3RKGA

Structural and functional characterization of the yeast mg2+ channel mrs2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
KQLLSLKPISASDSLFISCTVFNSKGNIISMSEKFPKWSFLTEHSLFPRDLRKIDNSSIDIIPTIMCKPNCIVINLLHIKALIERDKVYVFDTTNPSAAAKLSVLMYDLESKLSSTKNNSQFYEHRALESIFINVMSALETDFKLHSQICIQILNDLENEVNRLKLRHLLIKSKDLTLFYQKTLLIRDLLDELLENDDDLANMYLTVKKSPKDNFSDLEMLIETYYTQCDEYVQQSESLIQDIKSTEEIVNIILDANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the N-terminal domain of the yeast Mg(2+) channel Mrs2.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords Magnesium transporter MRS2, mitochondrial
total genus 89
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2011-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 3rkgA02
2.40.128.330 Mainly Beta Beta Barrel Lipocalin Lipocalin 3rkgA01
4EEBA 4EEDA 4EGWA 4I0UA 5JTGA 2BBJA 2HN2A 2IUBA 4EV6A 3JCFA 3RKGA 3CK6A 3NVOA 2BBHA 3NWIA 2HN1A
chains in the Genus database with same CATH superfamily
5H6QB 3EW2A 3PUWF 4UELA 3AEGA 3NWIA 1GT4A 5AQTB 2NP9A 1VWLB 3P6GA 1FJ1E 3DSZA 4ZI2D 2C1QA 4ILAA 2VDFA 4CDDA 2NTYA 5JDFA 2UUCT 1XNQT 3ZW1B 3QB5K 2ZM8A 4U8UM 3X1DA 5HZ5A 2AT5X 5L3GB 4ASKA 1YWDA 2A72A 3JAFA 3KV9A 4CDCA 3UU5A 5L8OA 1I6ZA 4HFCA 5L3EB 3EABA 3ZUIA 5TAOA 4Z91A 3SS1A 2G5LA 1ZRYA 2X8FA 3RDXA 3L3PA 4O4XA 1EIOA 2PTFA 2H88A 4GOUA 4DBQA 2Q4NA 4ZHFA 3RHWA 2X9XA 5EK3A 3EAMA 2UU9T 1X71A 4YJ3E 3HWDA 5JQGE 4CPFA 4HTEA 3V5SA 2QVAA 3N9PA 2A13A 3AEAA 1HNXT 3HR0A 4EFGA 5ABEA 4MIRA 2G78A 3KVBA 2GH7A 3MM0A 4NYRA 5CFBA 3PQUA 2Q39A 1GX9A 2UXDT 2MM3A 2LE8A 3BDRA 2GTFX 4AKGA 2IAKA 3KQ0A 5EDBA 3EBWA 3M3ZB 2CA5A 1X8QA 3ZCIA 3B2IA 2CWOA 3SRZA 4X65T 5EZ2A 3T2WA 3RY1A 3CQXC 5AQ6A 4I0UA 4CI3B 4PFPA 2Q9QC 1UREA 3UEUA 5LG3A 1HG2A 5LG4A 2F09A 3FR5A 4HFOA 3BU9A 4U3CA 4NYQA 1XKIA 1XDPA 4D6AA 2X55A 4HPBA 4O4OA 3K3NA 4L0RA 4EEDA 3C98B 3PUAA 1GT3A 5ETWA 4YTPA 2IZLB 3NPOA 3TLUA 4JI1T 1X8OA 3C77X 4OMXA 3ABVA 4U33A 2AL0X 1O1VA 2LSYA 4TV8E 4IE0A 2NW7A 2W2UA 4NW4A 2WDQA 4KI0F 3FZLB 1EALA 1FENA 3AE5A 4WZXA 4H9RC 4KC7A 4FI5A 3RIAA 2IZFB 1TVQA 2WQ9A 3PUXF 2AT3X 3NADA 4ALBA 5HZ8A 1SA0E 2MOZA 3LDQB 3ONXA 2ZAGA 5JD2A 5K68A 4LFBT 1MOYA 1HF8A 5C0NA 2LJLA 1BEBA 3G7XA 1IJ6A 1I94T 4AXPA 5HEGA 2FJAA 2RQ0A 3C51A 4YCEA 3CX8B 1KF6A 3ETVA 3FEKA 3CMPA 1H91A 2A3DA 3A8YC 1E1HB 5LGUB 3RC8A 4CI2B 2H3RA 2E4JA 2XAGB 3FIDA 5LHHB 3VKHA 4CQIA 4QXHB 2XSTA 5LGNB 1UYNX 3SLTA 3AEEA 4WBOA 4I9SA 4DUZT 1CHUA 2BS4A 1KEYA 4AQGA 2LEHA 2LM2A 1EUOA 2RN4A 4ILUA 4GKJT 2HZRA 3CR6A 4GJVA 3RYFE 1IBMT 3AA7B 4BA9A 2VVSA 3C64A 4DNDA 1KT3A 4U8UN 2MBGA 1STRB 4U2YA 2A0AA 4ISTA 2JU7A 4Z2VA 1J5ET 3AE9A 2XQAA 2FKJA 4IE5A 1SWBA 1Y53X 4KP3C 3PV0F 3PDYA 3P50A 2K23A 4HWDA 1MVGA 2UXBT 3FR4A 5L47A 3H3MA 1MX8A 1Y9LA 1HNWT 3OYXA 5FENA 5KX5E 1WYCA 2ACOA 4BBOA 1RSUB 1KT7A 1JNZA 4H63V 2AT6X 2F73A 2NW9A 3RWXA 3S60A 3N9MA 3O4XE 1SY1A 5CSEA 2IZCB 4GNWA 2FTBA 5CA1E 3AEFA 4EB6E 3PP6A 1D1AA 4GGTA 4HWCA 2KXPB 2N9DA 2NOXA 5C8YE 5LBQB 1QFTA 2WPUA 4YSYA 3A5XA 3NVOA 5HCMA 1YP6A 1EIIA 1SMPI 2VKOA 3NRXA 3KFGA 4XMHA 4KHPT 3PE0A 3N9NA 3KV5A 4PJNA 5HZ9A 5K67A 3AA0B 2RP4A 4I9RA 3I0AA 4O49A 2KTDA 2LSGA 3J7Yq 3OBLA 2E5LT 3ANWB 3FBZA 2KT9A 4RUUA 4YCHA 5J2TE 2XAFB 1SLGB 3ZN0B 2XQ5A 1OPAA 2MWHA 1SWNA 1Y9TA 4Y5DA 2X45A 3B2LA 4HGAA 2C5JA 2MJIA 3Q5WA 2JU3A 1JYDA 3TKLB 2OY7A 5L3FB 4JGLA 2ACZA 5LA6E 2CEAA 4ZI3C 4YBPA 2OVDA 3ZPOA 2L8KA 3JC6D 2VASA 4DBRA 2W00A 5JDGA 3AKMA 1X8UA 4COTA 2LSIA 4KHZF 3PTRB 4TZ4C 3RKGA 1EW3A 1DV9A 3FB2A 4IMOA 4ZH9A 2W62A 5FY1A 1NC9A 3T1YT 3VHLA 5EK4A 1FMVA 4IDZA 3N9LA 4Q25A 1BLRA 5L3DB 4I95A 4CV7A 3SWHA 2V7IA 1S2PA 2OVSA 5IRAA 2VWAA 3WZNA 2A9UA 3ZC0A 3O9XA 3WZQA 3QB5A 4LMKA 2ALLX 5EZYE 3ZJ1A 1CRBA 1P6PA 3IF8B 2CBSA 2QOMA 3CMLA 2LOPA 3RYCE 1OBPA 2BVLA 3CKDA 3MVFA 1D3SA 1ERBA 1XMOT 1STPA 2K5BB 4NIQA 1YWCA 4KC8A 2F01A 4DR5T 4IRWA 2CBRA 3FZFB 1QWDA 4JI5T 4B3ST 5H9KA 2AT0X 1LUQA 2OLTA 4ZGUA 2Y3FA 5JDLA 5JH7E 1E2TA 4EOZB 2CPTA 1T8VA 5HCEC 4ZHCA 4GKCA 2X9WA 4ZHQE 2H89A 2SPCA 3JAEA 1CUNA 5M4YA 4BX5A 1ZNDA 4NXNT 3HOEA 2CM4A 2WDRA 3RE6A 2BKOA 1U4QA 3Q5DA 2G79A 5AQOB 3BX8A 1NAFA 5H9NA 3AE2A 4EEBA 3WJBA 2RTMA 1OSPO 3N2OA 4UU2A 3EUHA 2GK9A 2FJBA 1EQDA 3O2YA 4ALOA 5B2AO 4U74A 5KDMC 2WZIA 1ZOYA 4AZOA 4O4SA 1GM6A 5AQUB 3NQKA 2GTLN 1QSDA 1KNRA 4INNA 2MF6A 4ZS3A 4PNIA 5FXVA 1L6MA 2CZTA 3ZW0B 2XAJB 5KXJA 2R6GF 1JZUA 5KHPA 3Q5EA 4AKRB 5LJCA 1RXHA 5FL0A 2R74A 5GONE 2PJQA 1KOIA 3P6FA 4JO6A 2F4VT 2YG2A 5HTDA 3AE6A 4JV5T 1KT5A 2JPFA 3PJAJ 4QGWA 1IJ5A 3VRAA 1ZNEA 1JJJA 2UUBT 3ZSSA 2LKHA 1SWLA 1RAVA 2X51A 4I6SA 2VL0A 3VRBA 1X9BA 1VWAB 4KH8A 3KFIA 1XWMA 5AQFB 3ZQ3A 4NLIA 4H9QC 1KFFA 3I9WA 4TKHA 2N2NA 2WWVA 4I60A 3FZHB 1D1CA 5HEUA 2JMBA 2DL1A 5B3MO 4OFZA 1SWOA 4FBVA 2CLYC 1LKXA 2M67A 2YMSA 2LA7A 3O1JA 3M65A 5BR8T 1ZNLA 5F1EA 3SZJA 2OFMX 3BS2A 1CBIA 1S7DA 4HKAA 4MEEA 2A5BA 2H7VC 5FXWA 4JI8T 3Q2MA 4C91A 1LFOA 4OELA 3KZAA 3TGBA 2DLRA 1HBPA 1AQBA 2X8TA 3CX7B 4CSBA 3TLVA 2A2FX 4CXXA 1HQQA 1IAPA 1SHZC 1G85A 1LIDA 3C76X 3DTQA 3SOTA 5FY0A 5HTEA 1ZV4X 2KD2A 4IL9A 2CBJA 5JRCA 3P6HA 1EPBA 3KV4A 1QABE 1SY0A 4MHCA 3ANWA 4O3ZA 3D0TA 4TV9E 4NNSA 3AE1A 4DR4T 3KBUA 2MPKA 4TJZA 2V6XA 4MLKA 3RYHE 5H9AA 1U17A 4GK9A 3SZHA 1HX8A 2E9XD 1N9MA 2NTXA 3IA3A 1SLEB 5L3YA 1G74A 1VWCB 1VCTA 3ELZA 3HKEE 3CKGA 1GT1A 5HA1A 4YFQA 3EI0A 5IRUA 4EYYR 4N7CA 1WLXA 3RPUA 5L8NA 3TGCA 1WR6A 2NWBA 5FMNA 1O3XA 4GJSA 5IUXA 1YWAA 2CXFA 1SY3A 3R6NA 2BDEA 4IBAA 4YLHA 3F8AA 4ZHGA 4TNVA 2G0UA 2VQET 1A2DA 4ORRA 5DQVA 3BK9A 2G7BA 2OY1O 3MKDA 4RUNA 4P0BA 5HEOA 2IDOB 1VWNB 1JIWI 4YJ2E 4GETA 1LICA 2K62A 1YQ3A 3VU7H 2LKGA 5JR9B 1AVGI 3WZPA 3WXQA 3APVA 4HFDA 1Y0GA 5CYBA 3STMX 4OS0A 4Z8XA 3UQ4A 4A56A 1I4UA 2EU7X 4E7ZA 1HS7A 2V6YB 3VPJE 1HQPA 4DNEA 4GKKT 4O4JE 5F5WA 3EYCA 3RIFA 3STNA 2KW1A 2DM5A 5B11O 1BSYA 2BC3A 4QYNA 1X8PA 1ERXA 1RBPA 3PH5A 4ODDA 5AEOA 4I3DA 4TUYE 4GNYA 1HR0T 4XMEA 4QH1A 2WAUA 3T2XA 4IDOA 3GN5A 1Y52X 2AKQA 2L9QA 2ZAIA 1SWJA 2ES0A 1MIYA 1MNDA 4LMJA 1OBUA 3F6ZB 1SWRA 3ZWEA 3VG5A 3DP7A 2XM1A 4PSQA 4EAHA 4ZGFA 5JVDE 2LRKA 3T6FA 3RGLA 3PUGA 1D0XA 3CBSA 2LM9A 2ACXA 3AEHA 2RTDB 2NNQA 3K3QC 2WSSV 4UVCB 2ANSA 5HYAA 4XZCA 2QMIA 4LZUA 1PEEA 1E5PA 2X0LB 4P1NA 1ZEEA 1ZKEA 2ZMAA 5IRWA 4PJ2A 3PU8A 2WWPA 5AJBA 2HPLA 4IDNA 1IW2A 2ODVA 3MXZA 2KTSA 4LZVA 1SXXA 3RX6A 3SAOA 3JCFA 3CIRA 3KBTA 1BM5A 4JBWF 1IZNB 3V5UA 3VHMA 3UULA 5LJEA 2JOZA 5HCJA 1MDCA 3WZOA 5JR9A 2QO6A 2IZAA 2CZUA 3B2HA 4A5XA 1SXYA 5FQ6E 4EZHA 5FAZA 1LCZA 1W5RA 1EZ3A 5CB4E 1ZNHA 1TW4A 5HXHA 4OMWA 1QQSA 3ZW2A 3F9DA 5B29A 3WJGA 5LHGB 5J1GA 4QKNA 3ZMUB 1N32T 4AYHA 2W0GA 3SOLA 2HKDA 4JYAT 4EQAC 1CJ5A 1VWPB 4IAWA 2BLGA 4JI0T 3LFMA 5AQMB 5AQQB 3UEXA 2LRLA 4IE4A 1FIOA 3HKBE 3P7IA 2AH7X 4ADZA 4X66T 2AXDS 3AEBA 3T6LA 4KBMB 4WW0A 3UQ7A 2L68A 3NP1A 2BHVA 1YXRA 3GN5B 5LB7B 4IE7A 4DV3T 4YFRA 1SRJA 1OEEA 