3WVMA

The 0.88 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with stearic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
b'MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, heart
publication title Water-Mediated Recognition of Simple Alkyl Chains by Heart-Type Fatty-Acid-Binding Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 31
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3wvmA00
4A1HA 1RLBE 4LKTA 4OS8A 2JU7A 3DTQA 1OPAA 1I4UA 3EBWA 4XMHA 1A18A 4PSQA 2RA6A 3U03A 1BM5A 4I3CA 3TZSA 2FWVA 2Q9SA 2E4JA 4Y0RA 3TF6A 4IB8A 2AKQA 2L5PA 3ZUOA 3CQNA 3FEPA 4LZVA 3VG2A 4D6AA 2O62A 3KFIA 4YFPA 1ZNGA 1ZNHA 2HYSA 5KICA 1KGLA 2DM5A 1HQPA 1QY1A 2A2UA 4AZOA 1X8PA 1IW2A 1G7NA 2WUTA 1U17A 3APUA 2MO5A 4CK4A 3FMZA 4GNWA 3ELZA 4GRJA 2R73A 2LB6A 3WJFA 1JJXA 1CBSA 1YIVA 3WBGA 2W2BA 5DPQA 1YWBA 4A60A 1BWYA 5LJKA 2L9CA 1GKAB 1BBPA 4NLIA 1SXWA 2PY1A 1ACDA 1KT3A 2R74A 5BVTA 4MVLA 1B4MA 1VYFA 2RCQA 4ORXA 4ES7A 2AT6X 3I17A 5LJGA 3NADA 3K3LA 4UU3A 4HPAA 1TW4A 1GGLA 3VG5A 4YGGA 3FIQA 1X8NA 2G78A 3NP1A 1MDCA 3C76X 5B27A 5AQ6A 2W2FA 3O22A 3NR3A 2POAA 1KT5A 4ODDA 3TGAA 1E06A 3B2HA 1HMSA 1HMTA 1HN2A 1ICMA 5BVSA 5LKFA 2FLJA 4KIIA 1GT1A 3EM0A 4AZNA 3IA8A 4Y0PA 3WJCA 1TVQA 5EDCA 1DV9A 1IKJA 2QOSC 3FR5A 5CE4A 4QZTA 1GXAA 1AELA 4YGHA 4A1YA 2AT8X 1UZ2X 4QGXA 2FTBA 3D96A 2AT0X 1TOUA 2KTDA 4UU2A 1ZNKA 4ZJ0A 3FA8A 4GH7A 3CR6A 4HFOA 4OMXA 1L6MA 5HTDA 2QO5A 3C77X 2HZQA 3KFHA 4WBKA 3FA6A 4ZGUA 1OPBA 3NPOA 3UEWA 3HK1A 3UEXA 1ZNLA 4IMNA 2ACOA 1QG5A 2NNQA 1PBOA 3EYCA 3PEDA 4QAEA 1QY0A 3UEUA 3P6GA 4ZHDA 1I05A 3UEVA 5HCEC 5D47A 2QO4A 5C0NA 3B2JA 4R0BA 4XMEA 2ANSA 3RSWA 1JBHA 1XKIA 4YMYA 3APWA 4NNTA 3NQ9A 2OVEA 1LIFA 1OBUA 4TJZA 4AZRA 2ASNX 1SY0A 1P6PA 2AL0X 1KXOA 5F1EA 5L8OA 2K62A 4D6BA 1OBQA 3ZQ3A 1FTPA 1BEBA 4YDBA 3BY0A 5LJDA 1ZRYA 4QGWA 3P6FA 4GKCA 2JN3A 1QFTA 1JV4A 3B2LA 1BSYA 5HA1A 3BRNA 3FR4A 2WEWA 1T0VA 3HWGA 1KZXA 2JU8A 4HPDA 4ZCBA 3VG3A 4ZH6A 1ADLA 3PECA 3CMPA 1XCAA 1EPBA 2WR6A 4IB6A 5LJHA 3FLLA 5EEDA 4I3BA 1LFOA 4N7CA 5HZ6A 1TOWA 1CBIA 4YBPA 2CBSA 1LKEA 3G7XA 2P8GA 4O9SA 4Y0SA 1SXYA 2A0AA 1BSOA 1OEEA 2YG2A 4EEJA 2JOZA 1HBQA 3FR2A 5HZ8A 1R0UA 2HMBA 4ZR2A 4YDAA 1U18A 3P6HA 1YP7A 1KQXA 4DQ4A 1AVGI 1SA8A 3NX2A 1X8UA 3FELA 1EXSA 4I3DA 1NGLA 4HPCA 2N93A 4NLJA 4NYRA 1EPAA 2FS6A 2NP1A 3PH6A 4I9RA 5IO7A 3B2IA 1SY1A 1EIIA 3MVFA 3P6EA 5IO6A 2JU3A 2FR2A 1H91A 1ERBA 2CBRA 1LIEA 1D3SA 1HBPA 2RCTA 2X45A 4K19A 4QGVA 3I0AA 1PMPA 2XSTA 4ZH9A 1FELA 1DZMA 1OEJA 4LKPA 4TKBA 1KT7A 1LPJA 4IAWA 3WVMA 