3L4RA

Crystal structure of the dog lipocalin allergen can f 2 and implications for cross-reactivity to the cat allergen fel d 4
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
EPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen, lipid binding protein
molecule keywords Minor allergen Can f 2
publication title Crystal Structure of the Dog Lipocalin Allergen Can f 2: Implications for Cross-reactivity to the Cat Allergen Fel d 4
pubmed doi rcsb
source organism Canis familiaris
total genus 38
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3l4rA00
2GTFX 1SY2A 5F6ZA 3U9PC 1DFVA 3TGBA 1O8VA 4QYNA 2A3FX 1BRQA 4UU2A 1A3YA 5F58A 5HCCC 1KGLA 2BLGA 3KFIA 4YFQA 4YGZA 4M7MA 4QGXA 4IB6A 3WJFA 4NNTA 4GH7A 3C76X 2WEXA 1UZ2X 2CZTA 2WWPA 4ORSA 4GETA 4HPBA 2WQ9A 1RBPA 2Q4NA 4A8ZA 4ARHA 1DC9A 4MVIA 4YMYA 4WBKA 2MJIA 2OFRX 5H9KA 1KT7A 3BY0A 1GM6A 4LZUA 3CWKA 1ML7A 5HAEA 4ES7A 1SY3A 3UEVA 3SAOA 1BJ7A 2JU3A 3CQRA 1X71A 4YCEA 2FR3A 4QGVA 1OEEA 2RCTA 5LKEA 2KT4B 2RCQA 5CE4A 1T0VA 4BVMA 2RQ0A 3WBGA 1LKEA 3KFFA 3FA8A 1E02A 5FFHA 3VG5A 1G85A 2P8GA 2N93A 1HBPA 2POAA 3EBWA 4YBUA 4ZR2A 1GX9A 4TLJA 1CRBA 1QY2A 2L9CA 5D45A 1B4MA 1KT6A 5LJCA 4LKTA 3CQNA 1SXUA 1I04A 1PMPA 1EXSA 3HWFA 5F6BA 2Q39A 5JR8A 4YFPA 1CJ5A 4HPDA 4YDBA 3DSZA 5BVTA 1GXAA 3B2JA 1GT1A 4RUUA 1JBHA 1YP7A 1DZPA 3WVMA 1LIFA 3FW4A 1BEBA 2CM9A 4Y0SA 2YG2A 1XCAA 1IW2A 2WEWA 3MVFA 4D6AA 2HMBA 3BLGA 1E5PA 1EW3A 1S2PA 1YP6A 3TGAA 1IKEA 4GNYA 4AW8A 1G7NA 2R56A 4LKPA 1OPBA 3NQ9A 5K06A 1TVQA 4HFOA 5H9LA 2Q2MA 2AT5X 4EEJA 3PH6A 3VG2A 5D47A 1YIVA 3K3LA 1LICA 2FWVA 4ZHHA 1HMRA 1EIOA 2A2UA 5DG4A 1MVGA 1ZNGA 4QYPA 3O2YA 1A57A 2OVDA 4DQ4A 4DQ3A 3VG4A 1H91A 1ZNLA 5FAZA 5KIDA 1YWCA 5LJBA 3FMZA 4ALOA 1BSQA 4MVLA 5H8TA 1BLRA 1QY1A 2R73A 4IAWA 5HZ9A 1OEJA 1SA8A 3STMX 2AT6X 3FIQA 1QG5A 1YUPA 4XMHA 2X45A 1AVGI 2LKKA 3B2KA 5H9AA 5HTDA 2AT3X 2W2BA 3P6FA 4IB8A 1FE3A 1LFOA 1FTPA 4ZH6A 4KIIA 3L4RA 4YKMA 3ZUOA 1HBQA 4ORRA 4TKBA 3P6GA 5HZ5A 3G7XA 1S44A 3WXQA 1QFVA 1U17A 4ORWA 4AZOA 1QY0A 3WJCA 4ORUA 1QABE 4QZTA 3FENA 1ICNA 3BU9A 1BRPA 2Q9SA 1CBQA 5L8OA 1AB0A 1ICMA 3FLLA 3MBTA 2ASNX 4ALBA 5D4AA 4BOEA 4YCHA 1GX8A 2JU7A 1PBOA 1X89A 1ZNEA 1KZWA 1BWYA 1KT4A 1FDQA 1OEKA 4IBAA 5EEDA 3T1DA 4AZMA 3OJYC 2WR6A 1RLBE 2Q2PA 1KT3A 1X8PA 5L8NA 2FTBA 3C77X 4YBPA 2W2AA 1KXOA 3I17A 1LIEA 3ZQ3A 2OVAA 3UEWA 5LJEA 3NPOA 3S26A 3EM0A 3AKNA 3ELZA 2LFOA 2QOSC 4EDEA 1IIUA 3UEUA 4I9SA 1SXYA 4NYRA 3APVA 4NLIA 4Y0QA 4YFRA 1TXLA 4I3DA 3PEDA 5BVSA 1LPJA 1G74A 2NNQA 4N7DA 3DTQA 2EU7X 4BQUA 3FA9A 1HMTA 5LJHA 5HCEC 1HQPA 2CZUA 3P6DA 4OMWA 1T8VA 1NGLA 2HZRA 2QO6A 2RA6A 3WJEA 3FR2A 4OS3A 4QAEA 3VG3A 1GT5A 4YH0A 3D95A 1IFBA 5HZ8A 5LJKA 2NP1A 3FW5A 4A1HA 5FENA 2OZQA 3APWA 2A0AA 1SXXA 1GT3A 1KQXA 3D96A 2MM3A 4A60A 5IO6A 3FEPA 5EDBA 4AZPA 2L68A 1HN2A 1O1VA 5IO7A 4OMXA 2A13A 4ZCBA 3BRNA 1OBQA 5HBSA 2G78A 3HK1A 3PECA 4Y0RA 3F9DA 2XKLA 3EMMA 3TZSA 2AMMX 2WQAE 4GRJA 2ANSA 5H9NA 3CR6A 3FEKA 4ZJ0A 2CM4A 1GGLA 4TNNA 2K62A 5HA1A 1KZXA 4R0BA 2HYSA 3BU1A 4ZHFA 4AZNA 5IO5A 1GKAB 4ORYA 4MVKA 1YWAA 3RSWA 1TOWA 3EYCA 3O22A 2KTDA 1A2DA 4ODDA 4ZHCA 3TGCA 3PP6A 3JSQA 3PH5A 4LZVA 3CBSA 3I0AA 3B2LA 1G5WA 2AKQA 4XMGA 1JZUA 3P6HA 1KT5A 5LKFA 1L6MA 2WUTA 5HA0A 3TF6A 1FENA 3JS1A 1X8UA 3BDRA 3O19A 4TKHA 1JV4A 4IMNA 4NNSA 5HCDC 5B29A 1AQBA 1MDCA 2A2GA 1SY0A 1JJXA 1DZKA 1FELA 2L5PA 1ZNKA 4PSQA 4ZH9A 3WJGA 4XMDA 1SY1A 2QO4A 2NNDA 3HWEA 4I9RA 4NYQA 4RUNA 3KFHA 4O9SA 2QM9A 1LF7A 5BVQA 3VG6A 4Y0PA 4ZGUA 1OPAA 1JYDA 3NP1A 1X8QA 2G7BA 1ACDA 1YWDA 1ZNDA 4ZHDA 3AKMA 1LNMA 2GC9A 1NP1A 1EQDA 1B0OA 1DF3A 1B8EA 3FELA 1IFCA 4NLJA 4AZRA 2K23A 1N0SA 2FLJA 3P6CA 3U0DA 1I4UA 2NNEA 1QWDA 3KZAA 4ORXA 2FR2A 5LJGA 4ZHGA 3IA8A 1ZNHA 2AH7X 4M6SA 1UREA 1A18A 4OS0A 2OVEA 3WJBA 1EPAA 4YGHA 3RZYA 5D8JA 1O1UA 1R0UA 5HZQA 1D2UA 2FT9A 1D3SA 1FEMA 2DM5A 1LIBA 2RD7C 5B27A 4IB7A 1DV9A 3P6EA 1B56A 3U03A 1VYGA 3UEXA 2L67A 4XMEA 1TW4A 5KHPA 4HPAA 3NX1A 3B2HA 4GNWA 1JYJA 2LB6A 4IB9A 4QZUA 4YGGA 2AL0X 1NP4A 3GAQA 1ADLA 2HNXA 2X46A 1CBIA 4XMFA 5AQ6A 4HPCA 3ELXA 1EPBA 3B2IA 3KQ0A 1YWBA 1X8OA 3APUA 4AZQA 3CMPA 2ACOA 2AT0X 3NADA 5F1EA 1T68X 4QGWA 5EZ2A 1QQSA 3NX2A 1TOUA 2MO5A 4EXZA 3NR3A 3F8AA 5DPQA 3Q6LA 2IFBA 2HLVA 1KQWA 4I3CA 4NP1A 4TKJA 3STNA 2CBRA 2WSJA 1Z24A 3FA7A 3IFBA 4TQ2A 3BX8A 4CK4A 2E4JA 1U18A 1DZMA 1MUPA 5HTEA 1OBPA 2F73A 1ERBA 3KFGA 1I05A 2G79A 1BSOA 1GT4A 3FA6A 3STKA 3WJDA 2XSTA 5D48A 1I06A 3HWDA 4IAXA 2ALLX 3D97A 3PPTA 4WFUA 1DZJA 2FRSA 4YKOA 4XMCA 1VPRA 3BS2A 5EEEA 2LBVA 1HMSA 1XKIA 2HZQA 1JJJA 2PY1A 2AT8X 2O62A 1ZRYA 1BM5A 4N7CA 4WFVA 3FR5A 2LBAA 4I3BA 2OFMX 1AELA 1SXWA 3APXA 4IMOA 4EFGA 5F7GA 3ZUIA 1CBRA 4TJZA 4ZFXA 1QFTA 2W2FA 1S7DA 2JN3A 5EPQA 2FS7A 1MX7A 4D6BA 4GE1A 4K19A 1EIIA 1MX8A 2ACPX 4YDAA 1BSYA 1VYFA 4GKCA 2JU8A 3VG7A 2FS6A 4AYHA 4UU3A 5LJDA 5HZ6A 1PM1X 4A1YA 1U0XA 1PEEA 1EUOA 3EBKA 3C78X 5C0NA 3NQ3A 1E00A 1CBSA 5EDCA 1ALBA 1X8NA 5KICA 1LIDA 1KOIA 1EALA 2R74A 5L8IA 1OBUA 3CBCA 3BX7A 3BSZE 5HWZA 4OS8A 1P6PA 3HWGA 3QKGA 1IKJA 1E06A 1BBPA 2QO5A 3FR4A 1ERXA 2CBSA 1GKAA 2GJ5A 2JOZA
chains in the Genus database with same CATH superfamily