3RIUA 4CDFA 3IFBA 2JMKA 3FBLA 4C5PA 4KT5A 4YSXA 3WJEA 1VWEB 3X00A 3OTOT 1AB0A 3EC5A 2BS2A 4BGFA 2YKSA 5HXCA 4JI7T 2RTRB 1ZHCA 4BX5B 2BZBA 3TLSA 2BVMA 5JRCB 1SRIA 3I0QA 1WYBA 4D6BA 3QC9A 5H6RB 1IKEA 2Y8DA 2LOSA 3B57A 1FE3A 4HPAA 4BVMA 4AQFA 4BJ8A 1YWBA 2OL8O 5KICA 1KZXA 4WHIA 3QUJA 2PY1A 1O8VA 3KFWX 4BX6A 5B5FA 2ASNX 1Z24A 4IDQA 3QNUA 1HNZT 3RH3A 3GA8A 5FNVE 4U46A 4EDEA 1ACDA 1SWQA 4YY3T 4K19A 3MX7A 4DCBA 4BX7B 2RTQB 5BVTA 2WR6A 1MMAA 3UUMA 2OL6O 1UCUA 2WY2A 4AKLA 3BU1A 5AQIB 5L3BB 4OS3A 2V7KA 5LGTB 4DQ4A 5HXEA 1QLBA 3RSWA 1LIFA 2OYBO 1KK7A 3CPZA 3OPCA 2WBLA 4M7MA 3CX6B 3JQOA 4HWIB 1W9RA 4Z2OA 4IREA 4EYUA 2J1DG 3PU3A 5CJ5A 3P6EA 2FRSA 2D0TA 4H9PC 3TZSA 4YDBA 1ZNGA 5HBSA 2FJDA 5DABA 2W2BA 3ZI8A 4B3TT 1OPBA 3RYIE 5CHKA 1BR2A 2WP9A 4JEUB 2RTFB 2LHRA 2RA6A 5DPQA 2MYSA 3WJCA 2K3WA 1QY2A 4DMVA 1US7B 4KIIA 2CM9A 3FA6A 4FBOA 3JADA 4A98A 4NNTA 2A5CA 1DZMA 3T1DA 4I4TE 3HPEA 4EXZA 2YU1A 4YGGA 4CN1A 4BJNA 2Y6XA 3PUQA 1E02A 1E7PA 1WCRA 4BOEA 3N2KE 4P09A 4WFVA 2FT9A 1AJ3A 1M62A 4O3YA 4UU3A 3ZYMA 3KV6A 2WEWA 1TOUA 3NX2A 2IZDB 3UEWA 5IWAT 4A97A 2CXLA 2WS3A 3EW1A 3BRNA 5D47A 4TQ2A 5DQWA 4I55E 3IEEA 3N9QA 3PK2A 3VG2A 1GQEA 3D95A 4X1IE 4IABA 3LJCA 1OEDE 3VKGA 3D9WA 2W61A 3A7MA 5EK2A 5IXGA 5AQPB 2WU5A 2XQ8A 1YUPA 5FKYA 2V5CA 2MHDA 2G8CO 4TX5A 3OD9A 2JRKA 4LF9T 3LK3B 3P4RA 2IZEB 4H9NC 3WYQA 3E08A 2FGSA 2XTLA 5LCYA 4DR7T 3ZMZB 1KL4A 4ZJ0A 5FYMA 2A2GA 5C2TA 3C78X 4ZH6A 3AAIA 3PECA 4YGHA 4EEJA 2XQYA 4JHQA 4BQUA 4L9IA 4EIWA 3ESLA 2I5ZO 1W4TA 2KT4B 2ACPX 2BBJA 3N9OA 3VU1A 3UFEA 2R56A 5FL1A 3EVYA 1XCAA 4YKMA 1SREA 4YH0A 1OEDA 4MVEA 3C50A 4U2ZA 4EZ4A 4TWDA 3HI2A 1QY1A 2UYWA 4XMGA 2X66A 4GK5E 3W15B 4LF6T 2D5UA 4ZCBA 4PW8A 4X1KE 4N78D 4O4IE 4CPHA 4U7IA 4PK5A 1ALBA 4Z2PA 1SWTA 3FZKB 4QXBB 4HFBA 1VWBB 3VR9A 3FMZA 1DF8A 3FA9A 2IZKA 1K24A 2VKDA 1IKJA 1QFVA 1UGOA 4HEAA 4AW8A 1WRDA 3ZYKA 3ZEFB 3BX7A 4XAXB 1N7YA 4JI6T 1M7KA 4O3WA 4UVBB 2E8IA 4MVKA 2JQHA 2QA7A 1GT5A 4HE8A 1VWQB 2CAMA 5FVLA 5LJMA 5D4AA 3KDSE 4QRLA 4I43B 4CK4A 3D96A 4QZUA 2ZLYA 1UK5A 2IIUA 4HFIA 1GX8A 2JGSA 3SLJA 4ZZBA 1QY0A 5AQLB 2X34A 3O19A 1I06A 1MUPA 5AQKB 3U3IA 1JMZA 3UU4A 2BT9A 3RI5A 2E9XA 5F2BA 3APXA 1VWIB 1UYOX 2Q9SA 4TN7B 2LLYA 3ZT5A 3OJYC 5D45A 4IB6A 5LMUT 5FFHA 1YKHB 2W63A 4ZR2A 2VB6A 2OF9A 3NRYA 1QUUA 1Y01A 4PAGA 2XY8B 1UUSA 5FP3A 3RDSA 3E0ZA 3F31A 4HN9A 4DV1T 4QWNB 1BR0A 3T8OA 1SXWA 1YIVA 4I50E 5B10O 2CLYB 3HL6A 1KXOA 2FR2A 2X32A 5IO5A 4YFPA 3WI3A 1ICNA 4OYKA 1ICMA 2QO5A 1DC9A 3MACA 3O1IA 1LCVA 2BBHA 1LDQA 2X67A 4EGWA 3UTKA 2XAQB 3VE1A 5F7GA 3VG6A 3O1HA 4ORSA 1GKAA 5LJGA 2IZGB 3KVNA 1YD8G 4X20E 2NNEA 2Q9QD 1N9YA 4ARHA 4ZXLA 2LHNA 1YW0A 3UUXB 1PTSA 5AQSB 4IB8A 4DVDA 2D0UA 2XQ3A 1LIBA 3FA7A 4CPIA 3PURA 2DHRA 3AE7A 4NXMT 5DG4A 1SLFB 1U0XA 4YVBA 1LCWA 3I17A 3RC3A 3VR8A 4ERRA 3QQ2A 4YFSA 4X64T 4OX9T 1DFVA 1LF7A 3FZMB 1J5WA 5LNKA 2JQQA 3PUVF 2CHNA 2RD7C 3ZZVA 2EHOB 3RDUA 2CCQA 3UAQA 1QG5A 3VG3A 4UF0A 5EEEA 3FW4A 2XAHB 3KFFA 2P9BA 4BX7A 1CBRA 3MZKB 2NW8A 4UVAB 3B5MA 1NBXA 4WNKA 3N5LA 4H63H 4ZI7E 3HWGA 4KX6A 3HA4A 1GKAB 3RDMA 1S94A 2WZHA 2E9XB 2WWUA 4ISSA 4TNWA 2FBWA 4GYRA 5F58A 1I04A 3ZW0A 4JI3T 1U18A 5JR8A 3FYFA 4E7SA 1VWDB 4CI1B 2WSJA 2C5IT 1VYFA 2NNDA 2A3FX 1ZP0A 4YDAA 2AT8X 1VRBA 2V5DA 3ETUA 3HWEA 4Z27A 1N43A 2IMLA 2J4GA 2CE7A 5EPQA 3WYPA 4U8UO 3IA8A 1UURA 2WU2A 5ABFB 3TF6A 3ZMVB 4IT4A 3MBTA 3LHNA 2UXCT 5BMVE 2QM9A 4Y59A 1IBLT 3FXDB 2Q2PA 4GH7A 4A1HA 4A1YA 3CBCA 2BG9B 2XQ4A 3H3AA 4YT0A 2QYWA 2OFAA 2OL7A 1KQXA 4TKBA 3S4UA 4CXWA 3IBPA 1OXZA 2W66A 3BQKA 3BQLA 5AQVB 4UV9B 1SE7A 1OEJA 5H9LA 3CQCB 3ZLIA 4CXYA 2FLJA 3SFEA 1N34T 1SY2A 3NKZA 1G7NA 5HWYA 1GGLA 4P0AA 4J2CA 1FEMA 4Y0QA 2MO5A 3UFGA 2AE9A 1FTPA 5LJDA 3MK7C 3HKCE 4AZNA 1BR4A 2C5KT 3UT5E 2JN3A 1KQWA 2DJFA 5DJQC 4XMCA 1HFAA 2OFRX 4HWHA 1AVEA 2VKJA 2KWHA 5J2UE 2QOSC 4Y0PA 4HFVA 5HEHA 3EM0A 1DZKA 3FIQA 1KT4A 1Z0PA 3L39A 1FELA 2WMOA 2CWYA 3CQGB 2W2AA 2K48A 3LK42 5AFUL 3P8CD 3N2GE 3OVUA 3VG4A 3HOLA 1SWHA 4ZFXA 4O9SA 4IDPA 2MAWA 1B0OA 4X5TA 5HZ6A 2O62A 5FQ7E 3J9X1 1KNZA 2KZ7B 3WOVA 1R0UA 1T68X 4PK6A 4C90A 3PEDA 3S5XA 4KMCA 5JR9C 4TNNA 4ZZCA 3FEPA 4YTNA 1I78A 5F8PA 1AVDA 4GIWA 2CHOA 2UUAT 4LFCT 1B8EA 5HAXA 4O4UA 2XASB 2POAA 4AKHA 3VG7A 2FHNX 1YKEB 4JI2T 2WMNA 3UU6A 1Y55X 2YK0A 3ZJ2A 5D8JA 3NBXX 4L1NA 4LKPA 4CN6A 1N36T 1T72A 2WM9A 3C4XA 3MG5A 5L8IA 4QYPA 1KZWA 4LF4T 3B2JA 4V1Av 3V8UA 3GAQA 1AELA 3ZW1A 2OF8A 5BYPA 3F57A 3P4WA 1NGLA 5IYZE 3CQNA 2CMRA 4UV8B 4F8HA 1SRFA 3ZCJA 3I0OA 1DZJA 2IFBA 4U9CA 3QOFA 3HK1A 5IHYA 1X79A 2DNXA 2JQKA 2Y3EA 5AQNB 3GMIA 1KL5A 3NX1A 4IMNA 1V9DA 2GTLO 4QGXA 2YDSA 5HWXA 4PJMA 1S44A 2E5VA 1D0ZA 2PG8A 4FJOA 1GX3A 1MIVA 5LYJE 4GGZA 2WUTA 3ZC1A 3ZUOA 1B4MA 4IL4A 4LQZA 5LJKA 4MALA 2ZSCA 4OHFA 3NQ3A 2L67A 3SLOA 4DIDB 1SWGA 3JSQA 4HFHA 4DV4T 2Z4IA 4ORXA 1LVKA 2KINB 2K24A 4ORYA 2XJ7A 2UZ2A 2Z4HA 3NZPA 3JS1A 4GU8A 2X4MA 4TKJA 1RXKA 1XZYA 2ZM0A 2OZQA 4LF5T 1KT6A 2LBAA 1KNPA 4ORUA 1N0SA 2IW5B 5JDMA 2HLVA 2XSAA 4PFOA 3RQWA 5HXRA 2R73A 4M1PA 1D1BA 5LJNA 1FJGT 4ZHHA 3APUA 4IAXA 3G06A 3LTWA 2W4XA 4YHHT 2D2SA 4YSZA 1EI5A 5B27A 3K8PC 2GJ5A 1JBHA 2PI3O 3ELXA 2A2UA 4BCSA 3L8RA 2VK9A 1MNEA 4X1YE 4DV0T 1NDJA 2FJEA 3F2EA 4O8SA 1XMQT 3OJAA 4QXCB 3TLTA 5LP6E 5HA0A 2XHEB 1VCSA 3D97A 3EMMA 5KMGP 1LDOA 3FENA 3N91A 4A8ZA 1OBQA 3Q5XA 1MK5A 1ADLA 1UX4A 1D2UA 1Z8UA 2KSRA 3QKGA 1VWRB 1PM1X 2IC6A 2FS7A 3AA6B 1NQMA 4FGIB 3CWZB 4FBRA 3QK6A 1HN2A 4DV2T 4GGRA 4UR9A 1R8IA 2UXNB 1HMRA 4ZI2C 1T8BA 1G5WA 1HTJF 2JIWA 2IZIA 2VFCA 2IUBA 2Q9QB 2V7MA 3E3CA 2X56A 5HXSA 4B55A 2OY5O 4IE6A 3WAJA 2FR3A 2WEXA 3AEDA 5K06A 4CPEA 5LMNT 2BKNA 1LIEA 3E22E 3BSZE 4OS8A 5AQRB 4G2AA 4LFAT 1SWSA 5JTGA 1HCIA 4AZPA 2X9YA 5AQHB 5LKEA 3I9YA 4X62T 3VGWA 2NR4A 1IFCA 1SRGA 1E06A 3PPTA 2V8SV 4KUMB 1RXJA 2A8GA 2HMBA 1XDOA 4G63A 3BY0A 2FWVA 2OVAA 2IZHB 3AAEB 1X8NA 2XUEA 1JMXA 3RQUA 2HZQA 4TLJA 1SUMB 1VWJB 2RTAA 5BVSA 2VURA 1MIWA 2V26A 3FLLA 2LKKA 2W2FA 1RSTB 4O4HE 1CBQA 1S35A 2QGSA 2W67A 3HWFA 1W0BA 1FDQA 4NV8A 2XKLA 3WJFA 1MMDA 4WYVA 3VHHA 3EHZA 1DZPA 4PJJA 3LBXA 4AKIA 2RTBB 1SWDA 3P4SA 4GD9A 3MA9A 2IZJA 4A60A 2DWKA 4QX8B 1UZ2X 4YTMA 3WAKA 5EEDA 4CDEA 4O2AE 3T1HT 1JNRA 4B6XA 1IIUA 4LKTA 3PDFA 1H7CA 3BQIA 4ILCA 5E0OA 1GXAA 1I05A 5HCDC 1W6FA 4ZI3D 1BJ7A 2Y48B 4EKVA 1SRHA 2OFBA 4UEMA 2ODUA 5HEJA 3C4ZA 3LSVA 2YEVC 4Y0SA 3AA1B 4Z6JA 1VYGA 3S26A 4I3BA 4HWFA 4H9SE 2P8GA 4WBKA 1BRQA 3RE5A 2FUPA 3Q9DA 2AVIA 3KINB 4QHOA 1I9HA 4ES7A 3UUNA 5F6BA 1SWFA 2VL8A 1NEKA 2V6YA 3RDQA 4QH4A 4JUYA 5LHIB 2VVNA 1LVFA 2KNDA 4TWHA 2WQYA 4AQYT 3U0DA 1PBOA 3AECA 4NP1A 1WFDA 2M4LA 4XBFB 4AI6A 5HCCC 3BLGA 2RTKA 3AXJA 1DU2A 3ZYLA 1JJXA 2BG9A 2X8SA 5HZQA 2IZBA 2CBIA 4F6RC 3EBKA 2OVEA 1JJUA 3ZT6A 2B76A 3VE2A 2J62A 4DQ3A 1BSOA 4YHJA 5ABHA 3WJDA 3IHRA 3JC6C 2YDRA 2JU8A 1LKEA 3VHIA 1LNMA 2YN6A 2YINA 1SWKA 