3S26A 2FT9A 4YFRA 2QM9A 3F8AA 2A13A 3T1DA 3NX1A 4AZQA 3NQ3A 4AYHA 4IAXA 1MX8A 2Q39A 5LJCA 4ORSA 4ALOA 4ORUA 5L8NA 5D4AA 2OFRX 1ZNDA 4AZMA 1OEKA 1IFBA 3JS1A 1G5WA 3FA7A 4YCHA 1IFCA 1BSQA 2AT5X 3QKGA 1X8QA 1VPRA 1A57A 5EZ2A 3ZUIA 3C78X 4QYPA 4ORWA 1SXXA 5EDBA 1KZWA 4MVIA 4Y0QA 4EFGA 2IFBA 3P6DA 1AB0A 1SXUA 2G79A 3APXA 2GJ5A 4EXZA 1KOIA 3D97A 5F7GA 2OVDA 3FEKA 3PP6A 4ORYA 2AMMX 2CZTA 3AKMA 2G7BA 1A3YA 1KT6A 5HCCC 1DFVA 1GT4A 2Q2MA 1QABE 3VG4A 4OS3A 2MJIA 5HCDC 2OZQA 1ALBA 1I04A 3ELXA 4ZHHA 3B2KA 1YP6A 1T8VA 3PH5A 5D45A 2GC9A 5HTEA 1GM6A 1EW3A 1KQWA 2GTFX 1RBPA 5F6BA 5KHPA 2W2AA 1D2UA 1X71A 3U9PC 3BSZE 5FFHA 2RD7C 5LJBA 2MM3A 2QO6A 5EPQA 5HZ9A 1O1VA 3WJBA 2Q2PA 4QZUA 5D48A 2LBAA 1E00A 5IO5A 3TGCA 1TXLA 4IBAA 3HWDA 3PPTA 3WJGA 1LF7A 3D95A 2WSJA 1G85A 1MX7A 5H8TA 4XMFA 1IIUA 3WJDA 2CM9A 2CZUA 3FW5A 5F6ZA 1LIDA 2L68A 1PM1X 2L67A 3STKA 4AZPA 1ERXA 4GETA 3CBCA 5EEEA 1NP1A 4ZFXA 1QWDA 1I06A 1B8EA 1YWAA 4LZUA 1EIOA 5F58A 1JYDA 3AKNA 1BRQA 4ZHGA 1SY2A 4RUNA 5H9LA 1JJJA 3CWKA 1CJ5A 1Z24A 4WFUA 4YGZA 2F73A 2NNEA 1DZPA 4TNNA 1BLRA 1U0XA 4NNSA 1O1UA 4AW8A 2WQ9A 3KQ0A 5K06A 3BU9A 2EU7X 1OBPA 3BLGA 5DG4A 1GX9A 4XMDA 2RQ0A 1E5PA 3WJEA 1BRPA 1ML7A 1FE3A 1DZKA 1LNMA 1YWCA 3IFBA 5L8IA 1SY3A 3FW4A 3EBKA 2NNDA 1CRBA 3BX7A 2WQAE 1QQSA 1S7DA 3KZAA 5H9AA 2AT3X 2A3FX 5B29A 1ICNA 2WWPA 1X8OA 2KT4B 4EDEA 2R56A 3SAOA 2FRSA 5HZQA 5JR8A 3CBSA 2A2GA 1DZJA 3BS2A 2FS7A 4A8ZA 4BQUA 5HAEA 2XKLA 1S2PA 4HPBA 5HBSA 5KIDA 5H9NA 4YKOA 1AQBA 1FDQA 4IB7A 4TLJA 5LKEA 2X46A 2LKKA 1S44A 3JSQA 4WFVA 4OMWA 4TQ2A 1B56A 4ARHA 1EUOA 1GT5A 1FENA 1O8VA 4TKJA 4YFQA 1GT3A 2CM4A 3O19A 3F9DA 1KT4A 1DC9A 1UREA 3CQRA 3O2YA 2HLVA 2FR3A 4XMGA 4YBUA 1MUPA 3L4RA 4QYNA 3KFFA 4N7DA 1E02A 4ORRA 2LFOA 2ACPX 2HNXA 1YUPA 2OVAA 4ALBA 3Q6LA 4ZHFA 1BJ7A 1YWDA 2K23A 3BU1A 1JYJA 3DSZA 5HWZA 1DF3A 4I9SA 4YKMA 1T68X 5FENA 1CBRA 1QY2A 5LJEA 4ZHCA 1FEMA 1MVGA 1B0OA 3FENA 4XMCA 4YH0A 1GX8A 1G74A 3P6CA 1X89A 4BOEA 1LIBA 2OFMX 5HA0A 2AH7X 1N0SA 1JZUA 3EMMA 3WXQA 2ALLX 4YCEA 4GE1A 1QFVA 5BVQA 1HMRA 1GKAA 1LICA 5FAZA 5HZ5A 2LBVA 2BLGA 4IMOA 4NP1A 5H9KA 1PEEA 3MBTA 3OJYC 3APVA 4MVKA 4OS0A 3BDRA 4M6SA 1IKEA 2Q4NA 4GNYA 4DQ3A 3TGBA 3STMX 3BX8A 3KFGA 1ZNEA 3GAQA 3HWEA 1CBQA 2HZRA 1NP4A 3FA9A 3U0DA 3VG6A 5D8JA 4NYQA 4TKHA 4RUUA 2WEXA 3HWFA 4M7MA 3RZYA 1EALA 3STNA 1EQDA 4IB9A 3VG7A 4BVMA 1VYGA 1A2DA
chains in the Genus database with same CATH superfamily