3PDFA 1VWRB 2GTFX 1SREA 2IZEB 3PQUA 3LV4A 1SY2A 5F6ZA 3U9PC 4FBVA 1DFVA 3P24A 4ON1A 2KTSA 4O3YA 3TGBA 4U8UO 4QQ1A 1EI5A 1O8VA 4GDAA 2A3FX 1BRQA 4GGTA 4QYNA 3FDCA 4UU2A 4CDCA 1A3YA 5F58A 4BJ8A 5CSEA 2BLGA 4DCBA 5HCCC 3KFIA 1HY2A 1KGLA 4WHIA 4YFQA 4YGZA 4M7MA 1K24A 3N91A 4QGXA 2IZAA 4IB6A 2M4LA 3EW1A 3WJFA 4NNTA 4GH7A 3C76X 2WEXA 2YMSA 1UZ2X 2CZTA 4KH8A 2WWPA 4ORSA 1STPA 4GETA 2JMBA 4HPBA 2WQ9A 1RBPA 3SLTA 2Q4NA 4D6AA 4Z27A 4A8ZA 4ARHA 1DC9A 4MVIA 1SWTA 1SWOA 4YMYA 4WBKA 3S60A 2MJIA 2IZCB 3OE3A 2OFRX 2OF8A 2GH7A 5H9KA 3RDUA 2X8FA 1KT7A 3BY0A 1GM6A 4LZUA 3T6LA 3CWKA 1ML7A 4BX7A 5HAEA 1JMXA 1SY3A 2JW1A 3UEVA 3T2WA 3VHMA 4ES7A 4CV7A 3RKGA 4BX6A 1N43A 1SWJA 1BJ7A 1VWPB 3SAOA 2IZFB 1Y52X 2MF6A 3WYPA 2JU3A 3CQRA 1X71A 4YCEA 2X8SA 1LELA 2FR3A 4QGVA 2A5BA 4BX5B 1OEEA 4GD9A 1SWPA 2RCTA 1UYOX 5LKEA 4O3XB 5B3MO 2KT4B 4GK9A 2RCQA 1KFFA 5CE4A 1T0VA 4CPEA 4BVMA 2RQ0A 3VPJE 3WBGA 1SWNA 1LKEA 2RTLA 3KFFA 3FA8A 1E02A 5FFHA 3VG5A 1G85A 2P8GA 2N93A 1HBPA 2POAA 3EBWA 4YBUA 4ZR2A 1GX9A 4TLJA 1CRBA 1QY2A 2L9CA 3AEHA 3EC5A 5D45A 3X00A 1B4MA 1KT6A 2Y32A 2UYWA 5LJCA 4LKTA 3CQNA 3RDQA 3RWXA 1SXUA 1I04A 2DJFA 1PMPA 2QMIA 1EXSA 2X4MA 5IRAA 2AVIA 4U3QA 3HWFA 4GGZA 2Q39A 5F6BA 5JR8A 1W5RA 4YFPA 4CPHA 1CJ5A 3VE1A 1W6FA 1SWBA 4HPDA 4YDBA 4CDEA 3VE2A 3DSZA 3ZW1B 2RTPB 5BVTA 1GXAA 3B2JA 1GT1A 4RUUA 1JBHA 4FBRA 1YP7A 1DZPA 2X55A 1LIFA 3FW4A 3WVMA 1BEBA 1JJUA 1MEPA 2F09A 2CAMA 1SWDA 2CM9A 4Y0SA 2YG2A 1XCAA 1IW2A 4YVBA 2IZDB 2WEWA 3MVFA 2HMBA 3BLGA 1E5PA 1EW3A 1S2PA 1YP6A 4FBOA 4QNIA 3SZIA 1K3BA 1IKEA 1VWNB 2RTNB 4GNYA 1G7NA 2R56A 3MM0A 4LKPA 2IZIA 1OPBA 4AW8A 1SWHA 3NQ9A 5K06A 1TVQA 4HFOA 4IRWA 5H9LA 2G5LA 2Q2MA 2Z4IA 2AT5X 4EEJA 4QRLA 3PH6A 3VG2A 1HXZA 4ML7B 2WPUA 5D47A 2IZLB 1LUQA 4NW4A 2RTQB 2JGSA 1YIVA 3K3LA 1LICA 2FWVA 4ZHHA 1HMRA 1EIOA 2A2UA 5DG4A 1MVGA 1ZNGA 1VWOB 4O4SA 4QYPA 3O2YA 3VHIA 4OELA 1A57A 2OVDA 4DQ4A 1MM9A 2IZGB 3VG4A 4MVEA 3H3IA 1H91A 1RSTB 3SLJA 5BVSA 4DQ3A 1ZNLA 1MOYA 5FAZA 5BYPA 5KIDA 1VWBB 1YWCA 5LJBA 2JOZA 1VWIB 2OY5O 3FMZA 4ALOA 1BSQA 4JNJA 4MVLA 2G8CO 5H8TA 5IRUA 1BLRA 1LCVA 1QY1A 2R73A 4IAWA 5HZ9A 1OEJA 1SA8A 3STMX 4JGLA 2AT6X 3FIQA 4GDZA 1QG5A 1YUPA 4XMHA 4I60A 2OY1O 4U8UM 2OL7A 2X45A 1AVGI 2OFBA 2LKKA 3B2KA 1MK5A 5H9AA 5HTDA 2RTDB 2X34A 2AT3X 2W2BA 3P6FA 1N9YA 3E3CA 1FE3A 1LFOA 4IB8A 1FTPA 4JHQA 4ZH6A 1SWFA 3RDMA 4KIIA 3L4RA 4BX7B 2VDFA 4YKMA 3ZUOA 1HBQA 4ORRA 4TKBA 3P6GA 5HZ5A 1E2TA 3FYFA 3G7XA 3P02A 4CSBA 1S44A 5AJBA 3WXQA 1QFVA 1U17A 4ORWA 2RTGB 4AZOA 1QY0A 2FKGA 3WJCA 4ORUA 1QABE 4QZTA 3FENA 2VFBA 1ICNA 3BU9A 1BRPA 2Q9SA 1CBQA 5L8OA 1AB0A 4ZGFA 1ICMA 1LDOA 3FLLA 3MBTA 2ASNX 4ALBA 5D4AA 4BOEA 4YCHA 1GX8A 1Y53X 1PBOA 1X89A 1ZNEA 2JU7A 3TGAA 2X32A 1KZWA 2ZAGA 1BWYA 1KT4A 1FDQA 1OEKA 3ZZVA 4IBAA 1VWAB 5EEDA 3T1DA 4AZMA 2IZBA 3OJYC 2WR6A 1RLBE 2Q2PA 1KT3A 1SWLA 1X8PA 2FTBA 3C77X 4YBPA 5L8NA 2A5CA 2W2AA 1KXOA 3I17A 1LIEA 1SRGA 3ZQ3A 2OVAA 3UEWA 5LJEA 1NQNA 1SWQA 3EM0A 3AKNA 3NPOA 3S26A 3ELZA 2LFOA 2MWHA 2QOSC 4EDEA 1IIUA 3UEUA 4I9SA 1SXYA 4NYRA 3APVA 4NLIA 3F6ZB 4Y0QA 3T6FA 2KD2A 2RTCB 4YFRA 1TXLA 2UZ2A 4I3DA 3PEDA 1IJ8A 2RTKA 4U46A 1LPJA 1G74A 2NNQA 4N7DA 4I6SA 4LQZA 3DTQA 2EU7X 4O3WA 3FA9A 4BQUA 1SWGA 1HMTA 3UAQA 5HCEC 1HQPA 2CZUA 3P6DA 4OMWA 1T8VA 1NGLA 2HZRA 2QO6A 1RSUB 2RA6A 3FR2A 3PQSA 4OS3A 4O4UA 3WJEA 3LHNA 1KL5A 4QAEA 4Z6JA 3VG3A 1GT5A 1VWHB 4YH0A 3D95A 1DF8A 1IFBA 5HZ8A 5LJKA 2NP1A 3WYQA 3FW5A 3WZNA 4A1HA 5FENA 2OZQA 3APWA 1NC9A 3S5XA 2A0AA 1SXXA 5FQ8E 1GT3A 4CDFA 2FGSA 3OD9A 2OVSA 1KQXA 1SLFB 3D96A 2MM3A 4A60A 5IO6A 1SWKA 1SRFA 3FEPA 4NV7A 5EDBA 4AZPA 1N9MA 2L68A 2Y3EA 2GTLN 1HN2A 3HTYA 1O1VA 3JQOA 5IO7A 4FQBB 1N4JA 4OMXA 4L3RA 3RE6A 2A13A 1SLDB 2RTHB 4Y5DA 4ZCBA 3BRNA 2RN4A 1OBQA 4KCAA 5HBSA 2G78A 3HK1A 3PECA 4Y0RA 1SWUA 2IZJA 3F9DA 2XKLA 3EMMA 2RTOB 2AMMX 3TZSA 2BSZA 2WQAE 4DNEA 4GRJA 2ANSA 5H9NA 3CR6A 4I95A 2FHNX 1SLEB 3FEKA 2CM4A 1GGLA 4TNNA 2K62A 5HA1A 4ZJ0A 3OBLA 1UYNX 2IZKA 4R0BA 1KZXA 2HYSA 3BU1A 3ZW2A 4BX5A 4MEEA 3WOVA 4ZHFA 4AZNA 2OYBO 1VWGB 5IO5A 1GKAB 3RE5A 1NQMA 2RTMA 4ORYA 4MVKA 3PK2A 1YWAA 3RSWA 1TOWA 3EYCA 1RXJA 3RY1A 3AUMO 1HQQA 1N7YA 3O22A 2KTDA 4GJVA 1LDQA 1A2DA 2Y3FA 4ODDA 4ZHCA 3HPEA 2HKDA 3PP6A 5B5FA 3TGCA 2VFCA 3JSQA 3PH5A 4EQAC 1SWCA 1WBIA 4LZVA 5F2BA 3CBSA 3I0AA 3B2LA 1G5WA 1HXLA 2AKQA 2LA7A 5JD2A 4XMGA 1JQPA 1VWMB 1JZUA 3P6HA 4GGRA 4GU8A 1KT5A 4FGIB 1L6MA 2WUTA 3NBXX 5B5GA 2X56A 5LKFA 5HA0A 4Z2VA 5L3YA 4U8UN 3TF6A 2OY7A 1PTSA 1FENA 3JS1A 1X8UA 3BDRA 3O19A 3V8UA 1STSB 5IXGA 2PI3O 1Y0GA 1JV4A 4IMNA 4O4OA 1KL3A 1JIWI 4NNSA 4O4XA 4TKHA 3VU1A 1AQBA 1WUBA 5B29A 1MDCA 1VWKB 5HCDC 1LCZA 1SY0A 1VWQB 2A2GA 4GUZA 1VWDB 1NDJA 1DZKA 3ZW1A 1JJXA 1FELA 5B11O 3SZHA 5LJHA 4O3ZA 2L5PA 1ZNKA 4PSQA 4ZH9A 3RDXA 3WJGA 4XMDA 1SY1A 2QO4A 2MHDA 2I5VO 2NNDA 3HWEA 4I9RA 4NYQA 4RUNA 3KFHA 4O9SA 2QM9A 1LF7A 2BC3A 5BVQA 3VG6A 4Y0PA 4ZGUA 1OPAA 2RTIB 5AEOA 1JYDA 3NP1A 1X8QA 2G7BA 1ACDA 2OL6O 1PBYA 4IABA 1YWDA 1NBXA 1ZNDA 3AKMA 4ZHDA 4ID2A 1LNMA 2IZHB 2GC9A 1NP1A 1EQDA 1B0OA 2KW1A 1DF3A 1B8EA 3FELA 1IFCA 4NLJA 4O49A 4AZRA 2K23A 3HOEA 1N0SA 2FLJA 3P6CA 3U0DA 1I4UA 5B10O 1AVEA 2NNEA 4PJ2A 1QWDA 1VWCB 3KZAA 4ORXA 2FR2A 5LJGA 4CPIA 4ZHGA 2Z4HA 3IA8A 1ZNHA 1W4TA 2C1QA 2AH7X 4M6SA 4Z2PA 4COTA 1UREA 1A18A 1RXHA 1VWJB 2OVEA 4OS0A 3WJBA 4CDDA 1EPAA 2ZSCA 4YGHA 3RZYA 5D8JA 1O1UA 1R0UA 5HZQA 1D2UA 1VYOA 3VHHA 2FT9A 1D3SA 1FJ1E 1SWRA 1FEMA 2DM5A 1LIBA 2RD7C 4INNA 4JO6A 5B27A 3WZQA 4CPHB 4IB7A 1DV9A 4KC7A 1VWLB 1Y9LA 3P6EA 1B56A 3U03A 1VYGA 3UEXA 2L67A 4XMEA 4BGFA 1TW4A 2OF9A 4HPAA 3MX7A 3NX1A 5KHPA 3B2HA 4GNWA 1JYJA 2LB6A 4IB9A 4QZUA 4YGGA 2F01A 2AL0X 1NP4A 3GAQA 3WZPA 1ADLA 3ZWEA 3MG5A 4OKAA 2HNXA 5CHKA 4BBOA 2X46A 1SMPI 4KT5A 4C5PA 1CBIA 4XMFA 3S5VA 5AQ6A 4HPCA 4BX6B 3ZI8A 2BS6A 2C4IA 3ELXA 3RDOA 2DJGA 1EPBA 3B2IA 3KQ0A 1YWBA 1X8OA 1JMZA 4MISA 4U9CA 3APUA 1SWSA 4AZQA 1SRHA 2OY8A 