1B7TA 2XQ7A 5L2LA 3K3LA 4MISA 2VQFT 4GDAA 3OKQA 4IB9A 2E2AA 4AZQA 2V7LA 4AZRA 5CE4A 2C0SA 4CPHB 2VKHA 2BS6A 4GK0E 3Q6LA 3RZYA 2FS6A 5FXXA 4GRJA 3ZN1B 1LPJA 1OEDC 3L09A 4XMFA 2I0MA 2RTIB 4AISA 4AZMA 2L3LA 1MMNA 3H37A 5LOVE 4DR6T 2GC9A 1NWMX 2B1EA 2EHOD 2WB5A 3AB3B 2RTCB 4PJLA 2L9CA 3CQRA 3RF1A 2YDQA 1IBKT 1JV4A 4NUVA 2EHOC 2RTJA 2XZEA 4IIJE 2PBIA 4Y0RA 4HPCA 3UU3A 4U72A 1RLBE 2HHHT 3WBGA 3UU8A 2M6IA 2X0HA 4KCAA 4DR2T 3AE3A 1HMTA 5F6ZA 2JW1A 2WQAE 1BRPA 4Z90A 5A1LA 4DV6T 1PMPA 5LKFA 5HWZA 2VFBA 4LMLA 5EDCA 1UX5A 3P6CA 4QZTA 1IJ8A 4PK4A 3PH6A 1EXSA 4HFEA 2GTLM 1BWYA 4R0BA 4JLEA 2QCBA 1SA8A 1MMGA 2BKPA 2NP1A 4WBNE 2DJGA 1PBYA 3CWKA 1SWAA 5ABGA 2C4IA 3FR2A 1O1UA 1T0VA 1KL3A 4MVIA 3ZKRA 2LT3A 4EV6A 3LV4A 2E9XC 3RRWA 2BS5A 1DF3A 2HNXA 4UF0B 2DI4A 5C3JA 2EHOA 2WCAA 3PUSA 3HTYA 1OWAA 4QNIA 2X68A 2I59A 3OYZA 3STKA 3RBYA 3H3IA 3RDOA 5AQJB 1VWKB 3B13A 1K3BA 2XM2A 1LRZA 5LXTE 3PUZF 2BSZA 4YKOA 3FDCA 5L4EA 2RTNB 3P6DA 1U5PA 1HX1B 3UUBA 1JYJA 2JJ9A 4O2BE 1SWUA 5HAEA 2LSJA 1VPRA 3P4PA 2QO4A 2UXXB 3PJAA 5H8TA 4FQBB 3AE8A 2BG9C 3U9PC 4NV7A 1YP7A 1KFYA 1WUBA 1LELA 3RY2A 1L0VA 2H7OA 3PUYF 4CZZB 2XQ6A 1FMWA 4DV5T 2HPJA 3R84B 2RA1A 4K0KT 4YXDA 4HWMA 1G73A 4ZOLE 4IHJE 3EDUA 3FW5A 4O3XB 2HH7A 3O22A 4L5GA 2I5VO 4MBQA 1OEKA 2ZM2A 3NZQA 5F3JA 3ONLC 3KVAA 3ZMTB 2CM0A 4JI4T 2RTPB 4GUZA 3OBVE 5JDHA 1SWEA 4GZVA 1G8XA 1MM9A 5BVQA 2YU2A 3TLWA 4K0UA 4NPPA 3CKFA 1T98A 4ZHDA 3MJXA 2AMMX 5KIDA 3ONJA 4OEMA 1VWHB 5JREA 3P24A 4U31A 1SXUA 3K3OA 4MFRA 4YMYA 3AAAB 3LBXB 3U78A 3P02A 4ID2A 1E2AA 1BSQA 1Y64B 4DO0A 1OEDB 2RTHB 1HG5A 1ZNKA 3AVSA 4U7YA 1W0AA 1WR0A 1SLDB 1TOWA 1STSB 2FHLA 4TWFA 3L4RA 2N1GA 2X0YA 2AF5A 1ML7A 4DV7T 4NUUA 2JQ9A 1FEWA 1T7SA 2RTGB 3LG7A 1BR1A 1VWGB 5LBMA 3Q34A 4L3RA 5FY7A 5L4HA 4I3CA 2PFVA 4QH5A 1HXZA 1NP1A 4XMDA 3P4QA 1N4JA 1NP4A 2RTEB 4QGVA 4Z28A 4QQ1A 2OA5A 3D4RA 4ILBA 1CBSA 5L3CB 2X9HA 4ML7B 3AUMO 2HYSA 1XNRT 1BBPA 2I6HA 1W09A 1VWOB 4YGZA 3ZSTA 4DUYT 1YQ4A 4O4LE 4JNJA 2YOEA 4ZEYA 1J1JA 4LF7T 3DJBA 5D48A 2ZM6T 3I1AA 5JDNA 3HKDE 2LFOA 5FQ8E 3OE3A 2HN2A 4QAEA 2MTQA 5LJHA 1VWMB 4HPDA 4QX7B 4DR3T 3RKOA 4IB7A 3S5VA 1D0YA 1TXLA 4UXNB 2Q9QA 3NR3A 1VOMA 3CK6A 2CRBA 2D9DA 2XSBA 2L5PA 3SFDA 3FELA 1HBQA 3NQ9A 5B5GA 5ADXL 5LJBA 2OY8A 1HMSA 3APWA 5FXZA 4GDZA 2Q2MA 2WDVA 4ORWA 2V1DB 1SWCA 4ON1A 4YBUA 2IHR1 4BJMA 4ANJA 1HXLA 5JDQA 2FKGA 2LSKA 2JMHA 3ZT7A 2RCQA 4U3QA 2OV9A 4CN4A 5CGMA 5J0ZA 3K1SA 4LF8T 4NLJA 3FA8A 2BG9E 2X46A 1VWFB 3WVMA 2M6BA 1WBIA 4OK0A 1HY2A 3AKNA 3GWHA 2KMFA 3GE2A 4GYSA 1A57A 2LBVA 4H9OC 1MEPA 4OYJA 5FVKA 4GE1A 1IFBA 1A3YA 2K9AA 4BAYB 2QRXA 3CVRA 3SZIA 2N93A 4WFUA 4AIUA 1A18A 2C1SA 4ZS2A 2DCFA 2LB6A 4B3MT 4DR1T 2J47A 3TGAA 4BX6B 4OKAA 2Y32A 4COFA 3U03A 4IGUA 5AQGB 4EXTA 2RPAA 4B3RT 1MX7A 1E00A 3RIUC 3RLFF 4N7DA 2KLQA 3UEVA 3AXJB 5AJCA 4AQFC 2BS3A 3EDVA 3ZMSB 3AVRA 4DMWA 5IO6A 3DTOA 3C4WA 3RRCA 1X89A 2XQ9A 2Z6EA 2HN1A 4UIGA 1B56A 1EPAA 1VYOA 3FHNA 2RTOB 4M6SA 3KFHA 3AE4A 2RCTA 1KGLA 5ABFA 5IO7A 4JEHB 2DWGA 2XPKA 2CXDA 1JQPA 2IC9A 4MVLA 3B2KA 2V7JA 1NQNA 5CA0E 2RTLA 1N33T 3FXEB 1SWPA 1NENA 3PQSA 2KWIB 3LK2B
chains in the Genus database with same CATH topology
3DTQA 2BT9A 3SOTA 5HTEA 2KD2A 3APXA 1DZPA 3P6HA 3NWIA 1GT4A 1EPBA 2Q9SA 1QABE 1SY0A 3OJYC 5D45A 3P6GA 4IB6A 4A60A 5FFHA 1UZ2X 4O3ZA 3DSZA 4ZR2A 4NNSA 5EEDA 1IIUA 4LKTA 4TJZA 1GXAA 5H9AA 1I05A 1U17A 3ZW1B 4GK9A 5HCDC 4U8UM 5HZ5A 1BJ7A 2AT5X 1SXWA 1YIVA 1KXOA 1YWDA 2FR2A 5IO5A 4YFPA 1ICNA 1ICMA 2QO5A 5L8OA 1DC9A 1G74A 2BBHA 4EGWA 3VE1A 3ELZA 3ZUIA 5F7GA 3VG6A 1GT1A 4Y0SA 5HA1A 1VYGA 4YFQA 4ORSA 1GKAA 5LJGA 4N7CA 3S26A 1ZRYA 2X8FA 4I3BA 5L8NA 3TGCA 4O4XA 2P8GA 4WBKA 1EIOA 1BRQA 2NNEA 2Q4NA 4ZHFA 1YWAA 4ARHA 1SY3A 4ES7A 4IBAA 3F8AA 4IB8A 5F6BA 4ZHGA 1X71A 1LIBA 3FA7A 3HWDA 2A13A 5DG4A 1U0XA 1A2DA 4ORRA 1PBOA 4NP1A 3I17A 2G7BA 4EFGA 3U0DA 2M4LA 4MIRA 3C76X 2G78A 4RUNA 1DFVA 5HCCC 3BLGA 4NYRA 3PQUA 2Q39A 1JIWI 1GX9A 1LF7A 2MM3A 1JJXA 4GETA 2X8SA 1LICA 2K62A 5HZQA 3BDRA 2GTFX 3EBKA 2OVEA 2RD7C 3KQ0A 5EDBA 3ZZVA 3VE2A 4DQ3A 1AVGI 1BSOA 3EBWA 1X8QA 3UAQA 3WXQA 1QG5A 3APVA 3VG3A 5EEEA 3B2IA 3WJDA 3FW4A 5CYBA 3STMX 4OS0A 3KFFA 1I4UA 5EZ2A 2EU7X 1CBRA 2JU8A 1LKEA 3VPJE 1HQPA 5AQ6A 1LNMA 4I0UA 1UREA 3EYCA 3UEUA 3STNA 3HWGA 2KW1A 2F09A 3FR5A 4HFOA 2DM5A 3BU9A 3K3LA 4MISA 1BSYA 4NYQA 1XKIA 4QYNA 4D6AA 1X8PA 1ERXA 1GKAB 1RBPA 3PH5A 4HPBA 4IB9A 4O4OA 4AZQA 4EEDA 4AZRA 1GT3A 5CE4A 4ODDA 2BS6A 5AEOA 4I3DA 3RZYA 3Q6LA 3NPOA 2FS6A 4GNYA 4GRJA 3C77X 5F58A 1X8OA 4OMXA 1I04A 1LPJA 2AL0X 3ZW0A 1O1VA 4XMEA 4XMFA 1U18A 5JR8A 3FYFA 4NW4A 4AZMA 2WSJA 1EALA 1FENA 2AKQA 1VYFA 2NNDA 2A3FX 2ZAIA 4YDAA 2AT8X 4KC7A 2GC9A 3HWEA 1TVQA 2WQ9A 1OBUA 3F6ZB 2AT3X 3NADA 3ZWEA 4ALBA 5HZ8A 5EPQA 3VG5A 2L9CA 2ZAGA 4PSQA 3IA8A 4U8UO 4ZGFA 3CQRA 3TF6A 3MBTA 3LHNA 1JV4A 5C0NA 2QM9A 3CBSA 4Y0RA 2Q2PA 4HPCA 1BEBA 3G7XA 2NNQA 1RLBE 4GH7A 4A1HA 4A1YA 3CBCA 3WBGA 4KCAA 2RQ0A 2ANSA 1HMTA 4YCEA 5F6ZA 2JW1A 2WQAE 3FEKA 1BRPA 2QMIA 1H91A 3CMPA 4LZUA 1KQXA 1E5PA 1PMPA 5LKFA 1PEEA 5HWZA 4TKBA 4PJ2A 2E4JA 2WWPA 2XSTA 5EDCA 3P6CA 4QZTA 5AJBA 1IW2A 4I9SA 3PH6A 1EXSA 1OEJA 2KTSA 4LZVA 1SXXA 5H9LA 3SAOA 1EUOA 3JCFA 2RN4A 2GTLM 2FLJA 1BM5A 1BWYA 1SY2A 1G7NA 2HZRA 1GGLA 4R0BA 3CR6A 1SA8A 5LJEA 1FEMA 2NP1A 4Y0QA 2MO5A 2JOZA 1MDCA 1KT3A 3CWKA 4U8UN 1FTPA 5LJDA 2QO6A 3FR2A 2CZUA 3B2HA 1O1UA 4AZNA 2A0AA 1SXYA 2JN3A 2JU7A 5FQ6E 1KQWA 5FAZA 1T0VA 4XMCA 4MVIA 1ZNHA 1TW4A 2OFRX 4EV6A 3LV4A 2BS5A 1DF3A 2HNXA 4OMWA 1QQSA 2K23A 1MVGA 2QOSC 3ZW2A 3F9DA 4Y0PA 5B29A 3FR4A 3WJGA 1MX8A 1Y9LA 3HTYA 3EM0A 1DZKA 4AYHA 5FENA 3FIQA 1KT4A 4QNIA 1FELA 3STKA 2ACOA 4EQAC 1CJ5A 3RBYA 1KT7A 4IAWA 3H3IA 2BLGA 2W2AA 2AT6X 2F73A 3UEXA 3RWXA 3HOLA 3VG4A 4ZFXA 4O9SA 3S60A 4YKOA 1B0OA 2AH7X 3P6DA 1JYJA 1SY1A 2O62A 5HZ6A 4GNWA 2FTBA 5HAEA 5FQ7E 3NP1A 1VPRA 2L68A 3WOVA 2BHVA 1R0UA 2QO4A 1T68X 5H8TA 4FQBB 3PEDA 3S5XA 3U9PC 3PP6A 4TNNA 4YFRA 1YP7A 1OEEA 3FEPA 3IFBA 4KT5A 1QFTA 1B8EA 3WJEA 4HWMA 4O4UA 2POAA 1AB0A 3NVOA 1YP6A 3VG7A 1EIIA 1SMPI 3FW5A 3KFGA 4XMHA 4O3XB 4D6BA 3O22A 5HZ9A 1IKEA 5D8JA 3NBXX 1OEKA 3I0AA 1FE3A 4HPAA 4I9RA 4L1NA 4LKPA 4BVMA 4O49A 2KTDA 1YWBA 5KICA 5L8IA 3OBLA 1KZXA 4WHIA 4QYPA 1KZWA 2PY1A 1O8VA 3B2JA 4RUUA 2ASNX 4GZVA 4YCHA 3V8UA 3GAQA 1AELA 3ZW1A 5BYPA 1Z24A 1NGLA 5BVQA 1OPAA 2MWHA 3CQNA 1Y9TA 2X45A 3B2LA 4EDEA 1ACDA 4ZHDA 2AMMX 4K19A 5KIDA 2MJIA 3MX7A 2JU3A 5BVTA 1JYDA 1DZJA 2IFBA 2WR6A 4U9CA 3HK1A 3P24A 1SXUA 4YMYA 3BU1A 4OS3A 4JGLA 4DQ4A 3P02A 3NX1A 4ID2A 1BSQA 3RSWA 1LIFA 4IMNA 2GTLO 4QGXA 4YBPA 2OVDA 3AKMA 4COTA 1X8UA 1S44A 1ZNKA 4M7MA 1TOWA 3RKGA 3JQOA 1EW3A 1DV9A 3L4RA 2WUTA 4IMOA 4ZH9A 1ML7A 3P6EA 2FRSA 3ZUOA 1B4MA 4LQZA 5LJKA 3TZSA 3NQ3A 2L67A 4L3RA 4YDBA 1ZNGA 5HBSA 1BLRA 4I3CA 4I95A 2W2BA 3ZI8A 1NP1A 4CV7A 1OPBA 1S2PA 2OVSA 3JSQA 