2QOS C;  2G78 A;  3MBT A;  4QZU A;  5D45 A;  2GC9 A;  3HOL A;  4HPD A;  4ORY A;  3CMP A;  1LIC A;  3WJE A;  4O3Z A;  3I0A A;  3P6C A;  1S7D A;  4JGL A;  1PEE A;  2GTL N;  2BBJ A;  1IFC A;  3P24 A;  4ES7 A;  4KC7 A;  3ZWE A;  4AZO A;  2E4J A;  3O22 A;  2MHD A;  2AH7 X;  1GT5 A;  4GDZ A;  1CBR A;  1SA8 A;  1Y9T A;  4TKJ A;  4GZV A;  1BM5 A;  5IO5 A;  2Z4I A;  1LF7 A;  2BS5 A;  2Z4H A;  3WJG A;  5HZ6 A;  1AEL A;  3P02 A;  1HN2 A;  3HOE A;  1JYD A;  2CZT A;  1N0S A;  1XKI A;  3V8U A;  2L67 A;  1R0U A;  4AZP A;  1G7N A;  1KZX A;  1BLR A;  2A0A A;  1FEM A;  2FT9 A;  1YIV A;  2ASN X;  3NBX X;  5FQ8 E;  3CQR A;  2WSJ A;  1KGL A;  3PQS A;  4O49 A;  5AJB A;  3APU A;  1L6M A;  5LJK A;  4UU3 A;  1JV4 A;  3E3C A;  3KFF A;  3BDR A;  3HWG A;  2A2U A;  1LIB A;  4I95 A;  3D95 A;  4YCH A;  3VG5 A;  3S60 A;  4HPC A;  1ZNE A;  4WBK A;  1SXU A;  3MVF A;  2WUT A;  1FEN A;  4GNY A;  3VG7 A;  2FWV A;  2GJ5 A;  5EDB A;  2MWH A;  5FQ7 E;  3UEU A;  5B29 A;  3APW A;  2CM9 A;  1QG5 A;  3TGC A;  5HWZ A;  4K19 A;  1YWA A;  5D48 A;  5AEO A;  3PP6 A;  4XMC A;  2ACO A;  4YMY A;  2BLG A;  3KQ0 A;  1KT7 A;  4WHI A;  1ZND A;  4N7C A;  3BX7 A;  1SXW A;  2QO4 A;  4MVE A;  1TOW A;  4I3B A;  3OJY C;  1HQP A;  1HBQ A;  3HWE A;  3F8A A;  1B0O A;  1S44 A;  3DSZ A;  3NX1 A;  3NX2 A;  2KW1 A;  2L9C A;  1CJ5 A;  3HK1 A;  4TLJ A;  1Y9L A;  4MVK A;  5H9A A;  3OD9 A;  3FEP A;  5D4A A;  4BOE A;  3ELZ A;  3FIQ A;  4QNI A;  4ZHG A;  4KCA A;  5KID A;  1X8N A;  1PM1 X;  4YFR A;  1S2P A;  3N91 A;  5CE4 A;  4Y0R A;  1BSY A;  2NND A;  4ML7 B;  2QM9 A;  5K06 A;  5F6Z A;  4EXZ A;  3B2H A;  3FW4 A;  4IAW A;  3U9P C;  1ALB A;  1I4U A;  3KFG A;  2JW1 A;  1BJ7 A;  2Q2P A;  3CBC A;  1B56 A;  4WFU A;  1KT3 A;  2RQ0 A;  1DF3 A;  1P6P A;  3JCF A;  2AL0 X;  2JU8 A;  3FR4 A;  5EEE A;  3ZUI A;  1KT5 A;  3WJC A;  5B27 A;  1XCA A;  3PQU A;  4QYN A;  3CBS A;  1IFB A;  1U18 A;  4NYQ A;  3FR5 A;  4PSQ A;  3BLG A;  3L4R A;  4ORW A;  4QGV A;  1OEE A;  5BYP A;  2XKL A;  3EYC A;  1JJX A;  1X8Q A;  1MDC A;  2HLV A;  3B2J A;  1ZNG A;  2O62 A;  1PBO A;  2QO6 A;  3WJD A;  3TGB A;  5CYB A;  3VG6 A;  1ZNK A;  3RBY A;  1RBP A;  1ADL A;  1BRP A;  3D4R A;  3WBG A;  1EW3 A;  1QQS A;  1E5P A;  1FE3 A;  4PJ2 A;  4TJZ A;  5L8I A;  2WR6 A;  4DQ3 A;  2CBS A;  1ERX A;  3CK6 A;  4O3Y A;  4Y0Q A;  1HBP A;  1LID A;  2JN3 A;  4O4S A;  1ACD A;  2Q4N A;  4WFV A;  1QFV A;  1H91 A;  2K23 A;  1X89 A;  5LJC A;  3F9D A;  5IO6 A;  3HWF A;  1HMT A;  2MM3 A;  1LIF A;  2LKK A;  3NP1 A;  5DG4 A;  4INN