3LTWA 3CMPA 4MIRA 2ACOA 2AT0X 3NADA 4Y59A 1T68X 5AJCA 4QGWA 5F1EA 5EZ2A 1QQSA 3NX2A 1TOUA 2MO5A 5FQ6E 4EXZA 3NR3A 3F8AA 5DPQA 3Q6LA 2IFBA 2HLVA 1KQWA 3KVNA 4I3CA 1KL4A 4NP1A 4TKJA 4Z28A 1SRJA 3SOTA 3STNA 2OFAA 3FIDA 2CBRA 2WSJA 2X8TA 1Z24A 3FA7A 3IFBA 1VWFB 4TQ2A 3BX8A 3RDSA 4CK4A 2E4JA 1U18A 4Z2OA 2FHLA 1DZMA 1MUPA 5HTEA 1OBPA 1SWAA 2F73A 5K67A 1ERBA 3KFGA 1I05A 2G79A 4EKVA 1BSOA 1GT4A 2BHVA 3FA6A 3STKA 3WJDA 1OSPO 2XSTA 4GZVA 5D48A 1I06A 3HWDA 4IAXA 2ALLX 3D97A 1Y9TA 3PPTA 4WFUA 1DZJA 2FRSA 1RAVA 4YKOA 4XMCA 1VPRA 3BS2A 4GJSA 5EEEA 1AVDA 2LBVA 1HMSA 1XKIA 2HZQA 3CKFA 1JJJA 2RTRB 2AT8X 2O62A 2PY1A 1ZRYA 1BM5A 4N7CA 1GX3A 4WFVA 3FR5A 2LBAA 4I3BA 1SWEA 1LCWA 2OFMX 2GTLM 1AELA 1SXWA 1VWEB 3NQKA 3APXA 4IMOA 4EFGA 2FKJA 2RTAA 5F7GA 3ZUIA 1CBRA 4TJZA 4ZFXA 2RTEB 1QFTA 2W2FA 1S7DA 2JN3A 3ZW0A 2I5ZO 1STRB 5EPQA 3SZJA 2FS7A 1MX7A 2A8GA 2GTLO 3EW2A 4D6BA 4GE1A 4KC8A 4K19A 1EIIA 1MX8A 2ACPX 5K68A 2QCBA 4YDAA 1BSYA 1VYFA 4GKCA 2JU8A 4OEMA 2FS6A 4HWMA 4UU3A 3VG7A 4AYHA 5LJDA 3SLOA 1SRIA 3QQ2A 5HZ6A 3VGWA 1PM1X 4A1YA 1I9HA 1U0XA 1PEEA 1EUOA 4L1NA 2RTFB 3EBKA 3C78X 5C0NA 5IRWA 2ZAIA 3RBYA 3NQ3A 1E00A 1CBSA 5B2AO 5CYBA 5EDCA 5FQ7E 1ALBA 1X8NA 3T2XA 1LIDA 3WZOA 1KOIA 4CPFA 5KICA 2BT9A 1EALA 1SLGB 2R74A 3Q34A 4NV8A 5L8IA 1OBUA 3GE2A 3ZW0B 3CBCA 3D9WA 3BX7A 1Y55X 3BSZE 5HWZA 4OS8A 1P6PA 2C1SA 2RTBB 3HWGA 3RY2A 3QKGA 1RXKA 1IKJA 2BS5A 2QOMA 1E06A 1BBPA 2OL8O 2QO5A 2RTJA 3FR4A 3HOLA 1ERXA 3CKGA 2CBSA 1I78A 1GKAA 4B55A 2GJ5A 4BCSA 3D4RA 2AF5A
chains in the Genus database with same CATH topology
2GTFX 3PQUA 3LV4A 1SY2A 5F6ZA 3U9PC 4FBVA 1DFVA 3P24A 4ON1A 2KTSA 4O3YA 3TGBA 4U8UO 4QQ1A 1EI5A 1O8VA 4QYNA 2A3FX 1BRQA 4UU2A 1A3YA 5F58A 5HCCC 1KGLA 2BLGA 3KFIA 4WHIA 4YFQA 4YGZA 4M7MA 3N91A 4QGXA 4IB6A 2M4LA 3WJFA 4NNTA 4GH7A 3C76X 2WEXA 2YMSA 1UZ2X 2CZTA 4KH8A 2WWPA 4ORSA 4GETA 2JMBA 4HPBA 2WQ9A 1RBPA 2Q4NA 4A8ZA 4ARHA 1DC9A 4MVIA 4YMYA 4WBKA 3S60A 2MJIA 3OE3A 2OFRX 5H9KA 2X8FA 1KT7A 3BY0A 1GM6A 4LZUA 3CWKA 1ML7A 5HAEA 4ES7A 1SY3A 2JW1A 3UEVA 4CV7A 3RKGA 3SAOA 1BJ7A 2JU3A 3CQRA 1X71A 4YCEA 2X8SA 2FR3A 4QGVA 1OEEA 2RCTA 5LKEA 4O3XB 2KT4B 4GK9A 2RCQA 5CE4A 1T0VA 4BVMA 2RQ0A 3VPJE 3WBGA 1LKEA 3KFFA 3FA8A 1E02A 5FFHA 3VG5A 1G85A 2P8GA 2N93A 1HBPA 2POAA 3EBWA 4YBUA 4ZR2A 1GX9A 4TLJA 1CRBA 1QY2A 2L9CA 5D45A 1B4MA 1KT6A 5LJCA 4LKTA 3CQNA 3RWXA 1SXUA 1I04A 1PMPA 2QMIA 1EXSA 4U3QA 3HWFA 5F6BA 2Q39A 5JR8A 4YFPA 1CJ5A 3VE1A 4HPDA 4YDBA 3VE2A 3DSZA 3ZW1B 5BVTA 1GXAA 3B2JA 1GT1A 4RUUA 1JBHA 4FBRA 1YP7A 1DZPA 3WVMA 1LIFA 3FW4A 1BEBA 2F09A 2CM9A 4Y0SA 2YG2A 1XCAA 1IW2A 2WEWA 3MVFA 4D6AA 2HMBA 3BLGA 1E5PA 1EW3A 1S2PA 1YP6A 4FBOA 4QNIA 3TGAA 1IKEA 4GNYA 4AW8A 1G7NA 2R56A 4LKPA 1OPBA 3NQ9A 5K06A 1TVQA 4HFOA 5H9LA 2Q2MA 2Z4IA 2AT5X 4EEJA 4QRLA 3PH6A 3VG2A 4ML7B 5D47A 4NW4A 1YIVA 3K3LA 1LICA 2FWVA 4ZHHA 1HMRA 1EIOA 2A2UA 5DG4A 1MVGA 1ZNGA 4O4SA 4QYPA 3O2YA 1A57A 2OVDA 4DQ4A 4DQ3A 3VG4A 4MVEA 3H3IA 1H91A 1ZNLA 5FAZA 5BYPA 5KIDA 1YWCA 5LJBA 3FMZA 4ALOA 1BSQA 4MVLA 5H8TA 1BLRA 1QY1A 2R73A 4IAWA 5HZ9A 1OEJA 1SA8A 3STMX 4JGLA 2AT6X 3FIQA 4GDZA 1QG5A 1YUPA 4XMHA 4U8UM 2X45A 1AVGI 2LKKA 3B2KA 5H9AA 5HTDA 2AT3X 2W2BA 3P6FA 3E3CA 4IB8A 1FE3A 1LFOA 1FTPA 4ZH6A 4KIIA 3L4RA 4YKMA 3ZUOA 1HBQA 4ORRA 4TKBA 3P6GA 5HZ5A 3FYFA 3G7XA 3P02A 4CSBA 1S44A 5AJBA 3WXQA 1QFVA 1U17A 4ORWA 4AZOA 1QY0A 3WJCA 4ORUA 1QABE 4QZTA 3FENA 1ICNA 3BU9A 1BRPA 2Q9SA 1CBQA 5L8OA 1AB0A 4ZGFA 1ICMA 3FLLA 3MBTA 2ASNX 4ALBA 5D4AA 4BOEA 4YCHA 1GX8A 2JU7A 1PBOA 1X89A 1ZNEA 1KZWA 2ZAGA 1BWYA 1KT4A 1FDQA 1OEKA 3ZZVA 4IBAA 5EEDA 3T1DA 4AZMA 3OJYC 2WR6A 1RLBE 2Q2PA 1KT3A 1X8PA 5L8NA 2FTBA 3C77X 4YBPA 2W2AA 1KXOA 3I17A 1LIEA 3ZQ3A 2OVAA 3UEWA 5LJEA 3NPOA 3S26A 3EM0A 3AKNA 3ELZA 2LFOA 2MWHA 2QOSC 4EDEA 1IIUA 3UEUA 4I9SA 1SXYA 4NYRA 3APVA 4NLIA 3F6ZB 4Y0QA 2KD2A 4YFRA 1TXLA 4I3DA 3PEDA 5BVSA 1LPJA 1G74A 2NNQA 4N7DA 4I6SA 4LQZA 3DTQA 2EU7X 4O3WA 3FA9A 4BQUA 1HMTA 3UAQA 5HCEC 1HQPA 2CZUA 3P6DA 4OMWA 1T8VA 1NGLA 2HZRA 2QO6A 2RA6A 3PQSA 3FR2A 4OS3A 3WJEA 4O4UA 3LHNA 4QAEA 3VG3A 1GT5A 4YH0A 3D95A 1IFBA 5HZ8A 5LJKA 2NP1A 3FW5A 4A1HA 5FENA 2OZQA 3APWA 3S5XA 2A0AA 1SXXA 5FQ8E 1GT3A 3OD9A 2OVSA 1KQXA 3D96A 2MM3A 4A60A 5IO6A 3FEPA 5EDBA 4AZPA 2L68A 2GTLN 1HN2A 3HTYA 1O1VA 3JQOA 5IO7A 4FQBB 4OMXA 4L3RA 2A13A 4ZCBA 3BRNA 2RN4A 1OBQA 4KCAA 5HBSA 2G78A 3HK1A 3PECA 4Y0RA 3F9DA 2XKLA 3EMMA 3TZSA 2AMMX 2WQAE 4GRJA 2ANSA 5H9NA 3CR6A 4I95A 3FEKA 4ZJ0A 2CM4A 1GGLA 4TNNA 2K62A 5HA1A 3OBLA 1KZXA 4R0BA 2HYSA 3BU1A 3ZW2A 3WOVA 4ZHFA 4AZNA 5IO5A 1GKAB 4ORYA 4MVKA 1YWAA 3RSWA 1TOWA 3EYCA 3O22A 2KTDA 1A2DA 4ODDA 4ZHCA 3TGCA 3PP6A 3JSQA 3PH5A 4EQAC 4LZVA 3CBSA 3I0AA 3B2LA 1G5WA 2AKQA 2LA7A 4XMGA 1JZUA 3P6HA 4GU8A 1KT5A 4FGIB 1L6MA 2WUTA 3NBXX 5LKFA 5HA0A 4U8UN 3TF6A 1FENA 3JS1A 1X8UA 3BDRA 3O19A 3V8UA 4TKHA 1JV4A 4IMNA 4O4OA 4NNSA 1JIWI 4O4XA 3VU1A 5HCDC 5B29A 1AQBA 1MDCA 2A2GA 1SY0A 1JJXA 1DZKA 3ZW1A 1FELA 5LJHA 4O3ZA 2L5PA 1ZNKA 4PSQA 4ZH9A 3WJGA 4XMDA 1SY1A 2QO4A 2MHDA 2NNDA 3HWEA 4I9RA 4NYQA 4RUNA 3KFHA 4O9SA 2QM9A 1LF7A 5BVQA 3VG6A 4Y0PA 4ZGUA 1OPAA 5AEOA 1JYDA 3NP1A 1X8QA 2G7BA 1ACDA 4IABA 1YWDA 1ZNDA 4ZHDA 3AKMA 4ID2A 1LNMA 2GC9A 1NP1A 1EQDA 1B0OA 2KW1A 1DF3A 1B8EA 3FELA 1IFCA 4NLJA 4O49A 4AZRA 2K23A 3HOEA 1N0SA 2FLJA 3P6CA 3U0DA 1I4UA 2NNEA 4PJ2A 1QWDA 3KZAA 4ORXA 2FR2A 5LJGA 4ZHGA 2Z4HA 3IA8A 1ZNHA 2AH7X 4M6SA 4COTA 1UREA 1A18A 4OS0A 2OVEA 3WJBA 1EPAA 4YGHA 3RZYA 5D8JA 1O1UA 1R0UA 5HZQA 1D2UA 2FT9A 1D3SA 4INNA 3ZW0A 1FEMA 2DM5A 1LIBA 