4GDAA 4A1HA 1RLBE 4LKTA 4OS8A 2JU7A 3DTQA 3SLOA 1OPAA 4CDEA 1I4UA 3EBWA 4XMHA 1A18A 1KFFA 4PSQA 2RA6A 2I5VO 3U03A 2HKDA 3VHHA 1JJUA 1BM5A 4I3CA 3TZSA 2FWVA 2Q9SA 2E4JA 4Y0RA 1JMZA 3TF6A 4IB8A 2AKQA 2Y3EA 2C4IA 3RDXA 3QQ2A 1Y0GA 2L5PA 3VPJE 3ZUOA 3CQNA 4CPHA 3FEPA 4LZVA 3VG2A 1RXJA 4D6AA 1HXZA 2O62A 3KFIA 3RY1A 3ZW0A 2M4LA 2GTLN 2MWHA 1ZNGA 1ZNHA 4YFPA 2HYSA 5KICA 5B5GA 3RDSA 2DM5A 2MF6A 3RBYA 1HQPA 1KGLA 1QY1A 2A2UA 2RTBB 1X8PA 1IW2A 1G7NA 2WUTA 1U17A 3APUA 2MO5A 4AZOA 2RTGB 3V8UA 1FJ1E 3FMZA 4O3WA 4GNWA 3RY2A 4CK4A 3ELZA 4GRJA 2R73A 2LB6A 2RTNB 2FGSA 1CBSA 3KVNA 1YIVA 4U8UN 3WJFA 1JJXA 3WBGA 1VWRB 2W2BA 1SWPA 5DPQA 2X8TA 4BX5B 1YWBA 2Z4IA 4A60A 5LJKA 1BWYA 2L9CA 3E3CA 1GKAB 1BBPA 4NLIA 1SXWA 2PY1A 1ACDA 1KT3A 2R74A 5BVTA 4MVLA 1B4MA 1VYFA 2RCQA 4JGLA 4ORXA 3UAQA 2G5LA 3ZW1B 4ES7A 2AT6X 5L3YA 1WUBA 3I17A 5LJGA 3OBLA 5BYPA 3NADA 5FQ7E 3K3LA 4UU3A 4HPAA 1TW4A 1STRB 4OEMA 1UYNX 1GGLA 3VG5A 4YGGA 1Y55X 3FIQA 1W6FA 1X8NA 2G78A 1K24A 2Y3FA 1MDCA 3NP1A 3C76X 1RXHA 5AQ6A 2W2FA 2X8FA 5B27A 3WZNA 1SWGA 3O22A 3NR3A 2RTDB 2POAA 1KT5A 4ODDA 4I6SA 1E06A 3B2HA 3TGAA 1HMSA 1HMTA 1HN2A 1VWGB 1ICMA 3P24A 5BVSA 4WHIA 5LKFA 2FLJA 4KIIA 1GT1A 3EM0A 4AZNA 1VWFB 2FHLA 2A5BA 3IA8A 4Z28A 4Y0PA 3WJCA 1TVQA 4NV7A 5EDCA 3S5VA 1DV9A 1IKJA 1SMPI 2QOSC 2BHVA 3FR5A 3SOTA 1Y53X 1VWMB 5CE4A 4QZTA 1GXAA 1LELA 1AELA 4YGHA 4A1YA 4MIRA 1VYOA 2AT8X 5K68A 1UZ2X 2IZIA 2FTBA 3D96A 4QGXA 2AT0X 1TOUA 2KTDA 4CPHB 4UU2A 1ZNKA 4ZJ0A 3FA8A 4GH7A 3CR6A 3VE2A 3ZW0B 4HFOA 4OMXA 3H3IA 1L6MA 4L3RA 4IRWA 5HTDA 4BX7A 2RTJA 5IXGA 4GGRA 4LQZA 3LTWA 2QO5A 3C77X 4GUZA 2IZGB 2HZQA 3KFHA 4WBKA 3FA6A 3MX7A 4ZGUA 1OPBA 2RTLA 3NPOA 1MOYA 3UEWA 3HK1A 3UEXA 1ZNLA 2BS6A 4IMNA 2ACOA 1QG5A 2NNQA 1PBOA 5AJCA 3EYCA 1VWIB 3PEDA 1QY0A 4QAEA 3UEUA 3P6GA 2G8CO 2LA7A 1I05A 4ZHDA 4DNEA 3UEVA 5HCEC 2F01A 5D47A 2QO4A 1SRIA 2Z4HA 2IZBA 3B2JA 4R0BA 4XMEA 5C0NA 2ANSA 4PJ2A 3RSWA 3VGWA 1JBHA 1XKIA 1DF8A 4YMYA 1IJ8A 3APWA 4NNTA 4CDCA 1MM9A 3NQ9A 2OVEA 1LIFA 1OBUA 2RTHB 3WZPA 4TJZA 4GJVA 4AZRA 2ASNX 1VWPB 3WYQA 4BJ8A 1SY0A 1P6PA 2AL0X 1KXOA 5F1EA 5L8OA 2K62A 4D6BA 1OBQA 3ZQ3A 1FTPA 1BEBA 4YDBA 3BY0A 2MHDA 5LJDA 1N43A 1ZRYA 4QGWA 3P6FA 4NW4A 1SWJA 2JN3A 1QFTA 4GKCA 1JV4A 3B2LA 1BSYA 4O4SA 5HA1A 3BRNA 3FR4A 2WEWA 1SWCA 3X00A 1T0VA 3HWGA 1SWNA 1KZXA 2JU8A 2OY7A 4HPDA 4Y59A 4ZCBA 3VG3A 4ZH6A 4BBOA 4KH8A 1ADLA 3PECA 2AVIA 2ZAIA 3CMPA 1XCAA 3WYPA 1EPBA 5JD2A 2WR6A 4IB6A 1HQQA 5LJHA 2RTQB 2UZ2A 3FLLA 4I60A 4I3BA 4MVEA 5EEDA 1LFOA 5IRWA 4N7CA 1SLEB 2KD2A 5HZ6A 1TOWA 1CBIA 4YBPA 2A8GA 2CBSA 1LKEA 1LDOA 2OF8A 4YBUA 3G7XA 2P8GA 1VWAB 4O9SA 4BX7B 4Y0SA 4BX6A 1SXYA 4KC7A 