4XMDA 2RA6A 5DPQA 1NP4A 3WJCA 4QGVA 1QY2A 2Z4IA 4ORXA 2ALLX 4KIIA 2CM9A 4ORYA 4QQ1A 3D4RA 3FA6A 1CRBA 1CBSA 1P6PA 2Z4HA 4FBOA 2CBSA 3JS1A 4GU8A 4ML7B 4NNTA 2HYSA 1BBPA 1OBPA 4TKJA 1DZMA 4YGZA 3T1DA 3MVFA 1D3SA 1ERBA 4EXZA 4YGGA 1YWCA 4KC8A 2OZQA 1KT6A 2LBAA 2CBRA 4ORUA 5D48A 1N0SA 1E02A 1QWDA 5H9KA 4ZGUA 2AT0X 2HLVA 4BOEA 2LFOA 4WFVA 5FQ8E 2FT9A 2R73A 3OE3A 2HN2A 4O3YA 4QAEA 4ZHHA 4UU3A 5LJHA 1T8VA 3APUA 4IAXA 5HCEC 2WEWA 1TOUA 4ZHCA 4GKCA 4HPDA 4IB7A 3S5VA 1TXLA 1EI5A 3NX2A 5B27A 3NR3A 1ZNDA 2GJ5A 3UEWA 1JBHA 3CK6A 3HOEA 2CM4A 3BRNA 2A2UA 3ELXA 5D47A 4TQ2A 2L5PA 3FELA 1HBQA 3NQ9A 3VG2A 3D95A 4IABA 5LJBA 1HMSA 2G79A 3BX8A 3APWA 4GDZA 2Q2MA 4ORWA 5H9NA 4EEBA 1YUPA 4ON1A 3WJBA 4YBUA 2MHDA 5HA0A 3OD9A 3D97A 3EMMA 4UU2A 3FENA 3N91A 4A8ZA 1OBQA 2RCQA 1EQDA 3O2YA 1ADLA 4U3QA 4ALOA 4ZJ0A 1D2UA 2A2GA 3C78X 3QKGA 4ZH6A 4YGHA 3PECA 4EEJA 1PM1X 4BQUA 4AZOA 4NLJA 4O4SA 1GM6A 3FA8A 2FS7A 2X46A 3NQKA 3WVMA 2GTLN 4FGIB 2KT4B 4INNA 2ACPX 4FBRA 2BBJA 3VU1A 2CZTA 1L6MA 1HN2A 3AKNA 2R56A 3ZW0B 3GE2A 4YKMA 1XCAA 4YH0A 1A57A 1JZUA 2LBVA 4MVEA 5KHPA 1HMRA 4GE1A 1IFBA 5LJCA 1A3YA 1G5WA 2R74A 1QY1A 4XMGA 2IUBA 1KOIA 3P6FA 3E3CA 2YG2A 5HTDA 1KT5A 4ZCBA 4QGWA 2N93A 1ZNEA 1JJJA 2FR3A 2WEXA 4WFUA 1ALBA 1A18A 4I6SA 2LB6A 5K06A 1LIEA 3TGAA 4OS8A 3BSZE 3FMZA 3FA9A 3U03A 4KH8A 5JTGA 3KFIA 1IKJA 1QFVA 3ZQ3A 4AZPA 4NLIA 4TKHA 1MX7A 1E00A 4AW8A 5LKEA 1IFCA 3BX7A 4N7DA 2JMBA 1E06A 3UEVA 3PPTA 4FBVA 5AJCA 2HMBA 4O3WA 2YMSA 4MVKA 2LA7A 5IO6A 1GT5A 2FWVA 2OVAA 3BY0A 1X89A 1ZNLA 5F1EA 2OFMX 3BS2A 2HN1A 1CBIA 1B56A 1EPAA 1S7DA 1X8NA 5D4AA 2HZQA 4M6SA 4QRLA 4TLJA 5BVSA 3KFHA 1LFOA 4CK4A 3D96A 3KZAA 4QZUA 2RCTA 3TGBA 1KGLA 3FLLA 1HBPA 5IO7A 2LKKA 2W2FA 1AQBA 2X8TA 4CSBA 4MVLA 1CBQA 1GX8A 3B2KA 3HWFA 1QY0A 3O19A 1I06A 1G85A 1MUPA 1LIDA 1FDQA 3PQSA 2XKLA 3WJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEB A;  4EED A;  4EGW A;  4I0U A;  5JTG A;  2BBJ A;  2HN2 A;  2IUB A;  4EV6 A;  3JCF A;  3RKG A;  3CK6 A;  3NVO A;  2BBH A;  3NWI A;  2HN1 A; 
#chains in the Genus database with same CATH topology
 5H6Q B;  3EW2 A;  3PUW F;  4UEL A;  3AEG A;  3NWI A;  1GT4 A;  5AQT B;  2NP9 A;  1VWL B;  3P6G A;  1FJ1 E;  3DSZ A;  4ZI2 D;  2C1Q A;  4ILA A;  2VDF A;  4CDD A;  2NTY A;  5JDF A;  2UUC T;  1XNQ T;  3ZW1 B;  3QB5 K;  2ZM8 A;  4U8U M;  3X1D A;  5HZ5 A;  2AT5 X;  5L3G B;  4ASK A;  1YWD A;  2A72 A;  3JAF A;  3KV9 A;  4CDC A;  3UU5 A;  5L8O A;  1I6Z A;  4HFC A;  5L3E B;  3EAB A;  3ZUI A;  5TAO A;  4Z91 A;  3SS1 A;  2G5L A;  1ZRY A;  2X8F A;  3RDX A;  3L3P A;  4O4X A;  1EIO A;  2PTF A;  2H88 A;  4GOU A;  4DBQ A;  2Q4N A;  4ZHF A;  3RHW A;  2X9X A;  5EK3 A;  3EAM A;  2UU9 T;  1X71 A;  4YJ3 E;  3HWD A;  5JQG E;  4CPF A;  4HTE A;  3V5S A;  2QVA A;  3N9P A;  2A13 A;  3AEA A;  1HNX T;  3HR0 A;  4EFG A;  5ABE A;  4MIR A;  2G78 A;  3KVB A;  2GH7 A;  3MM0 A;  4NYR A;  5CFB A;  3PQU A;  2Q39 A;  1GX9 A;  2UXD T;  2MM3 A;  2LE8 A;  3BDR A;  2GTF X;  4AKG A;  2IAK A;  3KQ0 A;  5EDB A;  3EBW A;  3M3Z B;  2CA5 A;  1X8Q A;  3ZCI A;  3B2I A;  2CWO A;  3SRZ A;  4X65 T;  5EZ2 A;  3T2W A;  3RY1 A;  3CQX C;  5AQ6 A;  4I0U A;  4CI3 B;  4PFP A;  2Q9Q C;  1URE A;  3UEU A;  5LG3 A;  1HG2 A;  5LG4 A;  2F09 A;  3FR5 A;  4HFO A;  3BU9 A;  4U3C A;  4NYQ A;  1XKI A;  1XDP A;  4D6A A;  2X55 A;  4HPB A;  4O4O A;  3K3N A;  4L0R A;  4EED A;  3C98 B;  3PUA A;  1GT3 A;  5ETW A;  4YTP A;  2IZL B;  3NPO A;  3TLU A;  4JI1 T;  1X8O A;  3C77 X;  4OMX A;  3ABV A;  4U33 A;  2AL0 X;  1O1V A;  2LSY A;  4TV8 E;  4IE0 A;  2NW7 A;  2W2U A;  4NW4 A;  2WDQ A;  4KI0 F;  3FZL B;  1EAL A;  1FEN A;  3AE5 A;  4WZX A;  4H9R C;  4KC7 A;  4FI5 A;  3RIA A;  2IZF B;  1TVQ A;  2WQ9 A;  3PUX F;  2AT3 X;  3NAD A;  4ALB A;  5HZ8 A;  1SA0 E;  2MOZ A;  3LDQ B;  3ONX A;  2ZAG A;  5JD2 A;  5K68 A;  4LFB T;  1MOY A;  1HF8 A;  5C0N A;  2LJL A;  1BEB A;  3G7X A;  1IJ6 A;  1I94 T;  4AXP A;  5HEG A;  2FJA A;  2RQ0 A;  3C51 A;  4YCE A;  3CX8 B;  1KF6 A;  3ETV A;  3FEK A;  3CMP A;  1H91 A;  2A3D A;  3A8Y C;  1E1H B;  5LGU B;  3RC8 A;  4CI2 B;  2H3R A;  2E4J A;  2XAG B;  3FID A;  5LHH B;  3VKH A;  4CQI A;  4QXH B;  2XST A;  5LGN B;  1UYN X;  3SLT A;  3AEE A;  4WBO A;  4I9S A;  4DUZ T;  1CHU A;  2BS4 A;  1KEY A;  4AQG A;  2LEH A;  2LM2 A;  1EUO A;  2RN4 A;  4ILU A;  4GKJ T;  2HZR A;  3CR6 A;  4GJV A;  3RYF E;  1IBM T;  3AA7 B;  4BA9 A;  2VVS A;  3C64 A;  4DND A;  1KT3 A;  4U8U N;  2MBG A;  1STR B;  4U2Y A;  2A0A A;  4IST A;  2JU7 A;  4Z2V A;  1J5E T;  3AE9 A;  2XQA A;  2FKJ A;  4IE5 A;  1SWB A;  1Y53 X;  4KP3 C;  3PV0 F;  3PDY A;  3P50 A;  2K23 A;  4HWD A;  1MVG A;  2UXB T;  3FR4 A;  5L47 A;  3H3M A;  1MX8 A;  1Y9L A;  1HNW T;  3OYX A;  5FEN A;  5KX5 E;  1WYC A;  2ACO A;  4BBO A;  1RSU B;  1KT7 A;  1JNZ A;  4H63 V;  2AT6 X;  2F73 A;  2NW9 A;  3RWX A;  3S60 A;  3N9M A;  3O4X E;  1SY1 A;  5CSE A;  2IZC B;  4GNW A;  2FTB A;  5CA1 E;  3AEF A;  4EB6 E;  3PP6 A;  1D1A A;  4GGT A;  4HWC A;  2KXP B;  2N9D A;  2NOX A;  5C8Y E;  5LBQ B;  1QFT A;  2WPU A;  4YSY A;  3A5X A;  3NVO A;  5HCM A;  1YP6 A;  1EII A;  1SMP I;  2VKO A;  3NRX A;  3KFG A;  4XMH A;  4KHP T;  3PE0 A;  3N9N A;  3KV5 A;  4PJN A;  5HZ9 A;  5K67 A;  3AA0 B;  2RP4 A;  4I9R A;  3I0A A;  4O49 A;  2KTD A;  2LSG A;  3J7Y q;  3OBL A;  2E5L T;  3ANW B;  3FBZ A;  2KT9 A;  4RUU A;  4YCH A;  5J2T E;  2XAF B;  1SLG B;  3ZN0 B;  2XQ5 A;  1OPA A;  2MWH A;  1SWN A;  1Y9T A;  4Y5D A;  2X45 A;  3B2L A;  4HGA A;  2C5J A;  2MJI A;  3Q5W A;  2JU3 A;  1JYD A;  3TKL B;  2OY7 A;  5L3F B;  4JGL A;  2ACZ A;  5LA6 E;  2CEA A;  4ZI3 C;  4YBP A;  2OVD A;  3ZPO A;  2L8K A;  3JC6 D;  2VAS A;  4DBR A;  2W00 A;  5JDG A;  3AKM A;  1X8U A;  4COT A;  2LSI A;  4KHZ F;  3PTR B;  4TZ4 C;  3RKG A;  1EW3 A;  1DV9 A;  3FB2 A;  4IMO A;  4ZH9 A;  2W62 A;  5FY1 A;  1NC9 A;  3T1Y T;  3VHL A;  5EK4 A;  1FMV A;  4IDZ A;  3N9L A;  4Q25 A;  1BLR A;  5L3D B;  4I95 A;  4CV7 A;  3SWH A;  2V7I A;  1S2P A;  2OVS A;  5IRA A;  2VWA A;  3WZN A;  2A9U A;  3ZC0 A;  3O9X A;  3WZQ A;  3QB5 A;  4LMK A;  2ALL X;  5EZY E;  3ZJ1 A;  1CRB A;  1P6P A;  3IF8 B;  2CBS A;  2QOM A;  3CML A;  2LOP A;  3RYC E;  1OBP A;  2BVL A;  3CKD A;  3MVF A;  1D3S A;  1ERB A;  1XMO T;  1STP A;  2K5B B;  4NIQ A;  1YWC A;  4KC8 A;  2F01 A;  4DR5 T;  4IRW A;  2CBR A;  3FZF B;  1QWD A;  4JI5 T;  4B3S T;  5H9K A;  2AT0 X;  1LUQ A;  2OLT A;  4ZGU A;  2Y3F A;  5JDL A;  5JH7 E;  1E2T A;  4EOZ B;  2CPT A;  1T8V A;  5HCE C;  4ZHC A;  4GKC A;  2X9W A;  4ZHQ E;  2H89 A;  2SPC A;  3JAE A;  1CUN A;  5M4Y A;  4BX5 A;  1ZND A;  4NXN T;  3HOE A;  2CM4 A;  2WDR A;  3RE6 A;  2BKO A;  1U4Q A;  3Q5D A;  2G79 A;  5AQO B;  3BX8 A;  1NAF A;  5H9N A;  3AE2 A;  4EEB A;  3WJB A;  2RTM