2RD7C 5B27A 4IB7A 1DV9A 4KC7A 1Y9LA 3P6EA 1B56A 3U03A 1VYGA 3UEXA 2L67A 4XMEA 1TW4A 5KHPA 4HPAA 3MX7A 3NX1A 3B2HA 4GNWA 1JYJA 2LB6A 4IB9A 4QZUA 4YGGA 2AL0X 1NP4A 3GAQA 1ADLA 3ZWEA 2HNXA 2X46A 1SMPI 4KT5A 1CBIA 4XMFA 3S5VA 5AQ6A 4HPCA 3ZI8A 2BS6A 3ELXA 1EPBA 3B2IA 3KQ0A 1YWBA 1X8OA 4MISA 4U9CA 3APUA 4AZQA 3CMPA 4MIRA 2ACOA 2AT0X 3NADA 5F1EA 1T68X 5AJCA 4QGWA 5FQ6E 5EZ2A 1QQSA 3NX2A 1TOUA 2MO5A 4EXZA 3NR3A 3F8AA 5DPQA 3Q6LA 2IFBA 2HLVA 1KQWA 4I3CA 4NP1A 4TKJA 3SOTA 3STNA 2CBRA 2WSJA 2X8TA 1Z24A 3FA7A 3IFBA 4TQ2A 3BX8A 4CK4A 2E4JA 1U18A 1DZMA 1MUPA 5HTEA 1OBPA 2F73A 1ERBA 3KFGA 1I05A 2G79A 1BSOA 1GT4A 2BHVA 3FA6A 3STKA 3WJDA 2XSTA 4GZVA 5D48A 1I06A 3HWDA 4IAXA 2ALLX 3D97A 1Y9TA 3PPTA 4WFUA 1DZJA 2FRSA 4YKOA 4XMCA 1VPRA 3BS2A 5EEEA 2LBVA 1HMSA 1XKIA 2HZQA 1JJJA 2PY1A 2AT8X 2O62A 1ZRYA 1BM5A 4N7CA 4WFVA 3FR5A 2LBAA 4I3BA 2OFMX 2GTLM 1AELA 1SXWA 3NQKA 3APXA 4IMOA 4EFGA 5F7GA 3ZUIA 1CBRA 4TJZA 4ZFXA 1QFTA 2W2FA 1S7DA 2JN3A 5EPQA 2FS7A 1MX7A 2GTLO 4D6BA 4GE1A 4KC8A 4K19A 1EIIA 1MX8A 2ACPX 4YDAA 1BSYA 1VYFA 4GKCA 2JU8A 3VG7A 2FS6A 4HWMA 4UU3A 4AYHA 5LJDA 5HZ6A 1PM1X 4A1YA 1U0XA 1PEEA 1EUOA 4L1NA 3EBKA 3C78X 5C0NA 2ZAIA 3RBYA 3NQ3A 1E00A 1CBSA 5CYBA 5EDCA 5FQ7E 1ALBA 1X8NA 5KICA 1LIDA 1KOIA 2BT9A 1EALA 2R74A 5L8IA 1OBUA 3GE2A 3ZW0B 3CBCA 3BX7A 3BSZE 5HWZA 4OS8A 1P6PA 3HWGA 3QKGA 1IKJA 2BS5A 3HOLA 1E06A 1BBPA 2QO5A 3FR4A 1ERXA 2CBSA 1GKAA 2GJ5A 3D4RA 2JOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTF X;  1SY2 A;  5F6Z A;  3U9P C;  1DFV A;  3TGB A;  1O8V A;  4QYN A;  2A3F X;  1BRQ A;  4UU2 A;  1A3Y A;  5F58 A;  5HCC C;  1KGL A;  2BLG A;  3KFI A;  4YFQ A;  4YGZ A;  4M7M A;  4QGX A;  4IB6 A;  3WJF A;  4NNT A;  4GH7 A;  3C76 X;  2WEX A;  1UZ2 X;  2CZT A;  2WWP A;  4ORS A;  4GET A;  4HPB A;  2WQ9 A;  1RBP A;  2Q4N A;  4A8Z A;  4ARH A;  1DC9 A;  4MVI A;  4YMY A;  4WBK A;  2MJI A;  2OFR X;  5H9K A;  1KT7 A;  3BY0 A;  1GM6 A;  4LZU A;  3CWK A;  1ML7 A;  5HAE A;  4ES7 A;  1SY3 A;  3UEV A;  3SAO A;  1BJ7 A;  2JU3 A;  3CQR A;  1X71 A;  4YCE A;  2FR3 A;  4QGV A;  1OEE A;  2RCT A;  5LKE A;  2KT4 B;  2RCQ A;  5CE4 A;  1T0V A;  4BVM A;  2RQ0 A;  3WBG A;  1LKE A;  3KFF A;  3FA8 A;  1E02 A;  5FFH A;  3VG5 A;  1G85 A;  2P8G A;  2N93 A;  1HBP A;  2POA A;  3EBW A;  4YBU A;  4ZR2 A;  1GX9 A;  4TLJ A;  1CRB A;  1QY2 A;  2L9C A;  5D45 A;  1B4M A;  1KT6 A;  5LJC A;  4LKT A;  3CQN A;  1SXU A;  1I04 A;  1PMP A;  1EXS A;  3HWF A;  5F6B A;  2Q39 A;  5JR8 A;  4YFP A;  1CJ5 A;  4HPD A;  4YDB A;  3DSZ A;  5BVT A;  1GXA A;  3B2J A;  1GT1 A;  4RUU A;  1JBH A;  1YP7 A;  1DZP A;  3WVM A;  1LIF A;  3FW4 A;  1BEB A;  2CM9 A;  4Y0S A;  2YG2 A;  1XCA A;  1IW2 A;  2WEW A;  3MVF A;  4D6A A;  2HMB A;  3BLG A;  1E5P A;  1EW3 A;  1S2P A;  1YP6 A;  3TGA A;  1IKE A;  4GNY A;  4AW8 A;  1G7N A;  2R56 A;  4LKP A;  1OPB A;  3NQ9 A;  5K06 A;  1TVQ A;  4HFO A;  5H9L A;  2Q2M A;  2AT5 X;  4EEJ A;  3PH6 A;  3VG2 A;  5D47 A;  1YIV A;  3K3L A;  1LIC A;  2FWV A;  4ZHH A;  1HMR A;  1EIO A;  2A2U A;  5DG4 A;  1MVG A;  1ZNG A;  4QYP A;  3O2Y A;  1A57 A;  2OVD A;  4DQ4 A;  4DQ3 A;  3VG4 A;  1H91 A;  1ZNL A;  5FAZ A;  5KID A;  1YWC A;  5LJB A;  3FMZ A;  4ALO A;  1BSQ A;  4MVL A;  5H8T A;  1BLR A;  1QY1 A;  2R73 A;  4IAW A;  5HZ9 A;  1OEJ A;  1SA8 A;  3STM X;  2AT6 X;  3FIQ A;  1QG5 A;  1YUP A;  4XMH A;  2X45 A;  1AVG I;  2LKK A;  3B2K A;  5H9A A;  5HTD A;  2AT3 X;  2W2B A;  3P6F A;  4IB8 A;  1FE3 A;  1LFO A;  1FTP A;  4ZH6 A;  4KII A;  3L4R A;  4YKM A;  3ZUO A;  1HBQ A;  4ORR A;  4TKB A;  3P6G A;  5HZ5 A;  3G7X A;  1S44 A;  3WXQ A;  1QFV A;  1U17 A;  4ORW A;  4AZO A;  1QY0 A;  3WJC A;  4ORU A;  1QAB E;  4QZT A;  3FEN A;  1ICN A;  3BU9 A;  1BRP A;  2Q9S A;  1CBQ A;  5L8O A;  1AB0 A;  1ICM A;  3FLL A;  3MBT A;  2ASN X;  4ALB A;  5D4A A;  4BOE A;  4YCH A;  1GX8 A;  2JU7 A;  1PBO A;  1X89 A;  1ZNE A;  1KZW A;  1BWY A;  1KT4 A;  1FDQ A;  1OEK A;  4IBA A;  5EED A;  3T1D A;  4AZM A;  3OJY C;  2WR6 A;  1RLB E;  2Q2P A;  1KT3 A;  1X8P A;  5L8N A;  2FTB A;  3C77 X;  4YBP A;  2W2A A;  1KXO A;  3I17 A;  1LIE A;  3ZQ3 A;  2OVA A;  3UEW A;  5LJE A;  3NPO A;  3S26 A;  3EM0 A;  3AKN A;  3ELZ A;  2LFO A;  2QOS C;  4EDE A;  1IIU A;  3UEU A;  4I9S A;  1SXY A;  4NYR A;  3APV A;  4NLI A;  4Y0Q A;  4YFR A;  1TXL A;  4I3D A;  3PED A;  5BVS A;  1LPJ A;  1G74 A;  2NNQ A;  4N7D A;  3DTQ A;  2EU7 X;  4BQU A;  3FA9 A;  1HMT A;  5LJH A;  5HCE C;  1HQP A;  2CZU A;  3P6D A;  4OMW A;  1T8V A;  1NGL A;  2HZR A;  2QO6 A;  2RA6 A;  3WJE A;  3FR2 A;  4OS3 A;  4QAE A;  3VG3 A;  1GT5 A;  4YH0 A;  3D95 A;  1IFB A;  5HZ8 A;  5LJK A;  2NP1 A;  3FW5 A;  4A1H A;  5FEN A;  2OZQ A;  3APW A;  2A0A A;  1SXX A;  1GT3 A;  1KQX A;  3D96 A;  2MM3 A;  4A60 A;  5IO6 A;  3FEP A;  5EDB A;  4AZP A;  2L68 A;  1HN2 A;  1O1V A;  5IO7 A;  4OMX A;  2A13 A;  4ZCB A;  3BRN A;  1OBQ A;  5HBS A;  2G78 A;  3HK1 A;  3PEC A;  4Y0R A;  3F9D A;  2XKL A;  3EMM A;  3TZS A;  2AMM X;  2WQA E;  4GRJ A;  2ANS A;  5H9N A;  3CR6 A;  3FEK A;  4ZJ0 A;  2CM4 A;  1GGL A;  4TNN A;  2K62 A;  5HA1 A;  1KZX A;  4R0B A;  2HYS A;  3BU1 A;  4ZHF A;  4AZN A;  5IO5 A;  1GKA B;  4ORY A;  4MVK A;  1YWA A;  3RSW A;  1TOW A;  3EYC A;  3O22 A;  2KTD A;  1A2D A;  4ODD A;  4ZHC A;  3TGC A;  3PP6 A;  3JSQ A;  3PH5 A;  4LZV A;  3CBS A;  3I0A A;  3B2L A;  1G5W A;  2AKQ A;  4XMG A;  1JZU A;  3P6H A;  1KT5 A;  5LKF A;  1L6M A;  2WUT A;  5HA0 A;  3TF6 A;  1FEN A;  3JS1 A;  1X8U A;  3BDR