5B5FA 2A0AA 1BSOA 1OEEA 2YG2A 2FHNX 2OYBO 4DCBA 2AF5A 4EEJA 2JOZA 1HBQA 2X8SA 3FR2A 5HZ8A 1R0UA 2HMBA 4ZR2A 3WZQA 4YDAA 4JHQA 1VWLB 1U18A 2IZFB 5CSEA 3P6HA 4CPIA 1YP7A 1KQXA 4DQ4A 1AVGI 1SA8A 3NX2A 1X8UA 2OFAA 3FELA 5K67A 1EXSA 1HXLA 3D4RA 4I3DA 1NGLA 4HPCA 2N93A 4NLJA 4NYRA 1EPAA 2OL6O 2C1SA 2FS6A 2NP1A 3PH6A 4I9RA 1VWCB 3B2IA 1SY1A 5IO7A 1EIIA 3GE2A 3MVFA 2OFBA 3VU1A 3P6EA 4GU8A 5IO6A 2JU3A 2FR2A 2IZAA 1H91A 2IZHB 1ERBA 1N7YA 1SWKA 2CBRA 1LIEA 2JGSA 1D3SA 1HBPA 2RCTA 2RTAA 1W4TA 2X45A 4K19A 4QGVA 3EW1A 4YVBA 3I0AA 1PMPA 2A5CA 2ZAGA 3CKFA 2XSTA 1SLFB 4ZH9A 2GH7A 1RSUB 1FELA 1SWLA 1DZMA 1OEJA 4QNIA 4LKPA 3S5XA 4L1NA 4I95A 3SLJA 3RE6A 4TKBA 4CV7A 1KT7A 1LPJA 2FKGA 4Z27A 4IAWA 3WVMA 1SLGB 3S26A 2FKJA 2FT9A 4YFRA 2QM9A 2IZJA 3F8AA 2A13A 3T1DA 3T2WA 1NC9A 3NX1A 4AZQA 4Z2VA 3NQ3A 3T6LA 4AYHA 4IAXA 1MX8A 1PTSA 2Q39A 5LJCA 3HPEA 3JQOA 4ORSA 4ALOA 2RTMA 2DJFA 4ORUA 5B11O 4BX6B 5L8NA 3EW2A 5D4AA 2OFRX 1ZNDA 4AZMA 1OEKA 1IFBA 2OY8A 3JS1A 3WZOA 1G5WA 3FA7A 4YCHA 1IFCA 3RDQA 1BSQA 2AT5X 3QKGA 2JMBA 1X8QA 2OY1O 5CHKA 1VPRA 3VE1A 1A57A 1RAVA 5EZ2A 3ZUIA 3C78X 2OF9A 4QYPA 3PQUA 4ORWA 1SXXA 5EDBA 4GJSA 2F09A 4Z2PA 1SWUA 1KZWA 2BT9A 4ZGFA 4MVIA 1SWSA 4Y0QA 4EFGA 3LV4A 1SRFA 2IFBA 1PBYA 1JIWI 2PI3O 3P6DA 1AB0A 4FBOA 1SXUA 2G79A 2QCBA 3APXA 2GJ5A 5FQ8E 4EXZA 1KOIA 1Y9TA 2VFCA 3D97A 2OVDA 5F7GA 3HOEA 3FEKA 4INNA 3PP6A 4ORYA 2AMMX 2CZTA 3AKMA 3SZIA 2OL8O 3NBXX 4C5PA 3FIDA 4GGZA 2G7BA 1A3YA 1KT6A 1VWHB 5HCCC 1DFVA 1N4JA 1GT4A 2Q2MA 1JMXA 1QABE 3MG5A 3VG4A 4IABA 1WBIA 4OS3A 2MJIA 3AEHA 1KL3A 2IZLB 3RDOA 5HCDC 2OZQA 4O3XB 1ALBA 4GGTA 1I04A 3ELXA 1OSPO 4ZHHA 2CAMA 3B2KA 1E2TA 1T8VA 1YP6A 3PH5A 3T6FA 5D45A 2GC9A 5HTEA 1W5RA 1VWDB 1GM6A 1EW3A 1KQWA 3SZHA 2GTFX 1RBPA 4JO6A 5F6BA 1VWBB 2W2AA 1D2UA 1X71A 3U9PC 3BSZE 5KHPA 2C1QA 5FFHA 1VWJB 2RD7C 4COTA 5LJBA 3MM0A 2MM3A 2QO6A 1LDQA 5EPQA 5HZ9A 1O1VA 3WJBA 2Q2PA 4OELA 4QZUA 5D48A 2LBAA 1E00A 5CYBA 3ZZVA 2I5ZO 5IO5A 4MEEA 3TGCA 1TXLA 4Y5DA 2DJGA 1SRJA 3HWDA 3PPTA 4IBAA 3WJGA 2UYWA 1LF7A 3D95A 3P02A 1SWQA 2WSJA 3PQSA 1G85A 1MX7A 1SWOA 5H8TA 4XMFA 4Z6JA 1IIUA 3WJDA 2CM9A 5JR8A 4QQ1A 2CZUA 3FW5A 1SWEA 5F6ZA 1LIDA 4JNJA 4BCSA 2L68A 1PM1X 4FQBB 2L67A 3LHNA 3STKA 4AZPA 1ERXA 1STSB 1VWQB 4GETA 2YMSA 1LUQA 3CBCA 4U9CA 1Y52X 1NP1A 2RTKA 5EEEA 2RTCB 4ZFXA 1QWDA 1I06A 1B8EA 1YWAA 4LZUA 5IRUA 2X32A 4HWMA 3ZI8A 1EIOA 5F58A 1JYDA 3AKNA 1SWAA 1BRQA 1I9HA 4CDFA 2IZKA 1UYOX 4ZHGA 2BSZA 5B10O 1SY2A 4O4UA 4RUNA 4O3ZA 4GZVA 5H9LA 4O3YA 1JJJA 2RTOB 3CWKA 1CJ5A 1Z24A 