A;  1OSP O;  3N2O A;  4UU2 A;  3EUH A;  2GK9 A;  2FJB A;  1EQD A;  3O2Y A;  4ALO A;  5B2A O;  4U74 A;  5KDM C;  2WZI A;  1ZOY A;  4AZO A;  4O4S A;  1GM6 A;  5AQU B;  3NQK A;  2GTL N;  1QSD A;  1KNR A;  4INN A;  2MF6 A;  4ZS3 A;  4PNI A;  5FXV A;  1L6M A;  2CZT A;  3ZW0 B;  2XAJ B;  5KXJ A;  2R6G F;  1JZU A;  5KHP A;  3Q5E A;  4AKR B;  5LJC A;  1RXH A;  5FL0 A;  2R74 A;  5GON E;  2PJQ A;  1KOI A;  3P6F A;  4JO6 A;  2F4V T;  2YG2 A;  5HTD A;  3AE6 A;  4JV5 T;  1KT5 A;  2JPF A;  3PJA J;  4QGW A;  1IJ5 A;  3VRA A;  1ZNE A;  1JJJ A;  2UUB T;  3ZSS A;  2LKH A;  1SWL A;  1RAV A;  2X51 A;  4I6S A;  2VL0 A;  3VRB A;  1X9B A;  1VWA B;  4KH8 A;  3KFI A;  1XWM A;  5AQF B;  3ZQ3 A;  4NLI A;  4H9Q C;  1KFF A;  3I9W A;  4TKH A;  2N2N A;  2WWV A;  4I60 A;  3FZH B;  1D1C A;  5HEU A;  2JMB A;  2DL1 A;  5B3M O;  4OFZ A;  1SWO A;  4FBV A;  2CLY C;  1LKX A;  2M67 A;  2YMS A;  2LA7 A;  3O1J A;  3M65 A;  5BR8 T;  1ZNL A;  5F1E A;  3SZJ A;  2OFM X;  3BS2 A;  1CBI A;  1S7D A;  4HKA A;  4MEE A;  2A5B A;  2H7V C;  5FXW A;  4JI8 T;  3Q2M A;  4C91 A;  1LFO A;  4OEL A;  3KZA A;  3TGB A;  2DLR A;  1HBP A;  1AQB A;  2X8T A;  3CX7 B;  4CSB A;  3TLV A;  2A2F X;  4CXX A;  1HQQ A;  1IAP A;  1SHZ C;  1G85 A;  1LID A;  3C76 X;  3DTQ A;  3SOT A;  5FY0 A;  5HTE A;  1ZV4 X;  2KD2 A;  4IL9 A;  2CBJ A;  5JRC A;  3P6H A;  1EPB A;  3KV4 A;  1QAB E;  1SY0 A;  4MHC A;  3ANW A;  4O3Z A;  3D0T A;  4TV9 E;  4NNS A;  3AE1 A;  4DR4 T;  3KBU A;  2MPK A;  4TJZ A;  2V6X A;  4MLK A;  3RYH E;  5H9A A;  1U17 A;  4GK9 A;  3SZH A;  1HX8 A;  2E9X D;  1N9M A;  2NTX A;  3IA3 A;  1SLE B;  5L3Y A;  1G74 A;  1VWC B;  1VCT A;  3ELZ A;  3HKE E;  3CKG A;  1GT1 A;  5HA1 A;  4YFQ A;  3EI0 A;  5IRU A;  4EYY R;  4N7C A;  1WLX A;  3RPU A;  5L8N A;  3TGC A;  1WR6 A;  2NWB A;  5FMN A;  1O3X A;  4GJS A;  5IUX A;  1YWA A;  2CXF A;  1SY3 A;  3R6N A;  2BDE A;  4IBA A;  4YLH A;  3F8A A;  4ZHG A;  4TNV A;  2G0U A;  2VQE T;  1A2D A;  4ORR A;  5DQV A;  3BK9 A;  2G7B A;  2OY1 O;  3MKD A;  4RUN A;  4P0B A;  5HEO A;  2IDO B;  1VWN B;  1JIW I;  4YJ2 E;  4GET A;  1LIC A;  2K62 A;  1YQ3 A;  3VU7 H;  2LKG A;  5JR9 B;  1AVG I;  3WZP A;  3WXQ A;  3APV A;  4HFD A;  1Y0G A;  5CYB A;  3STM X;  4OS0 A;  4Z8X A;  3UQ4 A;  4A56 A;  1I4U A;  2EU7 X;  4E7Z A;  1HS7 A;  2V6Y B;  3VPJ E;  1HQP A;  4DNE A;  4GKK T;  4O4J E;  5F5W A;  3EYC A;  3RIF A;  3STN A;  2KW1 A;  2DM5 A;  5B11 O;  1BSY A;  2BC3 A;  4QYN A;  1X8P A;  1ERX A;  1RBP A;  3PH5 A;  4ODD A;  5AEO A;  4I3D A;  4TUY E;  4GNY A;  1HR0 T;  4XME A;  4QH1 A;  2WAU A;  3T2X A;  4IDO A;  3GN5 A;  1Y52 X;  2AKQ A;  2L9Q A;  2ZAI A;  1SWJ A;  2ES0 A;  1MIY A;  1MND A;  4LMJ A;  1OBU A;  3F6Z B;  1SWR A;  3ZWE A;  3VG5 A;  3DP7 A;  2XM1 A;  4PSQ A;  4EAH A;  4ZGF A;  5JVD E;  2LRK A;  3T6F A;  3RGL A;  3PUG A;  1D0X A;  3CBS A;  2LM9 A;  2ACX A;  3AEH A;  2RTD B;  2NNQ A;  3K3Q C;  2WSS V;  4UVC B;  2ANS A;  5HYA A;  4XZC A;  2QMI A;  4LZU A;  1PEE A;  1E5P A;  2X0L B;  4P1N A;  1ZEE A;  1ZKE A;  2ZMA A;  5IRW A;  4PJ2 A;  3PU8 A;  2WWP A;  5AJB A;  2HPL A;  4IDN A;  1IW2 A;  2ODV A;  3MXZ A;  2KTS A;  4LZV A;  1SXX A;  3RX6 A;  3SAO A;  3JCF A;  3CIR A;  3KBT A;  1BM5 A;  4JBW F;  1IZN B;  3V5U A;  3VHM A;  3UUL A;  5LJE A;  2JOZ A;  5HCJ A;  1MDC A;  3WZO A;  5JR9 A;  2QO6 A;  2IZA A;  2CZU A;  3B2H A;  4A5X A;  1SXY A;  5FQ6 E;  4EZH A;  5FAZ A;  1LCZ A;  1W5R A;  1EZ3 A;  5CB4 E;  1ZNH A;  1TW4 A;  5HXH A;  4OMW A;  1QQS A;  3ZW2 A;  3F9D A;  5B29 A;  3WJG A;  5LHG B;  5J1G A;  4QKN A;  3ZMU B;  1N32 T;  4AYH A;  2W0G A;  3SOL A;  2HKD A;  4JYA T;  4EQA C;  1CJ5 A;  1VWP B;  4IAW A;  2BLG A;  4JI0 T;  3LFM A;  5AQM B;  5AQQ B;  3UEX A;  2LRL A;  4IE4 A;  1FIO A;  3HKB E;  3P7I A;  2AH7 X;  4ADZ A;  4X66 T;  2AXD S;  3AEB A;  3T6L A;  4KBM B;  4WW0 A;  3UQ7 A;  2L68 A;  3NP1 A;  2BHV A;  1YXR A;  3GN5 B;  5LB7 B;  4IE7 A;  4DV3 T;  4YFR A;  1SRJ A;  1OEE A;  3RIU A;  4CDF A;  3IFB A;  2JMK A;  3FBL A;  4C5P A;  4KT5 A;  4YSX A;  3WJE A;  1VWE B;  3X00 A;  3OTO T;  1AB0 A;  3EC5 A;  2BS2 A;  4BGF A;  2YKS A;  5HXC A;  4JI7 T;  2RTR B;  1ZHC A;  4BX5 B;  2BZB A;  3TLS A;  2BVM A;  5JRC B;  1SRI A;  3I0Q A;  1WYB A;  4D6B A;  3QC9 A;  5H6R B;  1IKE A;  2Y8D A;  2LOS A;  3B57 A;  1FE3 A;  4HPA A;  4BVM A;  4AQF A;  4BJ8 A;  1YWB A;  2OL8 O;  5KIC A;  1KZX A;  4WHI A;  3QUJ A;  2PY1 A;  1O8V A;  3KFW X;  4BX6 A;  5B5F A;  2ASN X;  1Z24 A;  4IDQ A;  3QNU A;  1HNZ T;  3RH3 A;  3GA8 A;  5FNV E;  4U46 A;  4EDE A;  1ACD A;  1SWQ A;  4YY3 T;  4K19 A;  3MX7 A;  4DCB A;  4BX7 B;  2RTQ B;  5BVT A;  2WR6 A;  1MMA A;  3UUM A;  2OL6 O;  1UCU A;  2WY2 A;  4AKL A;  3BU1 A;  5AQI B;  5L3B B;  4OS3 A;  2V7K A;  5LGT B;  4DQ4 A;  5HXE A;  1QLB A;  3RSW A;  1LIF A;  2OYB O;  1KK7 A;  3CPZ A;  3OPC A;  2WBL A;  4M7M A;  3CX6 B;  3JQO A;  4HWI B;  1W9R A;  4Z2O A;  4IRE A;  4EYU A;  2J1D G;  3PU3 A;  5CJ5 A;  3P6E A;  2FRS A;  2D0T A;  4H9P C;  3TZS A;  4YDB A;  1ZNG A;  5HBS A;  2FJD A;  5DAB A;  2W2B A;  3ZI8 A;  4B3T T;  1OPB A;  3RYI E;  5CHK A;  1BR2 A;  2WP9 A;  4JEU B;  2RTF B;  2LHR A;  2RA6 A;  5DPQ A;  2MYS A;  3WJC A;  2K3W A;  1QY2 A;  4DMV A;  1US7 B;  4KII A;  2CM9 A;  3FA6 A;  4FBO A;  3JAD A;  4A98 A;  4NNT A;  2A5C A;  1DZM A;  3T1D A;  4I4T E;  3HPE A;  4EXZ A;  2YU1 A;  4YGG A;  4CN1 A;  4BJN A;  2Y6X A;  3PUQ A;  1E02 A;  1E7P A;  1WCR A;  4BOE A;  3N2K E;  4P09 A;  4WFV A;  2FT9 A;  1AJ3 A;  1M62 A;  4O3Y A;  4UU3 A;  3ZYM A;  3KV6 A;  2WEW A;  1TOU A;  3NX2 A;  2IZD B;  3UEW A;  5IWA T;  4A97 A;  2CXL A;  2WS3 A;  3EW1 A;  3BRN A;  5D47 A;  4TQ2 A;  5DQW A;  4I55 E;  3IEE A;  3N9Q A;  3PK2 A;  3VG2 A;  1GQE A;  3D95 A;  4X1I E;  4IAB A;  3LJC A;  1OED E;  3VKG A;  3D9W A;  2W61 A;  3A7M A;  5EK2 A;  5IXG A;  5AQP B;  2WU5 A;  2XQ8 A;  1YUP A;  5FKY A;  2V5C A;  2MHD A;  2G8C O;  4TX5 A;  3OD9 A;  2JRK A;  4LF9 T;  3LK3 B;  3P4R A;  2IZE B;  4H9N C;  3WYQ A;  3E08 A;  2FGS A;  2XTL A;  5LCY A;  4DR7 T;  3ZMZ B;  1KL4 A;  4ZJ0 A;  5FYM A;  2A2G A;  5C2T A;  3C78 X;  4ZH6 A;  3AAI A;  3PEC A;  4YGH A;  4EEJ A;  2XQY A;  4JHQ A;  4BQU A;  4L9I A;  4EIW A;  3ESL A;  2I5Z O;  1W4T A;  2KT4 B;  2ACP X;  2BBJ A;  3N9O A;  3VU1 A;  3UFE A;  2R56 A;  5FL1 A;  3EVY A;  1XCA A;  4YKM A;  1SRE A;  4YH0 A;  1OED A;  4MVE A;  3C50 A;  4U2Z A;  4EZ4 A;  4TWD A;  3HI2 A;  1QY1 A;  2UYW A;  4XMG A;  2X66 A;  4GK5 E;  3W15 B;  4LF6 T;  2D5U A;  4ZCB A;  4PW8 A;  4X1K E;  4N78 D;  4O4I E;  4CPH A;  4U7I A;  4PK5 A;  1ALB A;  4Z2P A;  1SWT A;  3FZK B;  4QXB B;  4HFB A;  1VWB B;  3VR9 A;  3FMZ A;  1DF8 A;  3FA9 A;  2IZK A;  1K24 A;  2VKD A;  1IKJ A;  1QFV A;  1UGO A;  4HEA