A;  3O19 A;  4TKH A;  1JV4 A;  4IMN A;  4NNS A;  5HCD C;  5B29 A;  1AQB A;  1MDC A;  2A2G A;  1SY0 A;  1JJX A;  1DZK A;  1FEL A;  2L5P A;  1ZNK A;  4PSQ A;  4ZH9 A;  3WJG A;  4XMD A;  1SY1 A;  2QO4 A;  2NND A;  3HWE A;  4I9R A;  4NYQ A;  4RUN A;  3KFH A;  4O9S A;  2QM9 A;  1LF7 A;  5BVQ A;  3VG6 A;  4Y0P A;  4ZGU A;  1OPA A;  1JYD A;  3NP1 A;  1X8Q A;  2G7B A;  1ACD A;  1YWD A;  1ZND A;  4ZHD A;  3AKM A;  1LNM A;  2GC9 A;  1NP1 A;  1EQD A;  1B0O A;  1DF3 A;  1B8E A;  3FEL A;  1IFC A;  4NLJ A;  4AZR A;  2K23 A;  1N0S A;  2FLJ A;  3P6C A;  3U0D A;  1I4U A;  2NNE A;  1QWD A;  3KZA A;  4ORX A;  2FR2 A;  5LJG A;  4ZHG A;  3IA8 A;  1ZNH A;  2AH7 X;  4M6S A;  1URE A;  1A18 A;  4OS0 A;  2OVE A;  3WJB A;  1EPA A;  4YGH A;  3RZY A;  5D8J A;  1O1U A;  1R0U A;  5HZQ A;  1D2U A;  2FT9 A;  1D3S A;  1FEM A;  2DM5 A;  1LIB A;  2RD7 C;  5B27 A;  4IB7 A;  1DV9 A;  3P6E A;  1B56 A;  3U03 A;  1VYG A;  3UEX A;  2L67 A;  4XME A;  1TW4 A;  5KHP A;  4HPA A;  3NX1 A;  3B2H A;  4GNW A;  1JYJ A;  2LB6 A;  4IB9 A;  4QZU A;  4YGG A;  2AL0 X;  1NP4 A;  3GAQ A;  1ADL A;  2HNX A;  2X46 A;  1CBI A;  4XMF A;  5AQ6 A;  4HPC A;  3ELX A;  1EPB A;  3B2I A;  3KQ0 A;  1YWB A;  1X8O A;  3APU A;  4AZQ A;  3CMP A;  2ACO A;  2AT0 X;  3NAD A;  5F1E A;  1T68 X;  4QGW A;  5EZ2 A;  1QQS A;  3NX2 A;  1TOU A;  2MO5 A;  4EXZ A;  3NR3 A;  3F8A A;  5DPQ A;  3Q6L A;  2IFB A;  2HLV A;  1KQW A;  4I3C A;  4NP1 A;  4TKJ A;  3STN A;  2CBR A;  2WSJ A;  1Z24 A;  3FA7 A;  3IFB A;  4TQ2 A;  3BX8 A;  4CK4 A;  2E4J A;  1U18 A;  1DZM A;  1MUP A;  5HTE A;  1OBP A;  2F73 A;  1ERB A;  3KFG A;  1I05 A;  2G79 A;  1BSO A;  1GT4 A;  3FA6 A;  3STK A;  3WJD A;  2XST A;  5D48 A;  1I06 A;  3HWD A;  4IAX A;  2ALL X;  3D97 A;  3PPT A;  4WFU A;  1DZJ A;  2FRS A;  4YKO A;  4XMC A;  1VPR A;  3BS2 A;  5EEE A;  2LBV A;  1HMS A;  1XKI A;  2HZQ A;  1JJJ A;  2PY1 A;  2AT8 X;  2O62 A;  1ZRY A;  1BM5 A;  4N7C A;  4WFV A;  3FR5 A;  2LBA A;  4I3B A;  2OFM X;  1AEL A;  1SXW A;  3APX A;  4IMO A;  4EFG A;  5F7G A;  3ZUI A;  1CBR A;  4TJZ A;  4ZFX A;  1QFT A;  2W2F A;  1S7D A;  2JN3 A;  5EPQ A;  2FS7 A;  1MX7 A;  4D6B A;  4GE1 A;  4K19 A;  1EII A;  1MX8 A;  2ACP X;  4YDA A;  1BSY A;  1VYF A;  4GKC A;  2JU8 A;  3VG7 A;  2FS6 A;  4AYH A;  4UU3 A;  5LJD A;  5HZ6 A;  1PM1 X;  4A1Y A;  1U0X A;  1PEE A;  1EUO A;  3EBK A;  3C78 X;  5C0N A;  3NQ3 A;  1E00 A;  1CBS A;  5EDC A;  1ALB A;  1X8N A;  5KIC A;  1LID A;  1KOI A;  1EAL A;  2R74 A;  5L8I A;  1OBU A;  3CBC A;  3BX7 A;  3BSZ E;  5HWZ A;  4OS8 A;  1P6P A;  3HWG A;  3QKG A;  1IKJ A;  1E06 A;  1BBP A;  2QO5 A;  3FR4 A;  1ERX A;  2CBS A;  1GKA A;  2GJ5 A;  2JOZ A; 
#chains in the Genus database with same CATH topology
 3PDF A;  1VWR B;  2GTF X;  1SRE A;  2IZE B;  3PQU A;  3LV4 A;  1SY2 A;  5F6Z A;  3U9P C;  4FBV A;  1DFV A;  3P24 A;  4ON1 A;  2KTS A;  4O3Y A;  3TGB A;  4U8U O;  4QQ1 A;  1EI5 A;  1O8V A;  4GDA A;  2A3F X;  1BRQ A;  4GGT A;  4QYN A;  3FDC A;  4UU2 A;  4CDC A;  1A3Y A;  5F58 A;  4BJ8 A;  5CSE A;  2BLG A;  4DCB A;  5HCC C;  3KFI A;  1HY2 A;  1KGL A;  4WHI A;  4YFQ A;  4YGZ A;  4M7M A;  1K24 A;  3N91 A;  4QGX A;  2IZA A;  4IB6 A;  2M4L A;  3EW1 A;  3WJF A;  4NNT A;  4GH7 A;  3C76 X;  2WEX A;  2YMS A;  1UZ2 X;  2CZT A;  4KH8 A;  2WWP A;  4ORS A;  1STP A;  4GET A;  2JMB A;  4HPB A;  2WQ9 A;  1RBP A;  3SLT A;  2Q4N A;  4D6A A;  4Z27 A;  4A8Z A;  4ARH A;  1DC9 A;  4MVI A;  1SWT A;  1SWO A;  4YMY A;  4WBK A;  3S60 A;  2MJI A;  2IZC B;  3OE3 A;  2OFR X;  2OF8 A;  2GH7 A;  5H9K A;  3RDU A;  2X8F A;  1KT7 A;  3BY0 A;  1GM6 A;  4LZU A;  3T6L A;  3CWK A;  1ML7 A;  4BX7 A;  5HAE A;  1JMX A;  1SY3 A;  2JW1 A;  3UEV A;  3T2W A;  3VHM A;  4ES7 A;  4CV7 A;  3RKG A;  4BX6 A;  1N43 A;  1SWJ A;  1BJ7 A;  1VWP B;  3SAO A;  2IZF B;  1Y52 X;  2MF6 A;  3WYP A;  2JU3 A;  3CQR A;  1X71 A;  4YCE A;  2X8S A;  1LEL A;  2FR3 A;  4QGV A;  2A5B A;  4BX5 B;  1OEE A;  4GD9 A;  1SWP A;  2RCT A;  1UYO X;  5LKE A;  4O3X B;  5B3M O;  2KT4 B;  4GK9 A;  2RCQ A;  1KFF A;  5CE4 A;  1T0V A;  4CPE A;  4BVM A;  2RQ0 A;  3VPJ E;  3WBG A;  1SWN A;  1LKE A;  2RTL A;  3KFF A;  3FA8 A;  1E02 A;  5FFH A;  3VG5 A;  1G85 A;  2P8G A;  2N93 A;  1HBP A;  2POA A;  3EBW A;  4YBU A;  4ZR2 A;  1GX9 A;  4TLJ A;  1CRB A;  1QY2 A;  2L9C A;  3AEH A;  3EC5 A;  5D45 A;  3X00 A;  1B4M A;  1KT6 A;  2Y32 A;  2UYW A;  5LJC A;  4LKT A;  3CQN A;  3RDQ A;  3RWX A;  1SXU A;  1I04 A;  2DJF A;  1PMP A;  2QMI A;  1EXS A;  2X4M A;  5IRA A;  2AVI A;  4U3Q A;  3HWF A;  4GGZ A;  2Q39 A;  5F6B A;  5JR8 A;  1W5R A;  4YFP A;  4CPH A;  1CJ5 A;  3VE1 A;  1W6F A;  1SWB A;  4HPD A;  4YDB A;  4CDE A;  3VE2 A;  3DSZ A;  3ZW1 B;  2RTP B;  5BVT A;  1GXA A;  3B2J A;  1GT1 A;  4RUU A;  1JBH A;  4FBR A;  1YP7 A;  1DZP A;  2X55 A;  1LIF A;  3FW4 A;  3WVM A;  1BEB A;  1JJU A;  1MEP A;  2F09 A;  2CAM A;  1SWD A;  2CM9 A;  4Y0S A;  2YG2 A;  1XCA A;  1IW2 A;  4YVB A;  2IZD B;  2WEW A;  3MVF A;  2HMB A;  3BLG A;  1E5P A;  1EW3 A;  1S2P A;  1YP6 A;  4FBO A;  4QNI A;  3SZI A;  1K3B A;  1IKE A;  1VWN B;  2RTN B;  4GNY A;  1G7N A;  2R56 A;  3MM0 A;  4LKP A;  2IZI A;  1OPB A;  4AW8 A;  1SWH A;  3NQ9 A;  5K06 A;  1TVQ A;  4HFO A;  4IRW A;  5H9L A;  2G5L A;  2Q2M A;  2Z4I A;  2AT5 X;  4EEJ A;  4QRL A;  3PH6 A;  3VG2 A;  1HXZ A;  4ML7 B;  2WPU A;  5D47 A;  2IZL B;  1LUQ A;  4NW4 A;  2RTQ B;  2JGS A;  1YIV A;  3K3L A;  1LIC A;  2FWV A;  4ZHH A;  1HMR A;  1EIO A;  