4WFUA 4YGZA 1RXKA 1SREA 2F73A 1VWKB 1SWFA 2KTSA 2NNEA 3PDFA 4FBVA 1DZPA 5B3MO 1AVEA 2Y32A 4TNNA 1BLRA 1U0XA 4NNSA 1O1UA 4AW8A 2VFBA 2WQ9A 3KQ0A 5K06A 2RTPB 3BU9A 2EU7X 4GDZA 1N9MA 1JQPA 3EC5A 4EKVA 1OBPA 2X34A 2IZEB 3BLGA 4CDDA 5DG4A 1GX9A 1LCVA 4XMDA 2RQ0A 4BGFA 3CKGA 1SWDA 3Q34A 1E5PA 3WJEA 1BRPA 3RWXA 1ML7A 1FE3A 1DZKA 1LNMA 1YWCA 3IFBA 4KC8A 5IRAA 5L8IA 4CPFA 2OY5O 1SY3A 3FW4A 3EBKA 1GX3A 2NNDA 1CRBA 3BX7A 2WQAE 1QQSA 1S7DA 3PK2A 3KZAA 4O49A 4B55A 5H9AA 4ON1A 2AT3X 4CPEA 2OVSA 2A3FX 1KL5A 2BC3A 2X4MA 5B29A 1K3BA 4ID2A 3NQKA 4KT5A 1ICNA 2WWPA 3VHMA 1X8OA 2KT4B 4FBRA 4EDEA 2R56A 2ZSCA 3ZWEA 4U46A 3SAOA 2FRSA 5HZQA 4KCAA 3CBSA 1SWRA 2A2GA 4U3QA 3SLTA 4ML7B 3T2XA 4YFQA 1DZJA 3BS2A 1SWHA 2FS7A 4MISA 1LCZA 5AJBA 1SLDB 4A8ZA 4BQUA 5HAEA 2VDFA 2XKLA 1S2PA 4HPBA 5HBSA 5KIDA 5H9NA 2RN4A 4YKOA 2RTRB 1AQBA 1FDQA 1MEPA 3HTYA 4IB7A 2BS5A 4TLJA 2X46A 2WPUA 4GK9A 5LKEA 2LKKA 1VWEB 1NDJA 1S44A 3JSQA 1KL4A 4WFVA 4OMWA 4TQ2A 1B56A 1SWTA 4ARHA 1EUOA 1Y9LA 1GT5A 1FENA 1O8VA 2RTEB 3FDCA 4TKJA 1GT3A 1NQMA 2CM4A 3RDMA 3O19A 3S60A 4CSBA 1STPA 4FGIB 5FQ6E 3F9DA 1KT4A 1DC9A 1UREA 3CQRA 3O2YA 2HLVA 2FR3A 4GD9A 4OKAA 1MUPA 1VWNB 3L4RA 4QYNA 4XMGA 4NV8A 3RE5A 3KFFA 4Z2OA 4N7DA 1E02A 4ORRA 2RTIB 4QRLA 2LFOA 2ACPX 2HNXA 1YUPA 2OVAA 4ALBA 3WOVA 1LCWA 2JW1A 1SRGA 3Q6LA 3F6ZB 4ZHFA 1BJ7A 2QOMA 3OE3A 1MK5A 1YWDA 3HOLA 2K23A 3BU1A 1JYJA 3DSZA 5HWZA 1DF3A 1SRHA 4I9SA 4YKMA 2IZDB 1T68X 4EQAC 3N91A 1CBRA 1QY2A 5FENA 5LJEA 3OD9A 3SZJA 4ZHCA 1FEMA 1I78A 1MVGA 1B0OA 3ZW2A 3FENA 4XMCA 2X55A 4YH0A 1GX8A 3RKGA 1G74A 3P6CA 5B2AO 2KW1A 1X89A 2OL7A 1LIBA 2OFMX 3FYFA 4BOEA 2QMIA 5HA0A 2AH7X 1N0SA 1JZUA 4BX5A 3EMMA 4O4XA 3WXQA 2ALLX 4YCEA 4GE1A 1QFVA 5BVQA 3VHIA 1HMRA 1GKAA 1LICA 5FAZA 5HZ5A 2LBVA 2BLGA 4IMOA 4NP1A 5H9KA 1PEEA 3D9WA 1EI5A 1VWOB 2RTFB 2GTLO 3MBTA 3APVA 3OJYC 4MVKA 4OS0A 3ZW1A 3BDRA 4M6SA 1IKEA 2X56A 1NBXA 2GTLM 2Q4NA 3AUMO 4GNYA 3RDUA 4DQ3A 3STMX 1SWBA 3BX8A 5AEOA 3KFGA 1ZNEA 3GAQA 3TGBA 1RSTB 1NQNA 1CBQA 2HZRA 1NP4A 3FA9A 3HWEA 5F2BA 3VG6A 5D8JA 3U0DA 4NYQA 4TKHA 4U8UO 2IZCB 4RUUA 2WEXA 4O4OA 1AVDA 4U8UM 1HY2A 3HWFA 4M7MA 3RZYA 1EALA 3STNA 1EQDA 4IB9A 3VG7A 1N9YA 4BVMA 1VYGA 1A2DA
chains in the Genus database with same CATH topology