A;  4AW8 A;  1WRD A;  3ZYK A;  3ZEF B;  3BX7 A;  4XAX B;  1N7Y A;  4JI6 T;  1M7K A;  4O3W A;  4UVB B;  2E8I A;  4MVK A;  2JQH A;  2QA7 A;  1GT5 A;  4HE8 A;  1VWQ B;  2CAM A;  5FVL A;  5LJM A;  5D4A A;  3KDS E;  4QRL A;  4I43 B;  4CK4 A;  3D96 A;  4QZU A;  2ZLY A;  1UK5 A;  2IIU A;  4HFI A;  1GX8 A;  2JGS A;  3SLJ A;  4ZZB A;  1QY0 A;  5AQL B;  2X34 A;  3O19 A;  1I06 A;  1MUP A;  5AQK B;  3U3I A;  1JMZ A;  3UU4 A;  2BT9 A;  3RI5 A;  2E9X A;  5F2B A;  3APX A;  1VWI B;  1UYO X;  2Q9S A;  4TN7 B;  2LLY A;  3ZT5 A;  3OJY C;  5D45 A;  4IB6 A;  5LMU T;  5FFH A;  1YKH B;  2W63 A;  4ZR2 A;  2VB6 A;  2OF9 A;  3NRY A;  1QUU A;  1Y01 A;  4PAG A;  2XY8 B;  1UUS A;  5FP3 A;  3RDS A;  3E0Z A;  3F31 A;  4HN9 A;  4DV1 T;  4QWN B;  1BR0 A;  3T8O A;  1SXW A;  1YIV A;  4I50 E;  5B10 O;  2CLY B;  3HL6 A;  1KXO A;  2FR2 A;  2X32 A;  5IO5 A;  4YFP A;  3WI3 A;  1ICN A;  4OYK A;  1ICM A;  2QO5 A;  1DC9 A;  3MAC A;  3O1I A;  1LCV A;  2BBH A;  1LDQ A;  2X67 A;  4EGW A;  3UTK A;  2XAQ B;  3VE1 A;  5F7G A;  3VG6 A;  3O1H A;  4ORS A;  1GKA A;  5LJG A;  2IZG B;  3KVN A;  1YD8 G;  4X20 E;  2NNE A;  2Q9Q D;  1N9Y A;  4ARH A;  4ZXL A;  2LHN A;  1YW0 A;  3UUX B;  1PTS A;  5AQS B;  4IB8 A;  4DVD A;  2D0U A;  2XQ3 A;  1LIB A;  3FA7 A;  4CPI A;  3PUR A;  2DHR A;  3AE7 A;  4NXM T;  5DG4 A;  1SLF B;  1U0X A;  4YVB A;  1LCW A;  3I17 A;  3RC3 A;  3VR8 A;  4ERR A;  3QQ2 A;  4YFS A;  4X64 T;  4OX9 T;  1DFV A;  1LF7 A;  3FZM B;  1J5W A;  5LNK A;  2JQQ A;  3PUV F;  2CHN A;  2RD7 C;  3ZZV A;  2EHO B;  3RDU A;  2CCQ A;  3UAQ A;  1QG5 A;  3VG3 A;  4UF0 A;  5EEE A;  3FW4 A;  2XAH B;  3KFF A;  2P9B A;  4BX7 A;  1CBR A;  3MZK B;  2NW8 A;  4UVA B;  3B5M A;  1NBX A;  4WNK A;  3N5L A;  4H63 H;  4ZI7 E;  3HWG A;  4KX6 A;  3HA4 A;  1GKA B;  3RDM A;  1S94 A;  2WZH A;  2E9X B;  2WWU A;  4ISS A;  4TNW A;  2FBW A;  4GYR A;  5F58 A;  1I04 A;  3ZW0 A;  4JI3 T;  1U18 A;  5JR8 A;  3FYF A;  4E7S A;  1VWD B;  4CI1 B;  2WSJ A;  2C5I T;  1VYF A;  2NND A;  2A3F X;  1ZP0 A;  4YDA A;  2AT8 X;  1VRB A;  2V5D A;  3ETU A;  3HWE A;  4Z27 A;  1N43 A;  2IML A;  2J4G A;  2CE7 A;  5EPQ A;  3WYP A;  4U8U O;  3IA8 A;  1UUR A;  2WU2 A;  5ABF B;  3TF6 A;  3ZMV B;  4IT4 A;  3MBT A;  3LHN A;  2UXC T;  5BMV E;  2QM9 A;  4Y59 A;  1IBL T;  3FXD B;  2Q2P A;  4GH7 A;  4A1H A;  4A1Y A;  3CBC A;  2BG9 B;  2XQ4 A;  3H3A A;  4YT0 A;  2QYW A;  2OFA A;  2OL7 A;  1KQX A;  4TKB A;  3S4U A;  4CXW A;  3IBP A;  1OXZ A;  2W66 A;  3BQK A;  3BQL A;  5AQV B;  4UV9 B;  1SE7 A;  1OEJ A;  5H9L A;  3CQC B;  3ZLI A;  4CXY A;  2FLJ A;  3SFE A;  1N34 T;  1SY2 A;  3NKZ A;  1G7N A;  5HWY A;  1GGL A;  4P0A A;  4J2C A;  1FEM A;  4Y0Q A;  2MO5 A;  3UFG A;  2AE9 A;  1FTP A;  5LJD A;  3MK7 C;  3HKC E;  4AZN A;  1BR4 A;  2C5K T;  3UT5 E;  2JN3 A;  1KQW A;  2DJF A;  5DJQ C;  4XMC A;  1HFA A;  2OFR X;  4HWH A;  1AVE A;  2VKJ A;  2KWH A;  5J2U E;  2QOS C;  4Y0P A;  4HFV A;  5HEH A;  3EM0 A;  1DZK A;  3FIQ A;  1KT4 A;  1Z0P A;  3L39 A;  1FEL A;  2WMO A;  2CWY A;  3CQG B;  2W2A A;  2K48 A;  3LK4 2;  5AFU L;  3P8C D;  3N2G E;  3OVU A;  3VG4 A;  3HOL A;  1SWH A;  4ZFX A;  4O9S A;  4IDP A;  2MAW A;  1B0O A;  4X5T A;  5HZ6 A;  2O62 A;  5FQ7 E;  3J9X 1;  1KNZ A;  2KZ7 B;  3WOV A;  1R0U A;  1T68 X;  4PK6 A;  4C90 A;  3PED A;  3S5X A;  4KMC A;  5JR9 C;  4TNN A;  4ZZC A;  3FEP A;  4YTN A;  1I78 A;  5F8P A;  1AVD A;  4GIW A;  2CHO A;  2UUA T;  4LFC T;  1B8E A;  5HAX A;  4O4U A;  2XAS B;  2POA A;  4AKH A;  3VG7 A;  2FHN X;  1YKE B;  4JI2 T;  2WMN A;  3UU6 A;  1Y55 X;  2YK0 A;  3ZJ2 A;  5D8J A;  3NBX X;  4L1N A;  4LKP A;  4CN6 A;  1N36 T;  1T72 A;  2WM9 A;  3C4X A;  3MG5 A;  5L8I A;  4QYP A;  1KZW A;  4LF4 T;  3B2J A;  4V1A v;  3V8U A;  3GAQ A;  1AEL A;  3ZW1 A;  2OF8 A;  5BYP A;  3F57 A;  3P4W A;  1NGL A;  5IYZ E;  3CQN A;  2CMR A;  4UV8 B;  4F8H A;  1SRF A;  3ZCJ A;  3I0O A;  1DZJ A;  2IFB A;  4U9C A;  3QOF A;  3HK1 A;  5IHY A;  1X79 A;  2DNX A;  2JQK A;  2Y3E A;  5AQN B;  3GMI A;  1KL5 A;  3NX1 A;  4IMN A;  1V9D A;  2GTL O;  4QGX A;  2YDS A;  5HWX A;  4PJM A;  1S44 A;  2E5V A;  1D0Z A;  2PG8 A;  4FJO A;  1GX3 A;  1MIV A;  5LYJ E;  4GGZ A;  2WUT A;  3ZC1 A;  3ZUO A;  1B4M A;  4IL4 A;  4LQZ A;  5LJK A;  4MAL A;  2ZSC A;  4OHF A;  3NQ3 A;  2L67 A;  3SLO A;  4DID B;  1SWG A;  3JSQ A;  4HFH A;  4DV4 T;  2Z4I A;  4ORX A;  1LVK A;  2KIN B;  2K24 A;  4ORY A;  2XJ7 A;  2UZ2 A;  2Z4H A;  3NZP A;  3JS1 A;  4GU8 A;  2X4M A;  4TKJ A;  1RXK A;  1XZY A;  2ZM0 A;  2OZQ A;  4LF5 T;  1KT6 A;  2LBA A;  1KNP A;  4ORU A;  1N0S A;  2IW5 B;  5JDM A;  2HLV A;  2XSA A;  4PFO A;  3RQW A;  5HXR A;  2R73 A;  4M1P A;  1D1B A;  5LJN A;  1FJG T;  4ZHH A;  3APU A;  4IAX A;  3G06 A;  3LTW A;  2W4X A;  4YHH T;  2D2S A;  4YSZ A;  1EI5 A;  5B27 A;  3K8P C;  2GJ5 A;  1JBH A;  2PI3 O;  3ELX A;  2A2U A;  4BCS A;  3L8R A;  2VK9 A;  1MNE A;  4X1Y E;  4DV0 T;  1NDJ A;  2FJE A;  3F2E A;  4O8S A;  1XMQ T;  3OJA A;  4QXC B;  3TLT A;  5LP6 E;  5HA0 A;  2XHE B;  1VCS A;  3D97 A;  3EMM A;  5KMG P;  1LDO A;  3FEN A;  3N91 A;  4A8Z A;  1OBQ A;  3Q5X A;  1MK5 A;  1ADL A;  1UX4 A;  1D2U A;  1Z8U A;  2KSR A;  3QKG A;  1VWR B;  1PM1 X;  2IC6 A;  2FS7 A;  3AA6 B;  1NQM A;  4FGI B;  3CWZ B;  4FBR A;  3QK6 A;  1HN2 A;  4DV2 T;  4GGR A;  4UR9 A;  1R8I A;  2UXN B;  1HMR A;  4ZI2 C;  1T8B A;  1G5W A;  1HTJ F;  2JIW A;  2IZI A;  2VFC A;  2IUB A;  2Q9Q B;  2V7M A;  3E3C A;  2X56 A;  5HXS A;  4B55 A;  2OY5 O;  4IE6 A;  3WAJ A;  2FR3 A;  2WEX A;  3AED A;  5K06 A;  4CPE A;  5LMN T;  2BKN A;  1LIE A;  3E22 E;  3BSZ E;  4OS8 A;  5AQR B;  4G2A A;  4LFA T;  1SWS A;  5JTG A;  1HCI A;  4AZP A;  2X9Y A;  5AQH B;  5LKE A;  3I9Y A;  4X62 T;  3VGW A;  2NR4 A;  1IFC A;  1SRG A;  1E06 A;  3PPT A;  2V8S V;  4KUM B;  1RXJ A;  2A8G A;  2HMB A;  1XDO A;  4G63 A;  3BY0 A;  2FWV A;  2OVA A;  2IZH B;  3AAE B;  1X8N A;  2XUE A;  1JMX A;  3RQU A;  2HZQ A;  4TLJ A;  1SUM B;  1VWJ B;  2RTA A;  5BVS A;  2VUR A;  1MIW A;  2V26 A;  3FLL A;  2LKK A;  2W2F A;  1RST B;  4O4H E;  1CBQ A;  1S35 A;  2QGS A;  2W67 A;  3HWF A;  1W0B A;  1FDQ A;  4NV8 A;  2XKL A;  3WJF A;  1MMD A;  4WYV A;  3VHH A;  3EHZ A;  1DZP A;  4PJJ A;  3LBX A;  4AKI A;  2RTB B;  1SWD A;  3P4S A;  4GD9 A;  3MA9 A;  2IZJ A;  4A60 A;  2DWK A;  4QX8 B;  1UZ2 X;  4YTM A;  3WAK A;  5EED A;  4CDE A;  4O2A E;  3T1H T;  1JNR A;  4B6X A;  1IIU A;  4LKT A;  3PDF A;  1H7C A;  3BQI A;  4ILC A;  5E0O A;  1GXA A;  1I05 A;  5HCD C;  1W6F A;  4ZI3 D;  1BJ7 A;  2Y48 B;  4EKV A;  1SRH A;  2OFB A;  4UEM A;  2ODU A;  5HEJ A;  3C4Z A;  3LSV A;  2YEV C;  4Y0S A;  3AA1 B;  4Z6J A;  1VYG A;  3S26 A;  4I3B A;  4HWF A;  4H9S E;  2P8G A;  4WBK A;  1BRQ A;  3RE5 A;  2FUP A;  3Q9D A;  2AVI