A;  1HMR A;  2NP1 A;  1SY3 A;  5HAE A;  1EUO A;  3S26 A;  2WEW A;  4NYR A;  1QWD A;  1TOU A;  2FS7 A;  4A1H A;  3WOV A;  1SY0 A;  3APV A;  1EPA A;  1LNM A;  1LKE A;  3FW5 A;  4AZM A;  1SXX A;  1X71 A;  2EU7 X;  3ELX A;  1QAB E;  3O19 A;  1NGL A;  4TNN A;  5H9K A;  3ZUO A;  1ZNH A;  4AYH A;  5L8N A;  3AKN A;  4CK4 A;  4HPA A;  1GXA A;  1OBU A;  1U0X A;  3WXQ A;  4ALB A;  5LKE A;  4LKP A;  1E00 A;  2F09 A;  2N93 A;  4XMD A;  3BSZ E;  3F6Z B;  4D6B A;  2W2A A;  4O3W A;  1LPJ A;  3HWD A;  4YKO A;  2JMB A;  2RCQ A;  2PY1 A;  5JTG A;  2RCT A;  4EDE A;  3FA7 A;  4XMG A;  3IFB A;  2ANS A;  2G7B A;  2M4L A;  2X8T A;  1ERB A;  2HZQ A;  5LJH A;  2AT5 X;  2QMI A;  4EFG A;  3FEL A;  1KXO A;  2FTB A;  1I06 A;  4XME A;  4QZT A;  5KIC A;  1TW4 A;  3P6G A;  4ARH A;  4CV7 A;  3VG4 A;  1VYG A;  2HNX A;  3VE1 A;  5HCC C;  2W2F A;  2OFR X;  3KFH A;  4I0U A;  3STK A;  1CBI A;  1MUP A;  3FA8 A;  4MVI A;  4NNT A;  1ICN A;  4A1Y A;  4ORX A;  1ZNL A;  4IMO A;  3C77 X;  5EZ2 A;  1IW2 A;  5AJC A;  4EED A;  1GT3 A;  4AW8 A;  5HA1 A;  4O9S A;  2A3F X;  2WEX A;  3O2Y A;  3OE3 A;  2X45 A;  4GRJ A;  4GE1 A;  3UEW A;  4O3X B;  1X8O A;  4ODD A;  2OVD A;  4N7D A;  4YDA A;  2IFB A;  2Q9S A;  3P6E A;  3BS2 A;  3BRN A;  3CQN A;  4YDB A;  2QO5 A;  4NP1 A;  5HA0 A;  3NVO A;  1OEK A;  3FEK A;  4ORR A;  4I3D A;  3ZW0 B;  4ORS A;  3CR6 A;  4L1N A;  1DZM A;  2JU3 A;  3UEV A;  4EEJ A;  2JU7 A;  1G74 A;  1EI5 A;  1OBP A;  2OVA A;  4ZHF A;  2L68 A;  2HN2 A;  4ZGU A;  3I17 A;  1GGL A;  4HPB A;  1X8U A;  3IA8 A;  2CM4 A;  3RSW A;  1BSQ A;  1CRB A;  1T0V A;  2KD2 A;  5HBS A;  1QY2 A;  1EAL A;  2AMM X;  1CBS A;  4GET A;  1QY1 A;  1URE A;  3UAQ A;  4IB8 A;  1EII A;  4GU8 A;  1QFT A;  2LA7 A;  4RUN A;  4IB7 A;  1DFV A;  2XST A;  1JYJ A;  4QGX A;  1DC9 A;  3QKG A;  3D97 A;  2ACP X;  2AKQ A;  2NNE A;  2POA A;  5LJB A;  3PPT A;  4U8U O;  1E06 A;  1A57 A;  3BY0 A;  2R73 A;  4AZQ A;  1VPR A;  4UU2 A;  4Y0P A;  3NQK A;  4ZHH A;  5EED A;  1A18 A;  1IKE A;  2OFM X;  3VU1 A;  5H9L A;  1ICM A;  2F73 A;  4HFO A;  4O4X A;  4KC8 A;  1D2U A;  3BU1 A;  3K3L A;  4ZHD A;  3G7X A;  2KTD A;  2GTF X;  1QY0 A;  2X8F A;  1YP7 A;  4U3Q A;  1LFO A;  2AT8 X;  1B4M A;  5BVQ A;  5HZ9 A;  1VYF A;  2WQA E;  2FRS A;  3P6D A;  4L3R A;  4OS3 A;  3RKG A;  1Z24 A;  3STN A;  1CBQ A;  4YBU A;  1NP4 A;  3T1D A;  1O8V A;  1RLB E;  1TVQ A;  5BVT A;  1T68 X;  5KHP A;  4MIR A;  1JJJ A;  5FFH A;  1EXS A;  3B2K A;  4CSB A;  1OEJ A;  3FMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...