4A1HA 1RLBE 4LKTA 4OS8A 2JU7A 3DTQA 1OPAA 1I4UA 3EBWA 4XMHA 1A18A 4PSQA 2RA6A 3U03A 1BM5A 4I3CA 3TZSA 2FWVA 2Q9SA 2E4JA 4Y0RA 3TF6A 4IB8A 2AKQA 2L5PA 3VPJE 3ZUOA 3CQNA 3FEPA 4LZVA 3VG2A 4D6AA 2O62A 3KFIA 3ZW0A 2M4LA 2GTLN 2MWHA 1ZNGA 1ZNHA 4YFPA 2HYSA 5KICA 1KGLA 2DM5A 3RBYA 1HQPA 1QY1A 2A2UA 4AZOA 1X8PA 1IW2A 1G7NA 2WUTA 1U17A 3APUA 2MO5A 3V8UA 3FMZA 4O3WA 4CK4A 4GNWA 3ELZA 4GRJA 2R73A 2LB6A 3WJFA 4U8UN 1CBSA 1JJXA 1YIVA 3WBGA 2W2BA 5DPQA 2X8TA 1YWBA 2Z4IA 4A60A 5LJKA 1BWYA 2L9CA 3E3CA 1GKAB 1BBPA 4NLIA 1SXWA 2PY1A 1ACDA 1KT3A 2R74A 5BVTA 4MVLA 1B4MA 1VYFA 2RCQA 4JGLA 4ORXA 3UAQA 3ZW1B 4ES7A 2AT6X 3I17A 5LJGA 3OBLA 5BYPA 3NADA 5FQ7E 3K3LA 4UU3A 4HPAA 1TW4A 1GGLA 3VG5A 4YGGA 3FIQA 1X8NA 2G78A 3NP1A 1MDCA 3C76X 5B27A 5AQ6A 2W2FA 2X8FA 3O22A 3NR3A 2POAA 1KT5A 4ODDA 4I6SA 1E06A 3B2HA 3TGAA 1HMSA 1HMTA 1HN2A 1ICMA 3P24A 5BVSA 4WHIA 5LKFA 2FLJA 4KIIA 1GT1A 3EM0A 4AZNA 3IA8A 4Y0PA 3WJCA 1TVQA 5EDCA 3S5VA 1DV9A 1IKJA 1SMPI 2QOSC 2BHVA 3FR5A 3SOTA 5CE4A 4QZTA 1GXAA 1AELA 4YGHA 4A1YA 4MIRA 2AT8X 1UZ2X 4QGXA 2FTBA 3D96A 2AT0X 1TOUA 2KTDA 4UU2A 1ZNKA 4ZJ0A 3FA8A 4GH7A 3CR6A 3VE2A 3ZW0B 4HFOA 4OMXA 3H3IA 1L6MA 4L3RA 5HTDA 4LQZA 2QO5A 3C77X 2HZQA 3KFHA 4WBKA 3FA6A 3MX7A 4ZGUA 1OPBA 3NPOA 3UEWA 3HK1A 3UEXA 1ZNLA 2BS6A 4IMNA 2ACOA 1QG5A 2NNQA 1PBOA 5AJCA 3EYCA 3PEDA 4QAEA 1QY0A 3UEUA 3P6GA 4ZHDA 2LA7A 1I05A 3UEVA 5HCEC 5D47A 2QO4A 2Z4HA 5C0NA 3B2JA 4R0BA 4XMEA 2ANSA 4PJ2A 3RSWA 1JBHA 1XKIA 4YMYA 3APWA 4NNTA 3NQ9A 2OVEA 1LIFA 1OBUA 4TJZA 4AZRA 2ASNX 1SY0A 1P6PA 2AL0X 1KXOA 5F1EA 5L8OA 2K62A 4D6BA 1OBQA 3ZQ3A 1FTPA 1BEBA 4YDBA 3BY0A 2MHDA 5LJDA 1ZRYA 4QGWA 3P6FA 4NW4A 4GKCA 2JN3A 1QFTA 1JV4A 3B2LA 1BSYA 4O4SA 5HA1A 3BRNA 3FR4A 2WEWA 1T0VA 3HWGA 1KZXA 2JU8A 4HPDA 4ZCBA 3VG3A 4ZH6A 4KH8A 1ADLA 3PECA 2ZAIA 3CMPA 1XCAA 1EPBA 2WR6A 4IB6A 5LJHA 3FLLA 5EEDA 4I3BA 4MVEA 1LFOA 4N7CA 2KD2A 5HZ6A 1TOWA 1CBIA 4YBPA 2CBSA 1LKEA 3G7XA 2P8GA 4O9SA 4Y0SA 1SXYA 4KC7A 2A0AA 1BSOA 1OEEA 2YG2A 4EEJA 2JOZA 1HBQA 2X8SA 3FR2A 5HZ8A 1R0UA 2HMBA 4ZR2A 4YDAA 1U18A 3P6HA 1YP7A 1KQXA 4DQ4A 1AVGI 1SA8A 3NX2A 1X8UA 3FELA 1EXSA 3D4RA 4I3DA 1NGLA 4HPCA 2N93A 4NLJA 4NYRA 1EPAA 2FS6A 2NP1A 3PH6A 4I9RA 5IO7A 3B2IA 1SY1A 1EIIA 3GE2A 3MVFA 3VU1A 3P6EA 4GU8A 5IO6A 2JU3A 2FR2A 1H91A 1ERBA 2CBRA 1LIEA 1D3SA 1HBPA 2RCTA 2X45A 4K19A 4QGVA 3I0AA 1PMPA 2ZAGA 2XSTA 4ZH9A 1FELA 1DZMA 1OEJA 4QNIA 4LKPA 3S5XA 4L1NA 4I95A 4TKBA 4CV7A 1KT7A 1LPJA 4IAWA 3WVMA 3S26A 2FT9A 4YFRA 2QM9A 3F8AA 2A13A 3T1DA 3NX1A 4AZQA 3NQ3A 4AYHA 4IAXA 1MX8A 2Q39A 5LJCA 3JQOA 4ORSA 4ALOA 4ORUA 5L8NA 5D4AA 2OFRX 1ZNDA 4AZMA 1OEKA 1IFBA 3JS1A 1G5WA 3FA7A 4YCHA 1IFCA 1BSQA 2AT5X 3QKGA 2JMBA 1X8QA 1VPRA 3VE1A 1A57A 5EZ2A 3ZUIA 3C78X 4QYPA 3PQUA 4ORWA 1SXXA 5EDBA 2F09A 1KZWA 2BT9A 4ZGFA 4MVIA 4Y0QA 4EFGA 3LV4A 2IFBA 1JIWI 3P6DA 