2A2U A;  5DG4 A;  1MVG A;  1ZNG A;  1VWO B;  4O4S A;  4QYP A;  3O2Y A;  3VHI A;  4OEL A;  1A57 A;  2OVD A;  4DQ4 A;  1MM9 A;  2IZG B;  3VG4 A;  4MVE A;  3H3I A;  1H91 A;  1RST B;  3SLJ A;  5BVS A;  4DQ3 A;  1ZNL A;  1MOY A;  5FAZ A;  5BYP A;  5KID A;  1VWB B;  1YWC A;  5LJB A;  2JOZ A;  1VWI B;  2OY5 O;  3FMZ A;  4ALO A;  1BSQ A;  4JNJ A;  4MVL A;  2G8C O;  5H8T A;  5IRU A;  1BLR A;  1LCV A;  1QY1 A;  2R73 A;  4IAW A;  5HZ9 A;  1OEJ A;  1SA8 A;  3STM X;  4JGL A;  2AT6 X;  3FIQ A;  4GDZ A;  1QG5 A;  1YUP A;  4XMH A;  4I60 A;  2OY1 O;  4U8U M;  2OL7 A;  2X45 A;  1AVG I;  2OFB A;  2LKK A;  3B2K A;  1MK5 A;  5H9A A;  5HTD A;  2RTD B;  2X34 A;  2AT3 X;  2W2B A;  3P6F A;  1N9Y A;  3E3C A;  1FE3 A;  1LFO A;  4IB8 A;  1FTP A;  4JHQ A;  4ZH6 A;  1SWF A;  3RDM A;  4KII A;  3L4R A;  4BX7 B;  2VDF A;  4YKM A;  3ZUO A;  1HBQ A;  4ORR A;  4TKB A;  3P6G A;  5HZ5 A;  1E2T A;  3FYF A;  3G7X A;  3P02 A;  4CSB A;  1S44 A;  5AJB A;  3WXQ A;  1QFV A;  1U17 A;  4ORW A;  2RTG B;  4AZO A;  1QY0 A;  2FKG A;  3WJC A;  4ORU A;  1QAB E;  4QZT A;  3FEN A;  2VFB A;  1ICN A;  3BU9 A;  1BRP A;  2Q9S A;  1CBQ A;  5L8O A;  1AB0 A;  4ZGF A;  1ICM A;  1LDO A;  3FLL A;  3MBT A;  2ASN X;  4ALB A;  5D4A A;  4BOE A;  4YCH A;  1GX8 A;  1Y53 X;  1PBO A;  1X89 A;  1ZNE A;  2JU7 A;  3TGA A;  2X32 A;  1KZW A;  2ZAG A;  1BWY A;  1KT4 A;  1FDQ A;  1OEK A;  3ZZV A;  4IBA A;  1VWA B;  5EED A;  3T1D A;  4AZM A;  2IZB A;  3OJY C;  2WR6 A;  1RLB E;  2Q2P A;  1KT3 A;  1SWL A;  1X8P A;  2FTB A;  3C77 X;  4YBP A;  5L8N A;  2A5C A;  2W2A A;  1KXO A;  3I17 A;  1LIE A;  1SRG A;  3ZQ3 A;  2OVA A;  3UEW A;  5LJE A;  1NQN A;  1SWQ A;  3EM0 A;  3AKN A;  3NPO A;  3S26 A;  3ELZ A;  2LFO A;  2MWH A;  2QOS C;  4EDE A;  1IIU A;  3UEU A;  4I9S A;  1SXY A;  4NYR A;  3APV A;  4NLI A;  3F6Z B;  4Y0Q A;  3T6F A;  2KD2 A;  2RTC B;  4YFR A;  1TXL A;  2UZ2 A;  4I3D A;  3PED A;  1IJ8 A;  2RTK A;  4U46 A;  1LPJ A;  1G74 A;  2NNQ A;  4N7D A;  4I6S A;  4LQZ A;  3DTQ A;  2EU7 X;  4O3W A;  3FA9 A;  4BQU A;  1SWG A;  1HMT A;  3UAQ A;  5HCE C;  1HQP A;  2CZU A;  3P6D A;  4OMW A;  1T8V A;  1NGL A;  2HZR A;  2QO6 A;  1RSU B;  2RA6 A;  3FR2 A;  3PQS A;  4OS3 A;  4O4U A;  3WJE A;  3LHN A;  1KL5 A;  4QAE A;  4Z6J A;  3VG3 A;  1GT5 A;  1VWH B;  4YH0 A;  3D95 A;  1DF8 A;  1IFB A;  5HZ8 A;  5LJK A;  2NP1 A;  3WYQ A;  3FW5 A;  3WZN A;  4A1H A;  5FEN A;  2OZQ A;  3APW A;  1NC9 A;  3S5X A;  2A0A A;  1SXX A;  5FQ8 E;  1GT3 A;  4CDF A;  2FGS A;  3OD9 A;  2OVS A;  1KQX A;  1SLF B;  3D96 A;  2MM3 A;  4A60 A;  5IO6 A;  1SWK A;  1SRF A;  3FEP A;  4NV7 A;  5EDB A;  4AZP A;  1N9M A;  2L68 A;  2Y3E A;  2GTL N;  1HN2 A;  3HTY A;  1O1V A;  3JQO A;  5IO7 A;  4FQB B;  1N4J A;  4OMX A;  4L3R A;  3RE6 A;  2A13 A;  1SLD B;  2RTH B;  4Y5D A;  4ZCB A;  3BRN A;  2RN4 A;  1OBQ A;  4KCA A;  5HBS A;  2G78 A;  3HK1 A;  3PEC A;  4Y0R A;  1SWU A;  2IZJ A;  3F9D A;  2XKL A;  3EMM A;  2RTO B;  2AMM X;  3TZS A;  2BSZ A;  2WQA E;  4DNE A;  4GRJ A;  2ANS A;  5H9N A;  3CR6 A;  4I95 A;  2FHN X;  1SLE B;  3FEK A;  2CM4 A;  1GGL A;  4TNN A;  2K62 A;  5HA1 A;  4ZJ0 A;  3OBL A;  1UYN X;  2IZK A;  4R0B A;  1KZX A;  2HYS A;  3BU1 A;  3ZW2 A;  4BX5 A;  4MEE A;  3WOV A;  4ZHF A;  4AZN A;  2OYB O;  1VWG B;  5IO5 A;  1GKA B;  3RE5 A;  1NQM A;  2RTM A;  4ORY A;  4MVK A;  3PK2 A;  1YWA A;  3RSW A;  1TOW A;  3EYC A;  1RXJ A;  3RY1 A;  3AUM O;  1HQQ A;  1N7Y A;  3O22 A;  2KTD A;  4GJV A;  1LDQ A;  1A2D A;  2Y3F A;  4ODD A;  4ZHC A;  3HPE A;  2HKD A;  3PP6 A;  5B5F A;  3TGC A;  2VFC A;  3JSQ A;  3PH5 A;  4EQA C;  1SWC A;  1WBI A;  4LZV A;  5F2B A;  3CBS A;  3I0A A;  3B2L A;  1G5W A;  1HXL A;  2AKQ A;  2LA7 A;  5JD2 A;  4XMG A;  1JQP A;  1VWM B;  1JZU A;  3P6H A;  4GGR A;  4GU8 A;  1KT5 A;  4FGI B;  1L6M A;  2WUT A;  3NBX X;  5B5G A;  2X56 A;  5LKF A;  5HA0 A;  4Z2V A;  5L3Y A;  4U8U N;  3TF6 A;  2OY7 A;  1PTS A;  1FEN A;  3JS1 A;  1X8U A;  3BDR A;  3O19 A;  3V8U A;  1STS B;  5IXG A;  2PI3 O;  1Y0G A;  1JV4 A;  4IMN A;  4O4O A;  1KL3 A;  1JIW I;  4NNS A;  4O4X A;  4TKH A;  3VU1 A;  1AQB A;  1WUB A;  5B29 A;  1MDC A;  1VWK B;  5HCD C;  1LCZ A;  1SY0 A;  1VWQ B;  2A2G A;  4GUZ A;  1VWD B;  1NDJ A;  1DZK A;  3ZW1 A;  1JJX A;  1FEL A;  5B11 O;  3SZH A;  5LJH A;  4O3Z A;  2L5P A;  1ZNK A;  4PSQ A;  4ZH9 A;  3RDX A;  3WJG A;  4XMD A;  1SY1 A;  2QO4 A;  2MHD A;  2I5V O;  2NND A;  3HWE A;  4I9R A;  4NYQ A;  4RUN A;  3KFH A;  4O9S A;  2QM9 A;  1LF7 A;  2BC3 A;  5BVQ A;  3VG6 A;  4Y0P A;  4ZGU A;  1OPA A;  2RTI B;  5AEO A;  1JYD A;  3NP1 A;  1X8Q A;  2G7B A;  1ACD A;  2OL6 O;  1PBY A;  4IAB A;  1YWD A;  1NBX A;  1ZND A;  3AKM A;  4ZHD A;  4ID2 A;  1LNM A;  2IZH B;  2GC9 A;  1NP1 A;  1EQD A;  1B0O A;  2KW1 A;  1DF3 A;  1B8E A;  3FEL A;  1IFC A;  4NLJ A;  4O49 A;  4AZR A;  2K23 A;  3HOE A;  1N0S A;  2FLJ A;  3P6C A;  3U0D A;  1I4U A;  5B10 O;  1AVE A;  2NNE A;  4PJ2 A;  1QWD A;  1VWC B;  3KZA A;  4ORX A;  2FR2 A;  5LJG A;  4CPI A;  4ZHG A;  2Z4H A;  3IA8 A;  1ZNH A;  1W4T A;  2C1Q A;  2AH7 X;  4M6S A;  4Z2P A;  4COT A;  1URE A;  1A18 A;  1RXH A;  1VWJ B;  2OVE A;  4OS0 A;  3WJB A;  4CDD A;  1EPA A;  2ZSC A;  4YGH A;  3RZY A;  5D8J A;  1O1U A;  1R0U A;  5HZQ A;  1D2U A;  1VYO A;  3VHH A;  2FT9 A;  1D3S A;  1FJ1 E;  1SWR A;  1FEM A;  2DM5 A;  1LIB A;  2RD7 C;  4INN A;  4JO6 A;  5B27 A;  3WZQ A;  4CPH B;  4IB7 A;  1DV9 A;  4KC7 A;  1VWL B;  1Y9L A;  3P6E A;  1B56 A;  3U03 