A;  3KIN B;  4QHO A;  1I9H A;  4ES7 A;  3UUN A;  5F6B A;  1SWF A;  2VL8 A;  1NEK A;  2V6Y A;  3RDQ A;  4QH4 A;  4JUY A;  5LHI B;  2VVN A;  1LVF A;  2KND A;  4TWH A;  2WQY A;  4AQY T;  3U0D A;  1PBO A;  3AEC A;  4NP1 A;  1WFD A;  2M4L A;  4XBF B;  4AI6 A;  5HCC C;  3BLG A;  2RTK A;  3AXJ A;  1DU2 A;  3ZYL A;  1JJX A;  2BG9 A;  2X8S A;  5HZQ A;  2IZB A;  2CBI A;  4F6R C;  3EBK A;  2OVE A;  1JJU A;  3ZT6 A;  2B76 A;  3VE2 A;  2J62 A;  4DQ3 A;  1BSO A;  4YHJ A;  5ABH A;  3WJD A;  3IHR A;  3JC6 C;  2YDR A;  2JU8 A;  1LKE A;  3VHI A;  1LNM A;  2YN6 A;  2YIN A;  1SWK A;  1B7T A;  2XQ7 A;  5L2L A;  3K3L A;  4MIS A;  2VQF T;  4GDA A;  3OKQ A;  4IB9 A;  2E2A A;  4AZQ A;  2V7L A;  4AZR A;  5CE4 A;  2C0S A;  4CPH B;  2VKH A;  2BS6 A;  4GK0 E;  3Q6L A;  3RZY A;  2FS6 A;  5FXX A;  4GRJ A;  3ZN1 B;  1LPJ A;  1OED C;  3L09 A;  4XMF A;  2I0M A;  2RTI B;  4AIS A;  4AZM A;  2L3L A;  1MMN A;  3H37 A;  5LOV E;  4DR6 T;  2GC9 A;  1NWM X;  2B1E A;  2EHO D;  2WB5 A;  3AB3 B;  2RTC B;  4PJL A;  2L9C A;  3CQR A;  3RF1 A;  2YDQ A;  1IBK T;  1JV4 A;  4NUV A;  2EHO C;  2RTJ A;  2XZE A;  4IIJ E;  2PBI A;  4Y0R A;  4HPC A;  3UU3 A;  4U72 A;  1RLB E;  2HHH T;  3WBG A;  3UU8 A;  2M6I A;  2X0H A;  4KCA A;  4DR2 T;  3AE3 A;  1HMT A;  5F6Z A;  2JW1 A;  2WQA E;  1BRP A;  4Z90 A;  5A1L A;  4DV6 T;  1PMP A;  5LKF A;  5HWZ A;  2VFB A;  4LML A;  5EDC A;  1UX5 A;  3P6C A;  4QZT A;  1IJ8 A;  4PK4 A;  3PH6 A;  1EXS A;  4HFE A;  2GTL M;  1BWY A;  4R0B A;  4JLE A;  2QCB A;  1SA8 A;  1MMG A;  2BKP A;  2NP1 A;  4WBN E;  2DJG A;  1PBY A;  3CWK A;  1SWA A;  5ABG A;  2C4I A;  3FR2 A;  1O1U A;  1T0V A;  1KL3 A;  4MVI A;  3ZKR A;  2LT3 A;  4EV6 A;  3LV4 A;  2E9X C;  3RRW A;  2BS5 A;  1DF3 A;  2HNX A;  4UF0 B;  2DI4 A;  5C3J A;  2EHO A;  2WCA A;  3PUS A;  3HTY A;  1OWA A;  4QNI A;  2X68 A;  2I59 A;  3OYZ A;  3STK A;  3RBY A;  3H3I A;  3RDO A;  5AQJ B;  1VWK B;  3B13 A;  1K3B A;  2XM2 A;  1LRZ A;  5LXT E;  3PUZ F;  2BSZ A;  4YKO A;  3FDC A;  5L4E A;  2RTN B;  3P6D A;  1U5P A;  1HX1 B;  3UUB A;  1JYJ A;  2JJ9 A;  4O2B E;  1SWU A;  5HAE A;  2LSJ A;  1VPR A;  3P4P A;  2QO4 A;  2UXX B;  3PJA A;  5H8T A;  4FQB B;  3AE8 A;  2BG9 C;  3U9P C;  4NV7 A;  1YP7 A;  1KFY A;  1WUB A;  1LEL A;  3RY2 A;  1L0V A;  2H7O A;  3PUY F;  4CZZ B;  2XQ6 A;  1FMW A;  4DV5 T;  2HPJ A;  3R84 B;  2RA1 A;  4K0K T;  4YXD A;  4HWM A;  1G73 A;  4ZOL E;  4IHJ E;  3EDU A;  3FW5 A;  4O3X B;  2HH7 A;  3O22 A;  4L5G A;  2I5V O;  4MBQ A;  1OEK A;  2ZM2 A;  3NZQ A;  5F3J A;  3ONL C;  3KVA A;  3ZMT B;  2CM0 A;  4JI4 T;  2RTP B;  4GUZ A;  3OBV E;  5JDH A;  1SWE A;  4GZV A;  1G8X A;  1MM9 A;  5BVQ A;  2YU2 A;  3TLW A;  4K0U A;  4NPP A;  3CKF A;  1T98 A;  4ZHD A;  3MJX A;  2AMM X;  5KID A;  3ONJ A;  4OEM A;  1VWH B;  5JRE A;  3P24 A;  4U31 A;  1SXU A;  3K3O A;  4MFR A;  4YMY A;  3AAA B;  3LBX B;  3U78 A;  3P02 A;  4ID2 A;  1E2A A;  1BSQ A;  1Y64 B;  4DO0 A;  1OED B;  2RTH B;  1HG5 A;  1ZNK A;  3AVS A;  4U7Y A;  1W0A A;  1WR0 A;  1SLD B;  1TOW A;  1STS B;  2FHL A;  4TWF A;  3L4R A;  2N1G A;  2X0Y A;  2AF5 A;  1ML7 A;  4DV7 T;  4NUU A;  2JQ9 A;  1FEW A;  1T7S A;  2RTG B;  3LG7 A;  1BR1 A;  1VWG B;  5LBM A;  3Q34 A;  4L3R A;  5FY7 A;  5L4H A;  4I3C A;  2PFV A;  4QH5 A;  1HXZ A;  1NP1 A;  4XMD A;  3P4Q A;  1N4J A;  1NP4 A;  2RTE B;  4QGV A;  4Z28 A;  4QQ1 A;  2OA5 A;  3D4R A;  4ILB A;  1CBS A;  5L3C B;  2X9H A;  4ML7 B;  3AUM O;  2HYS A;  1XNR T;  1BBP A;  2I6H A;  1W09 A;  1VWO B;  4YGZ A;  3ZST A;  4DUY T;  1YQ4 A;  4O4L E;  4JNJ A;  2YOE A;  4ZEY A;  1J1J A;  4LF7 T;  3DJB A;  5D48 A;  2ZM6 T;  3I1A A;  5JDN A;  3HKD E;  2LFO A;  5FQ8 E;  3OE3 A;  2HN2 A;  4QAE A;  2MTQ A;  5LJH A;  1VWM B;  4HPD A;  4QX7 B;  4DR3 T;  3RKO A;  4IB7 A;  3S5V A;  1D0Y A;  1TXL A;  4UXN B;  2Q9Q A;  3NR3 A;  1VOM A;  3CK6 A;  2CRB A;  2D9D A;  2XSB A;  2L5P A;  3SFD A;  3FEL A;  1HBQ A;  3NQ9 A;  5B5G A;  5ADX L;  5LJB A;  2OY8 A;  1HMS A;  3APW A;  5FXZ A;  4GDZ A;  2Q2M A;  2WDV A;  4ORW A;  2V1D B;  1SWC A;  4ON1 A;  4YBU A;  2IHR 1;  4BJM A;  4ANJ A;  1HXL A;  5JDQ A;  2FKG A;  2LSK A;  2JMH A;  3ZT7 A;  2RCQ A;  4U3Q A;  2OV9 A;  4CN4 A;  5CGM A;  5J0Z A;  3K1S A;  4LF8 T;  4NLJ A;  3FA8 A;  2BG9 E;  2X46 A;  1VWF B;  3WVM A;  2M6B A;  1WBI A;  4OK0 A;  1HY2 A;  3AKN A;  3GWH A;  2KMF A;  3GE2 A;  4GYS A;  1A57 A;  2LBV A;  4H9O C;  1MEP A;  4OYJ A;  5FVK A;  4GE1 A;  1IFB A;  1A3Y A;  2K9A A;  4BAY B;  2QRX A;  3CVR A;  3SZI A;  2N93 A;  4WFU A;  4AIU A;  1A18 A;  2C1S A;  4ZS2 A;  2DCF A;  2LB6 A;  4B3M T;  4DR1 T;  2J47 A;  3TGA A;  4BX6 B;  4OKA A;  2Y32 A;  4COF A;  3U03 A;  4IGU A;  5AQG B;  4EXT A;  2RPA A;  4B3R T;  1MX7 A;  1E00 A;  3RIU C;  3RLF F;  4N7D A;  2KLQ A;  3UEV A;  3AXJ B;  5AJC A;  4AQF C;  2BS3 A;  3EDV A;  3ZMS B;  3AVR A;  4DMW A;  5IO6 A;  3DTO A;  3C4W A;  3RRC A;  1X89 A;  2XQ9 A;  2Z6E A;  2HN1 A;  4UIG A;  1B56 A;  1EPA A;  1VYO A;  3FHN A;  2RTO B;  4M6S A;  3KFH A;  3AE4 A;  2RCT A;  1KGL A;  5ABF A;  5IO7 A;  4JEH B;  2DWG A;  2XPK A;  2CXD A;  1JQP A;  2IC9 A;  4MVL A;  3B2K A;  2V7J A;  1NQN A;  5CA0 E;  2RTL A;  1N33 T;  3FXE B;  1SWP A;  1NEN A;  3PQS A;  2KWI B;  3LK2 B; 
#chains in the Genus database with same CATH homology
 3DTQ A;  2BT9 A;  3SOT A;  5HTE A;  2KD2 A;  3APX A;  1DZP A;  3P6H A;  3NWI A;  1GT4 A;  1EPB A;  2Q9S A;  1QAB E;  1SY0 A;  3OJY C;  5D45 A;  3P6G A;  4IB6 A;  4A60 A;  5FFH A;  1UZ2 X;  4O3Z A;  3DSZ A;  4ZR2 A;  4NNS A;  5EED A;  1IIU A;  4LKT A;  4TJZ A;  1GXA A;  5H9A A;  1I05 A;  1U17 A;  3ZW1 B;  4GK9 A;  5HCD C;  4U8U M;  5HZ5 A;  1BJ7 A;  2AT5 X;  1SXW A;  1YIV A;  1KXO A;  1YWD A;  2FR2 A;  5IO5 A;  4YFP A;  1ICN A;  1ICM A;  2QO5 A;  5L8O A;  1DC9 A;  1G74 A;  2BBH A;  4EGW A;  3VE1 A;  3ELZ A;  3ZUI A;  5F7G A;  3VG6 A;  1GT1 A;  4Y0S A;  5HA1 A;  1VYG A;  4YFQ A;  4ORS A;  1GKA A;  5LJG A;  4N7C A;  3S26 A;  1ZRY A;  2X8F A;  4I3B A;  5L8N A;  3TGC A;  4O4X A;  2P8G A;  4WBK A;  1EIO A;  1BRQ A;  2NNE A;  2Q4N A;  4ZHF A;  1YWA A;  4ARH A;  1SY3 A;  4ES7 A;  4IBA A;  3F8A A;  4IB8 A;  5F6B A;  4ZHG A;  1X71 A;  1LIB A;  3FA7 A;  3HWD A;  2A13 A;  5DG4 A;  1U0X A;  1A2D A;  4ORR A;  1PBO A;  4NP1 A;  3I17 A;  2G7B A;  4EFG A;  3U0D A;  2M4L A;  4MIR A;  3C76 X;  2G78 A;  4RUN A;  1DFV A;  5HCC C;  3BLG A;  4NYR A;  3PQU A;  2Q39 A;  1JIW I;  1GX9 A;  1LF7 A;  2MM3 A;  1JJX A;  4GET A;  2X8S A;  1LIC A;  2K62 A;  5HZQ A;  3BDR A;  2GTF X;  3EBK A;  2OVE A;  2RD7 C;  3KQ0 A;  5EDB A;  3ZZV A;  3VE2 A;  4DQ3 A;  1AVG I;  1BSO A;  3EBW A;  1X8Q A;  3UAQ A;  3WXQ A;  1QG5 A;  3APV A;  3VG3 A;  5EEE A;  3B2I A;  3WJD A;  3FW4 A;  5CYB A;  3STM X;  4OS0 