1AB0A 4FBOA 1SXUA 2G79A 3APXA 2GJ5A 5FQ8E 4EXZA 1KOIA 1Y9TA 3D97A 5F7GA 2OVDA 3HOEA 3FEKA 4INNA 3PP6A 4ORYA 2AMMX 2CZTA 3AKMA 3NBXX 2G7BA 1A3YA 1KT6A 5HCCC 1DFVA 1GT4A 2Q2MA 1QABE 3VG4A 4IABA 4OS3A 2MJIA 5HCDC 2OZQA 4O3XB 1ALBA 1I04A 3ELXA 4ZHHA 3B2KA 1YP6A 1T8VA 3PH5A 5D45A 2GC9A 5HTEA 1GM6A 1EW3A 1KQWA 2GTFX 1RBPA 5F6BA 5KHPA 2W2AA 1D2UA 1X71A 3U9PC 3BSZE 5FFHA 2RD7C 4COTA 5LJBA 2MM3A 2QO6A 5EPQA 5HZ9A 1O1VA 3WJBA 2Q2PA 4QZUA 5D48A 2LBAA 1E00A 5CYBA 3ZZVA 5IO5A 3TGCA 1TXLA 4IBAA 3HWDA 3PPTA 3WJGA 1LF7A 3D95A 3P02A 2WSJA 3PQSA 1G85A 1MX7A 5H8TA 4XMFA 1IIUA 3WJDA 2CM9A 4QQ1A 2CZUA 3FW5A 5F6ZA 1LIDA 2L68A 1PM1X 4FQBB 2L67A 3LHNA 3STKA 4AZPA 1ERXA 4GETA 2YMSA 3CBCA 4U9CA 1NP1A 5EEEA 4ZFXA 1QWDA 1I06A 1B8EA 1YWAA 4LZUA 3ZI8A 1EIOA 4HWMA 5F58A 1JYDA 3AKNA 1BRQA 4ZHGA 1SY2A 4O4UA 4RUNA 4O3ZA 4GZVA 5H9LA 4O3YA 1JJJA 3CWKA 1CJ5A 1Z24A 4WFUA 4YGZA 2F73A 4FBVA 2KTSA 2NNEA 1DZPA 4TNNA 1BLRA 1U0XA 4NNSA 1O1UA 4AW8A 2WQ9A 3KQ0A 5K06A 3BU9A 2EU7X 4GDZA 1OBPA 3BLGA 5DG4A 1GX9A 4XMDA 2RQ0A 1E5PA 3WJEA 1BRPA 3RWXA 1ML7A 1FE3A 1DZKA 1LNMA 1YWCA 3IFBA 4KC8A 5L8IA 1SY3A 3FW4A 3EBKA 2NNDA 1CRBA 3BX7A 2WQAE 1QQSA 1S7DA 4O49A 3KZAA 5H9AA 4ON1A 2AT3X 2OVSA 2A3FX 5B29A 4ID2A 3NQKA 4KT5A 1ICNA 2WWPA 1X8OA 2KT4B 4FBRA 4EDEA 2R56A 3ZWEA 3SAOA 2FRSA 5HZQA 4KCAA 3CBSA 4U3QA 2A2GA 5JR8A 4ML7B 1DZJA 3BS2A 2FS7A 4MISA 5AJBA 4A8ZA 4BQUA 5HAEA 2XKLA 1S2PA 4HPBA 5HBSA 5KIDA 5H9NA 2RN4A 4YKOA 1AQBA 1FDQA 3HTYA 4IB7A 4TLJA 2BS5A 5LKEA 2X46A 4GK9A 2LKKA 1S44A 3JSQA 4WFVA 4OMWA 4TQ2A 1B56A 4ARHA 1EUOA 1GT5A 1FENA 1O8VA 1Y9LA 4TKJA 4YFQA 1GT3A 2CM4A 4CSBA 3O19A 3S60A 4FGIB 5FQ6E 3F9DA 1KT4A 1DC9A 1UREA 3CQRA 3O2YA 2HLVA 2FR3A 4XMGA 4YBUA 1MUPA 3L4RA 4QYNA 3KFFA 4N7DA 1E02A 4ORRA 4QRLA 2LFOA 2ACPX 2HNXA 1YUPA 2OVAA 4ALBA 3WOVA 2JW1A 3Q6LA 3F6ZB 4ZHFA 1BJ7A 3OE3A 1YWDA 3HOLA 2K23A 3BU1A 1JYJA 3DSZA 5HWZA 1DF3A 4I9SA 4YKMA 1T68X 4EQAC 3N91A 1CBRA 1QY2A 5FENA 5LJEA 3OD9A 4ZHCA 1FEMA 1MVGA 1B0OA 3ZW2A 3FENA 4XMCA 4YH0A 1GX8A 3RKGA 1G74A 3P6CA 2KW1A 1X89A 3FYFA 1LIBA 2OFMX 4BOEA 2QMIA 5HA0A 2AH7X 1N0SA 1JZUA 3EMMA 4O4XA 3WXQA 2ALLX 4YCEA 4GE1A 1QFVA 5BVQA 1HMRA 1GKAA 1LICA 5FAZA 5HZ5A 2LBVA 2BLGA 4IMOA 4NP1A 5H9KA 1PEEA 1EI5A 2GTLO 3MBTA 3APVA 3OJYC 4MVKA 4OS0A 3ZW1A 3BDRA 4M6SA 1IKEA 2GTLM 2Q4NA 4GNYA 4DQ3A 3TGBA 3STMX 3BX8A 5AEOA 3KFGA 1ZNEA 3GAQA 3HWEA 1CBQA 2HZRA 1NP4A 3FA9A 3U0DA 3VG6A 5D8JA 4NYQA 4TKHA 4U8UO 4RUUA 2WEXA 4O4OA 4U8UM 3HWFA 4M7MA 3RZYA 1EALA 3STNA 1EQDA 4IB9A 3VG7A 4BVMA 1VYGA 