A;  1VYG A;  3UEX A;  2L67 A;  4XME A;  4BGF A;  1TW4 A;  2OF9 A;  4HPA A;  3MX7 A;  3NX1 A;  5KHP A;  3B2H A;  4GNW A;  1JYJ A;  2LB6 A;  4IB9 A;  4QZU A;  4YGG A;  2F01 A;  2AL0 X;  1NP4 A;  3GAQ A;  3WZP A;  1ADL A;  3ZWE A;  3MG5 A;  4OKA A;  2HNX A;  5CHK A;  4BBO A;  2X46 A;  1SMP I;  4KT5 A;  4C5P A;  1CBI A;  4XMF A;  3S5V A;  5AQ6 A;  4HPC A;  4BX6 B;  3ZI8 A;  2BS6 A;  2C4I A;  3ELX A;  3RDO A;  2DJG A;  1EPB A;  3B2I A;  3KQ0 A;  1YWB A;  1X8O A;  1JMZ A;  4MIS A;  4U9C A;  3APU A;  1SWS A;  4AZQ A;  1SRH A;  2OY8 A;  3LTW A;  3CMP A;  4MIR A;  2ACO A;  2AT0 X;  3NAD A;  4Y59 A;  1T68 X;  5AJC A;  4QGW A;  5F1E A;  5EZ2 A;  1QQS A;  3NX2 A;  1TOU A;  2MO5 A;  5FQ6 E;  4EXZ A;  3NR3 A;  3F8A A;  5DPQ A;  3Q6L A;  2IFB A;  2HLV A;  1KQW A;  3KVN A;  4I3C A;  1KL4 A;  4NP1 A;  4TKJ A;  4Z28 A;  1SRJ A;  3SOT A;  3STN A;  2OFA A;  3FID A;  2CBR A;  2WSJ A;  2X8T A;  1Z24 A;  3FA7 A;  3IFB A;  1VWF B;  4TQ2 A;  3BX8 A;  3RDS A;  4CK4 A;  2E4J A;  1U18 A;  4Z2O A;  2FHL A;  1DZM A;  1MUP A;  5HTE A;  1OBP A;  1SWA A;  2F73 A;  5K67 A;  1ERB A;  3KFG A;  1I05 A;  2G79 A;  4EKV A;  1BSO A;  1GT4 A;  2BHV A;  3FA6 A;  3STK A;  3WJD A;  1OSP O;  2XST A;  4GZV A;  5D48 A;  1I06 A;  3HWD A;  4IAX A;  2ALL X;  3D97 A;  1Y9T A;  3PPT A;  4WFU A;  1DZJ A;  2FRS A;  1RAV A;  4YKO A;  4XMC A;  1VPR A;  3BS2 A;  4GJS A;  5EEE A;  1AVD A;  2LBV A;  1HMS A;  1XKI A;  2HZQ A;  3CKF A;  1JJJ A;  2RTR B;  2AT8 X;  2O62 A;  2PY1 A;  1ZRY A;  1BM5 A;  4N7C A;  1GX3 A;  4WFV A;  3FR5 A;  2LBA A;  4I3B A;  1SWE A;  1LCW A;  2OFM X;  2GTL M;  1AEL A;  1SXW A;  1VWE B;  3NQK A;  3APX A;  4IMO A;  4EFG A;  2FKJ A;  2RTA A;  5F7G A;  3ZUI A;  1CBR A;  4TJZ A;  4ZFX A;  2RTE B;  1QFT A;  2W2F A;  1S7D A;  2JN3 A;  3ZW0 A;  2I5Z O;  1STR B;  5EPQ A;  3SZJ A;  2FS7 A;  1MX7 A;  2A8G A;  2GTL O;  3EW2 A;  4D6B A;  4GE1 A;  4KC8 A;  4K19 A;  1EII A;  1MX8 A;  2ACP X;  5K68 A;  2QCB A;  4YDA A;  1BSY A;  1VYF A;  4GKC A;  2JU8 A;  4OEM A;  2FS6 A;  4HWM A;  4UU3 A;  3VG7 A;  4AYH A;  5LJD A;  3SLO A;  1SRI A;  3QQ2 A;  5HZ6 A;  3VGW A;  1PM1 X;  4A1Y A;  1I9H A;  1U0X A;  1PEE A;  1EUO A;  4L1N A;  2RTF B;  3EBK A;  3C78 X;  5C0N A;  5IRW A;  2ZAI A;  3RBY A;  3NQ3 A;  1E00 A;  1CBS A;  5B2A O;  5CYB A;  5EDC A;  5FQ7 E;  1ALB A;  1X8N A;  3T2X A;  1LID A;  3WZO A;  1KOI A;  4CPF A;  5KIC A;  2BT9 A;  1EAL A;  1SLG B;  2R74 A;  3Q34 A;  4NV8 A;  5L8I A;  1OBU A;  3GE2 A;  3ZW0 B;  3CBC A;  3D9W A;  3BX7 A;  1Y55 X;  3BSZ E;  5HWZ A;  4OS8 A;  1P6P A;  2C1S A;  2RTB B;  3HWG A;  3RY2 A;  3QKG A;  1RXK A;  1IKJ A;  2BS5 A;  2QOM A;  1E06 A;  1BBP A;  2OL8 O;  2QO5 A;  2RTJ A;  3FR4 A;  3HOL A;  1ERX A;  3CKG A;  2CBS A;  1I78 A;  1GKA A;  4B55 A;  2GJ5 A;  4BCS A;  3D4R A;  2AF5 A; 
#chains in the Genus database with same CATH homology
 2GTF X;  3PQU A;  3LV4 A;  1SY2 A;  5F6Z A;  3U9P C;  4FBV A;  1DFV A;  3P24 A;  4ON1 A;  2KTS A;  4O3Y A;  3TGB A;  4U8U O;  4QQ1 A;  1EI5 A;  1O8V A;  4QYN A;  2A3F X;  1BRQ A;  4UU2 A;  1A3Y A;  5F58 A;  5HCC C;  1KGL A;  2BLG A;  3KFI A;  4WHI A;  4YFQ A;  4YGZ A;  4M7M A;  3N91 A;  4QGX A;  4IB6 A;  2M4L A;  3WJF A;  4NNT A;  4GH7 A;  3C76 X;  2WEX A;  2YMS A;  1UZ2 X;  2CZT A;  4KH8 A;  2WWP A;  4ORS A;  4GET A;  2JMB A;  4HPB A;  2WQ9 A;  1RBP A;  2Q4N A;  4A8Z A;  4ARH A;  1DC9 A;  4MVI A;  4YMY A;  4WBK A;  3S60 A;  2MJI A;  3OE3 A;  2OFR X;  5H9K A;  2X8F A;  1KT7 A;  3BY0 A;  1GM6 A;  4LZU A;  3CWK A;  1ML7 A;  5HAE A;  4ES7 A;  1SY3 A;  2JW1 A;  3UEV A;  4CV7 A;  3RKG A;  3SAO A;  1BJ7 A;  2JU3 A;  3CQR A;  1X71 A;  4YCE A;  2X8S A;  2FR3 A;  4QGV A;  1OEE A;  2RCT A;  5LKE A;  4O3X B;  2KT4 B;  4GK9 A;  2RCQ A;  5CE4 A;  1T0V A;  4BVM A;  2RQ0 A;  3VPJ E;  3WBG A;  1LKE A;  3KFF A;  3FA8 A;  1E02 A;  5FFH A;  3VG5 A;  1G85 A;  2P8G A;  2N93 A;  1HBP A;  2POA A;  3EBW A;  4YBU A;  4ZR2 A;  1GX9 A;  4TLJ A;  1CRB A;  1QY2 A;  2L9C A;  5D45 A;  1B4M A;  1KT6 A;  5LJC A;  4LKT A;  3CQN A;  3RWX A;  1SXU A;  1I04 A;  1PMP A;  2QMI A;  1EXS A;  4U3Q A;  3HWF A;  5F6B A;  2Q39 A;  5JR8 A;  4YFP A;  1CJ5 A;  3VE1 A;  4HPD A;  4YDB A;  3VE2 A;  3DSZ A;  3ZW1 B;  5BVT A;  1GXA A;  3B2J A;  1GT1 A;  4RUU A;  1JBH A;  4FBR A;  1YP7 A;  1DZP A;  3WVM A;  1LIF A;  3FW4 A;  1BEB A;  2F09 A;  2CM9 A;  4Y0S A;  2YG2 A;  1XCA A;  1IW2 A;  2WEW A;  3MVF A;  4D6A A;  2HMB A;  3BLG A;  1E5P A;  1EW3 A;  1S2P A;  1YP6 A;  4FBO A;  4QNI A;  3TGA A;  1IKE A;  4GNY A;  4AW8 A;  1G7N A;  2R56 A;  4LKP A;  1OPB A;  3NQ9 A;  5K06 A;  1TVQ A;  4HFO A;  5H9L A;  2Q2M A;  2Z4I A;  2AT5 X;  4EEJ A;  4QRL A;  3PH6 A;  3VG2 A;  4ML7 B;  5D47 A;  4NW4 A;  1YIV A;  3K3L A;  1LIC A;  2FWV A;  4ZHH A;  1HMR A;  1EIO A;  2A2U A;  5DG4 A;  1MVG A;  1ZNG A;  4O4S A;  4QYP A;  3O2Y A;  1A57 A;  2OVD A;  4DQ4 A;  4DQ3 A;  3VG4 A;  4MVE A;  3H3I A;  1H91 A;  1ZNL A;  5FAZ A;  5BYP A;  5KID A;  1YWC A;  5LJB A;  3FMZ A;  4ALO A;  1BSQ A;  4MVL A;  5H8T A;  1BLR A;  1QY1 A;  2R73 A;  4IAW A;  5HZ9 A;  1OEJ A;  1SA8 A;  3STM X;  4JGL A;  2AT6 X;  3FIQ A;  4GDZ A;  1QG5 A;  1YUP A;  4XMH A;  4U8U M;  2X45 A;  1AVG I;  2LKK A;  3B2K A;  5H9A A;  5HTD A;  2AT3 X;  2W2B A;  3P6F A;  3E3C A;  4IB8 A;  1FE3 A;  1LFO A;  1FTP A;  4ZH6 A;  4KII A;  3L4R A;  4YKM A;  3ZUO A;  1HBQ A;  4ORR A;  4TKB A;  3P6G A;  5HZ5 A;  3FYF A;  3G7X A;  3P02 A;  4CSB A;  