A;  3KFF A;  1I4U A;  5EZ2 A;  2EU7 X;  1CBR A;  2JU8 A;  1LKE A;  3VPJ E;  1HQP A;  5AQ6 A;  1LNM A;  4I0U A;  1URE A;  3EYC A;  3UEU A;  3STN A;  3HWG A;  2KW1 A;  2F09 A;  3FR5 A;  4HFO A;  2DM5 A;  3BU9 A;  3K3L A;  4MIS A;  1BSY A;  4NYQ A;  1XKI A;  4QYN A;  4D6A A;  1X8P A;  1ERX A;  1GKA B;  1RBP A;  3PH5 A;  4HPB A;  4IB9 A;  4O4O A;  4AZQ A;  4EED A;  4AZR A;  1GT3 A;  5CE4 A;  4ODD A;  2BS6 A;  5AEO A;  4I3D A;  3RZY A;  3Q6L A;  3NPO A;  2FS6 A;  4GNY A;  4GRJ A;  3C77 X;  5F58 A;  1X8O A;  4OMX A;  1I04 A;  1LPJ A;  2AL0 X;  3ZW0 A;  1O1V A;  4XME A;  4XMF A;  1U18 A;  5JR8 A;  3FYF A;  4NW4 A;  4AZM A;  2WSJ A;  1EAL A;  1FEN A;  2AKQ A;  1VYF A;  2NND A;  2A3F X;  2ZAI A;  4YDA A;  2AT8 X;  4KC7 A;  2GC9 A;  3HWE A;  1TVQ A;  2WQ9 A;  1OBU A;  3F6Z B;  2AT3 X;  3NAD A;  3ZWE A;  4ALB A;  5HZ8 A;  5EPQ A;  3VG5 A;  2L9C A;  2ZAG A;  4PSQ A;  3IA8 A;  4U8U O;  4ZGF A;  3CQR A;  3TF6 A;  3MBT A;  3LHN A;  1JV4 A;  5C0N A;  2QM9 A;  3CBS A;  4Y0R A;  2Q2P A;  4HPC A;  1BEB A;  3G7X A;  2NNQ A;  1RLB E;  4GH7 A;  4A1H A;  4A1Y A;  3CBC A;  3WBG A;  4KCA A;  2RQ0 A;  2ANS A;  1HMT A;  4YCE A;  5F6Z A;  2JW1 A;  2WQA E;  3FEK A;  1BRP A;  2QMI A;  1H91 A;  3CMP A;  4LZU A;  1KQX A;  1E5P A;  1PMP A;  5LKF A;  1PEE A;  5HWZ A;  4TKB A;  4PJ2 A;  2E4J A;  2WWP A;  2XST A;  5EDC A;  3P6C A;  4QZT A;  5AJB A;  1IW2 A;  4I9S A;  3PH6 A;  1EXS A;  1OEJ A;  2KTS A;  4LZV A;  1SXX A;  5H9L A;  3SAO A;  1EUO A;  3JCF A;  2RN4 A;  2GTL M;  2FLJ A;  1BM5 A;  1BWY A;  1SY2 A;  1G7N A;  2HZR A;  1GGL A;  4R0B A;  3CR6 A;  1SA8 A;  5LJE A;  1FEM A;  2NP1 A;  4Y0Q A;  2MO5 A;  2JOZ A;  1MDC A;  1KT3 A;  3CWK A;  4U8U N;  1FTP A;  5LJD A;  2QO6 A;  3FR2 A;  2CZU A;  3B2H A;  1O1U A;  4AZN A;  2A0A A;  1SXY A;  2JN3 A;  2JU7 A;  5FQ6 E;  1KQW A;  5FAZ A;  1T0V A;  4XMC A;  4MVI A;  1ZNH A;  1TW4 A;  2OFR X;  4EV6 A;  3LV4 A;  2BS5 A;  1DF3 A;  2HNX A;  4OMW A;  1QQS A;  2K23 A;  1MVG A;  2QOS C;  3ZW2 A;  3F9D A;  4Y0P A;  5B29 A;  3FR4 A;  3WJG A;  1MX8 A;  1Y9L A;  3HTY A;  3EM0 A;  1DZK A;  4AYH A;  5FEN A;  3FIQ A;  1KT4 A;  4QNI A;  1FEL A;  3STK A;  2ACO A;  4EQA C;  1CJ5 A;  3RBY A;  1KT7 A;  4IAW A;  3H3I A;  2BLG A;  2W2A A;  2AT6 X;  2F73 A;  3UEX A;  3RWX A;  3HOL A;  3VG4 A;  4ZFX A;  4O9S A;  3S60 A;  4YKO A;  1B0O A;  2AH7 X;  3P6D A;  1JYJ A;  1SY1 A;  2O62 A;  5HZ6 A;  4GNW A;  2FTB A;  5HAE A;  5FQ7 E;  3NP1 A;  1VPR A;  2L68 A;  3WOV A;  2BHV A;  1R0U A;  2QO4 A;  1T68 X;  5H8T A;  4FQB B;  3PED A;  3S5X A;  3U9P C;  3PP6 A;  4TNN A;  4YFR A;  1YP7 A;  1OEE A;  3FEP A;  3IFB A;  4KT5 A;  1QFT A;  1B8E A;  3WJE A;  4HWM A;  4O4U A;  2POA A;  1AB0 A;  3NVO A;  1YP6 A;  3VG7 A;  1EII A;  1SMP I;  3FW5 A;  3KFG A;  4XMH A;  4O3X B;  4D6B A;  3O22 A;  5HZ9 A;  1IKE A;  5D8J A;  3NBX X;  1OEK A;  3I0A A;  1FE3 A;  4HPA A;  4I9R A;  4L1N A;  4LKP A;  4BVM A;  4O49 A;  2KTD A;  1YWB A;  5KIC A;  5L8I A;  3OBL A;  1KZX A;  4WHI A;  4QYP A;  1KZW A;  2PY1 A;  1O8V A;  3B2J A;  4RUU A;  2ASN X;  4GZV A;  4YCH A;  3V8U A;  3GAQ A;  1AEL A;  3ZW1 A;  5BYP A;  1Z24 A;  1NGL A;  5BVQ A;  1OPA A;  2MWH A;  3CQN A;  1Y9T A;  2X45 A;  3B2L A;  4EDE A;  1ACD A;  4ZHD A;  2AMM X;  4K19 A;  5KID A;  2MJI A;  3MX7 A;  2JU3 A;  5BVT A;  1JYD A;  1DZJ A;  2IFB A;  2WR6 A;  4U9C A;  3HK1 A;  3P24 A;  1SXU A;  4YMY A;  3BU1 A;  4OS3 A;  4JGL A;  4DQ4 A;  3P02 A;  3NX1 A;  4ID2 A;  1BSQ A;  3RSW A;  1LIF A;  4IMN A;  2GTL O;  4QGX A;  4YBP A;  2OVD A;  3AKM A;  4COT A;  1X8U A;  1S44 A;  1ZNK A;  4M7M A;  1TOW A;  3RKG A;  3JQO A;  1EW3 A;  1DV9 A;  3L4R A;  2WUT A;  4IMO A;  4ZH9 A;  1ML7 A;  3P6E A;  2FRS A;  3ZUO A;  1B4M A;  4LQZ A;  5LJK A;  3TZS A;  3NQ3 A;  2L67 A;  4L3R A;  4YDB A;  1ZNG A;  5HBS A;  1BLR A;  4I3C A;  4I95 A;  2W2B A;  3ZI8 A;  1NP1 A;  4CV7 A;  1OPB A;  1S2P A;  2OVS A;  3JSQ A;  4XMD A;  2RA6 A;  5DPQ A;  1NP4 A;  3WJC A;  4QGV A;  1QY2 A;  2Z4I A;  4ORX A;  2ALL X;  4KII A;  2CM9 A;  4ORY A;  4QQ1 A;  3D4R A;  3FA6 A;  1CRB A;  1CBS A;  1P6P A;  2Z4H A;  4FBO A;  2CBS A;  3JS1 A;  4GU8 A;  4ML7 B;  4NNT A;  2HYS A;  1BBP A;  1OBP A;  4TKJ A;  1DZM A;  4YGZ A;  3T1D A;  3MVF A;  1D3S A;  1ERB A;  4EXZ A;  4YGG A;  1YWC A;  4KC8 A;  2OZQ A;  1KT6 A;  2LBA A;  2CBR A;  4ORU A;  5D48 A;  1N0S A;  1E02 A;  1QWD A;  5H9K A;  4ZGU A;  2AT0 X;  2HLV A;  4BOE A;  2LFO A;  4WFV A;  5FQ8 E;  2FT9 A;  2R73 A;  3OE3 A;  2HN2 A;  4O3Y A;  4QAE A;  4ZHH A;  4UU3 A;  5LJH A;  1T8V A;  3APU A;  4IAX A;  5HCE C;  2WEW A;  1TOU A;  4ZHC A;  4GKC A;  4HPD A;  4IB7 A;  3S5V A;  1TXL A;  1EI5 A;  3NX2 A;  5B27 A;  3NR3 A;  1ZND A;  2GJ5 A;  3UEW A;  1JBH A;  3CK6 A;  3HOE A;  2CM4 A;  3BRN A;  2A2U A;  3ELX A;  5D47 A;  4TQ2 A;  2L5P A;  3FEL A;  1HBQ A;  3NQ9 A;  3VG2 A;  3D95 A;  4IAB A;  5LJB A;  1HMS A;  2G79 A;  3BX8 A;  3APW A;  4GDZ A;  2Q2M A;  4ORW A;  5H9N A;  4EEB A;  1YUP A;  4ON1 A;  3WJB A;  4YBU A;  2MHD A;  5HA0 A;  3OD9 A;  3D97 A;  3EMM A;  4UU2 A;  3FEN A;  3N91 A;  4A8Z A;  1OBQ A;  2RCQ A;  1EQD A;  3O2Y A;  1ADL A;  4U3Q A;  4ALO A;  4ZJ0 A;  1D2U A;  2A2G A;  3C78 X;  3QKG A;  4ZH6 A;  4YGH A;  3PEC A;  4EEJ A;  1PM1 X;  4BQU A;  4AZO A;  4NLJ A;  4O4S A;  1GM6 A;  3FA8 A;  2FS7 A;  2X46 A;  3NQK A;  3WVM A;  2GTL N;  4FGI B;  2KT4 B;  4INN A;  2ACP X;  4FBR A;  2BBJ A;  3VU1 A;  2CZT A;  1L6M A;  1HN2 A;  3AKN A;  2R56 A;  3ZW0 B;  3GE2 A;  4YKM A;  1XCA A;  4YH0 A;  1A57 A;  1JZU A;  2LBV A;  4MVE A;  5KHP A;  1HMR A;  4GE1 A;  1IFB A;  5LJC A;  1A3Y A;  1G5W A;  2R74 A;  1QY1 A;  4XMG A;  2IUB A;  1KOI A;  3P6F A;  3E3C A;  2YG2 A;  5HTD A;  1KT5 A;  4ZCB A;  4QGW A;  2N93 A;  1ZNE A;  1JJJ A;  2FR3 A;  2WEX A;  4WFU A;  1ALB A;  1A18 A;  4I6S A;  2LB6 A;  5K06 A;  1LIE A;  3TGA A;  4OS8 A;  3BSZ E;  3FMZ A;  3FA9 A;  3U03 A;  4KH8 A;  5JTG A;  3KFI A;  1IKJ A;  1QFV A;  3ZQ3 A;  4AZP A;  4NLI A;  4TKH A;  1MX7 A;  1E00 A;  4AW8 A;  5LKE A;  1IFC A;  3BX7 A;  4N7D A;  2JMB A;  1E06 A;  3UEV A;  3PPT A;  4FBV A;  5AJC A;  2HMB A;  4O3W A;  2YMS A;  4MVK A;  2LA7 A;  5IO6 A;  1GT5 A;  2FWV A;  2OVA A;  3BY0 A;  1X89 A;  1ZNL A;  5F1E A;  2OFM X;  3BS2 A;  2HN1 A;  1CBI A;  1B56 A;  1EPA A;  1S7D A;  1X8N A;  5D4A A;  2HZQ A;  4M6S A;  4QRL A;  4TLJ A;  5BVS A;  3KFH A;  1LFO A;  4CK4 A;  3D96 A;  3KZA A;  4QZU A;  2RCT A;  3TGB A;  1KGL A;  3FLL A;  1HBP A;  5IO7 A;  2LKK A;  2W2F A;  1AQB A;  2X8T A;  4CSB A;  4MVL A;  1CBQ A;  1GX8 A;  3B2K A;  3HWF A;  1QY0 A;  3O19 A;  1I06 A;  1G85 A;  1MUP A;  1LID A;  1FDQ A;  3PQS A;  2XKL A;  3WJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...