1S44 A;  5AJB A;  3WXQ A;  1QFV A;  1U17 A;  4ORW A;  4AZO A;  1QY0 A;  3WJC A;  4ORU A;  1QAB E;  4QZT A;  3FEN A;  1ICN A;  3BU9 A;  1BRP A;  2Q9S A;  1CBQ A;  5L8O A;  1AB0 A;  4ZGF A;  1ICM A;  3FLL A;  3MBT A;  2ASN X;  4ALB A;  5D4A A;  4BOE A;  4YCH A;  1GX8 A;  2JU7 A;  1PBO A;  1X89 A;  1ZNE A;  1KZW A;  2ZAG A;  1BWY A;  1KT4 A;  1FDQ A;  1OEK A;  3ZZV A;  4IBA A;  5EED A;  3T1D A;  4AZM A;  3OJY C;  2WR6 A;  1RLB E;  2Q2P A;  1KT3 A;  1X8P A;  5L8N A;  2FTB A;  3C77 X;  4YBP A;  2W2A A;  1KXO A;  3I17 A;  1LIE A;  3ZQ3 A;  2OVA A;  3UEW A;  5LJE A;  3NPO A;  3S26 A;  3EM0 A;  3AKN A;  3ELZ A;  2LFO A;  2MWH A;  2QOS C;  4EDE A;  1IIU A;  3UEU A;  4I9S A;  1SXY A;  4NYR A;  3APV A;  4NLI A;  3F6Z B;  4Y0Q A;  2KD2 A;  4YFR A;  1TXL A;  4I3D A;  3PED A;  5BVS A;  1LPJ A;  1G74 A;  2NNQ A;  4N7D A;  4I6S A;  4LQZ A;  3DTQ A;  2EU7 X;  4O3W A;  3FA9 A;  4BQU A;  1HMT A;  3UAQ A;  5HCE C;  1HQP A;  2CZU A;  3P6D A;  4OMW A;  1T8V A;  1NGL A;  2HZR A;  2QO6 A;  2RA6 A;  3PQS A;  3FR2 A;  4OS3 A;  3WJE A;  4O4U A;  3LHN A;  4QAE A;  3VG3 A;  1GT5 A;  4YH0 A;  3D95 A;  1IFB A;  5HZ8 A;  5LJK A;  2NP1 A;  3FW5 A;  4A1H A;  5FEN A;  2OZQ A;  3APW A;  3S5X A;  2A0A A;  1SXX A;  5FQ8 E;  1GT3 A;  3OD9 A;  2OVS A;  1KQX A;  3D96 A;  2MM3 A;  4A60 A;  5IO6 A;  3FEP A;  5EDB A;  4AZP A;  2L68 A;  2GTL N;  1HN2 A;  3HTY A;  1O1V A;  3JQO A;  5IO7 A;  4FQB B;  4OMX A;  4L3R A;  2A13 A;  4ZCB A;  3BRN A;  2RN4 A;  1OBQ A;  4KCA A;  5HBS A;  2G78 A;  3HK1 A;  3PEC A;  4Y0R A;  3F9D A;  2XKL A;  3EMM A;  3TZS A;  2AMM X;  2WQA E;  4GRJ A;  2ANS A;  5H9N A;  3CR6 A;  4I95 A;  3FEK A;  4ZJ0 A;  2CM4 A;  1GGL A;  4TNN A;  2K62 A;  5HA1 A;  3OBL A;  1KZX A;  4R0B A;  2HYS A;  3BU1 A;  3ZW2 A;  3WOV A;  4ZHF A;  4AZN A;  5IO5 A;  1GKA B;  4ORY A;  4MVK A;  1YWA A;  3RSW A;  1TOW A;  3EYC A;  3O22 A;  2KTD A;  1A2D A;  4ODD A;  4ZHC A;  3TGC A;  3PP6 A;  3JSQ A;  3PH5 A;  4EQA C;  4LZV A;  3CBS A;  3I0A A;  3B2L A;  1G5W A;  2AKQ A;  2LA7 A;  4XMG A;  1JZU A;  3P6H A;  4GU8 A;  1KT5 A;  4FGI B;  1L6M A;  2WUT A;  3NBX X;  5LKF A;  5HA0 A;  4U8U N;  3TF6 A;  1FEN A;  3JS1 A;  1X8U A;  3BDR A;  3O19 A;  3V8U A;  4TKH A;  1JV4 A;  4IMN A;  4O4O A;  4NNS A;  1JIW I;  4O4X A;  3VU1 A;  5HCD C;  5B29 A;  1AQB A;  1MDC A;  2A2G A;  1SY0 A;  1JJX A;  1DZK A;  3ZW1 A;  1FEL A;  5LJH A;  4O3Z A;  2L5P A;  1ZNK A;  4PSQ A;  4ZH9 A;  3WJG A;  4XMD A;  1SY1 A;  2QO4 A;  2MHD A;  2NND A;  3HWE A;  4I9R A;  4NYQ A;  4RUN A;  3KFH A;  4O9S A;  2QM9 A;  1LF7 A;  5BVQ A;  3VG6 A;  4Y0P A;  4ZGU A;  1OPA A;  5AEO A;  1JYD A;  3NP1 A;  1X8Q A;  2G7B A;  1ACD A;  4IAB A;  1YWD A;  1ZND A;  4ZHD A;  3AKM A;  4ID2 A;  1LNM A;  2GC9 A;  1NP1 A;  1EQD A;  1B0O A;  2KW1 A;  1DF3 A;  1B8E A;  3FEL A;  1IFC A;  4NLJ A;  4O49 A;  4AZR A;  2K23 A;  3HOE A;  1N0S A;  2FLJ A;  3P6C A;  3U0D A;  1I4U A;  2NNE A;  4PJ2 A;  1QWD A;  3KZA A;  4ORX A;  2FR2 A;  5LJG A;  4ZHG A;  2Z4H A;  3IA8 A;  1ZNH A;  2AH7 X;  4M6S A;  4COT A;  1URE A;  1A18 A;  4OS0 A;  2OVE A;  3WJB A;  1EPA A;  4YGH A;  3RZY A;  5D8J A;  1O1U A;  1R0U A;  5HZQ A;  1D2U A;  2FT9 A;  1D3S A;  4INN A;  3ZW0 A;  1FEM A;  2DM5 A;  1LIB A;  2RD7 C;  5B27 A;  4IB7 A;  1DV9 A;  4KC7 A;  1Y9L A;  3P6E A;  1B56 A;  3U03 A;  1VYG A;  3UEX A;  2L67 A;  4XME A;  1TW4 A;  5KHP A;  4HPA A;  3MX7 A;  3NX1 A;  3B2H A;  4GNW A;  1JYJ A;  2LB6 A;  4IB9 A;  4QZU A;  4YGG A;  2AL0 X;  1NP4 A;  3GAQ A;  1ADL A;  3ZWE A;  2HNX A;  2X46 A;  1SMP I;  4KT5 A;  1CBI A;  4XMF A;  3S5V A;  5AQ6 A;  4HPC A;  3ZI8 A;  2BS6 A;  3ELX A;  1EPB A;  3B2I A;  3KQ0 A;  1YWB A;  1X8O A;  4MIS A;  4U9C A;  3APU A;  4AZQ A;  3CMP A;  4MIR A;  2ACO A;  2AT0 X;  3NAD A;  5F1E A;  1T68 X;  5AJC A;  4QGW A;  5FQ6 E;  5EZ2 A;  1QQS A;  3NX2 A;  1TOU A;  2MO5 A;  4EXZ A;  3NR3 A;  3F8A A;  5DPQ A;  3Q6L A;  2IFB A;  2HLV A;  1KQW A;  4I3C A;  4NP1 A;  4TKJ A;  3SOT A;  3STN A;  2CBR A;  2WSJ A;  2X8T A;  1Z24 A;  3FA7 A;  3IFB A;  4TQ2 A;  3BX8 A;  4CK4 A;  2E4J A;  1U18 A;  1DZM A;  1MUP A;  5HTE A;  1OBP A;  2F73 A;  1ERB A;  3KFG A;  1I05 A;  2G79 A;  1BSO A;  1GT4 A;  2BHV A;  3FA6 A;  3STK A;  3WJD A;  2XST A;  4GZV A;  5D48 A;  1I06 A;  3HWD A;  4IAX A;  2ALL X;  3D97 A;  1Y9T A;  3PPT A;  4WFU A;  1DZJ A;  2FRS A;  4YKO A;  4XMC A;  1VPR A;  3BS2 A;  5EEE A;  2LBV A;  1HMS A;  1XKI A;  2HZQ A;  1JJJ A;  2PY1 A;  2AT8 X;  2O62 A;  1ZRY A;  1BM5 A;  4N7C A;  4WFV A;  3FR5 A;  2LBA A;  4I3B A;  2OFM X;  2GTL M;  1AEL A;  1SXW A;  3NQK A;  3APX A;  4IMO A;  4EFG A;  5F7G A;  3ZUI A;  1CBR A;  4TJZ A;  4ZFX A;  1QFT A;  2W2F A;  1S7D A;  2JN3 A;  5EPQ A;  2FS7 A;  1MX7 A;  2GTL O;  4D6B A;  4GE1 A;  4KC8 A;  4K19 A;  1EII A;  1MX8 A;  2ACP X;  4YDA A;  1BSY A;  1VYF A;  4GKC A;  2JU8 A;  3VG7 A;  2FS6 A;  4HWM A;  4UU3 A;  4AYH A;  5LJD A;  5HZ6 A;  1PM1 X;  4A1Y A;  1U0X A;  1PEE A;  1EUO A;  4L1N A;  3EBK A;  3C78 X;  5C0N A;  2ZAI A;  3RBY A;  3NQ3 A;  1E00 A;  1CBS A;  5CYB A;  5EDC A;  5FQ7 E;  1ALB A;  1X8N A;  5KIC A;  1LID A;  1KOI A;  2BT9 A;  1EAL A;  2R74 A;  5L8I A;  1OBU A;  3GE2 A;  3ZW0 B;  3CBC A;  3BX7 A;  3BSZ E;  5HWZ A;  4OS8 A;  1P6P A;  3HWG A;  3QKG A;  1IKJ A;  2BS5 A;  3HOL A;  1E06 A;  1BBP A;  2QO5 A;  3FR4 A;  1ERX A;  2CBS A;  1GKA A;  2GJ5 A;  3D4R A;  2JOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...