1A2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1H A;  1RLB E;  4LKT A;  4OS8 A;  2JU7 A;  3DTQ A;  1OPA A;  1I4U A;  3EBW A;  4XMH A;  1A18 A;  4PSQ A;  2RA6 A;  3U03 A;  1BM5 A;  4I3C A;  3TZS A;  2FWV A;  2Q9S A;  2E4J A;  4Y0R A;  3TF6 A;  4IB8 A;  2AKQ A;  2L5P A;  3ZUO A;  3CQN A;  3FEP A;  4LZV A;  3VG2 A;  4D6A A;  2O62 A;  3KFI A;  4YFP A;  1ZNG A;  1ZNH A;  2HYS A;  5KIC A;  1KGL A;  2DM5 A;  1HQP A;  1QY1 A;  2A2U A;  4AZO A;  1X8P A;  1IW2 A;  1G7N A;  2WUT A;  1U17 A;  3APU A;  2MO5 A;  4CK4 A;  3FMZ A;  4GNW A;  3ELZ A;  4GRJ A;  2R73 A;  2LB6 A;  3WJF A;  1JJX A;  1CBS A;  1YIV A;  3WBG A;  2W2B A;  5DPQ A;  1YWB A;  4A60 A;  1BWY A;  5LJK A;  2L9C A;  1GKA B;  1BBP A;  4NLI A;  1SXW A;  2PY1 A;  1ACD A;  1KT3 A;  2R74 A;  5BVT A;  4MVL A;  1B4M A;  1VYF A;  2RCQ A;  4ORX A;  4ES7 A;  2AT6 X;  3I17 A;  5LJG A;  3NAD A;  3K3L A;  4UU3 A;  4HPA A;  1TW4 A;  1GGL A;  3VG5 A;  4YGG A;  3FIQ A;  1X8N A;  2G78 A;  3NP1 A;  1MDC A;  3C76 X;  5B27 A;  5AQ6 A;  2W2F A;  3O22 A;  3NR3 A;  2POA A;  1KT5 A;  4ODD A;  3TGA A;  1E06 A;  3B2H A;  1HMS A;  1HMT A;  1HN2 A;  1ICM A;  5BVS A;  5LKF A;  2FLJ A;  4KII A;  1GT1 A;  3EM0 A;  4AZN A;  3IA8 A;  4Y0P A;  3WJC A;  1TVQ A;  5EDC A;  1DV9 A;  1IKJ A;  2QOS C;  3FR5 A;  5CE4 A;  4QZT A;  1GXA A;  1AEL A;  4YGH A;  4A1Y A;  2AT8 X;  1UZ2 X;  4QGX A;  2FTB A;  3D96 A;  2AT0 X;  1TOU A;  2KTD A;  4UU2 A;  1ZNK A;  4ZJ0 A;  3FA8 A;  4GH7 A;  3CR6 A;  4HFO A;  4OMX A;  1L6M A;  5HTD A;  2QO5 A;  3C77 X;  2HZQ A;  3KFH A;  4WBK A;  3FA6 A;  4ZGU A;  1OPB A;  3NPO A;  3UEW A;  3HK1 A;  3UEX A;  1ZNL A;  4IMN A;  2ACO A;  1QG5 A;  2NNQ A;  1PBO A;  3EYC A;  3PED A;  4QAE A;  1QY0 A;  3UEU A;  3P6G A;  4ZHD A;  1I05 A;  3UEV A;  5HCE C;  5D47 A;  2QO4 A;  5C0N A;  3B2J A;  4R0B A;  4XME A;  2ANS A;  3RSW A;  1JBH A;  1XKI A;  4YMY A;  3APW A;  4NNT A;  3NQ9 A;  2OVE A;  1LIF A;  1OBU A;  4TJZ A;  4AZR A;  2ASN X;  1SY0 A;  1P6P A;  2AL0 X;  1KXO A;  5F1E A;  5L8O A;  2K62 A;  4D6B A;  1OBQ A;  3ZQ3 A;  1FTP A;  1BEB A;  4YDB A;  3BY0 A;  5LJD A;  1ZRY A;  4QGW A;  3P6F A;  4GKC A;  2JN3 A;  1QFT A;  1JV4 A;  3B2L A;  1BSY A;  5HA1 A;  3BRN A;  3FR4 A;  2WEW A;  1T0V A;  3HWG A;  1KZX A;  2JU8 A;  4HPD A;  4ZCB A;  3VG3 A;  4ZH6 A;  1ADL A;  3PEC A;  3CMP A;  1XCA A;  1EPB A;  2WR6 A;  4IB6 A;  5LJH A;  3FLL A;  5EED A;  4I3B A;  1LFO A;  4N7C A;  5HZ6 A;  1TOW A;  1CBI A;  4YBP A;  2CBS A;  1LKE A;  3G7X A;  2P8G A;  4O9S A;  4Y0S A;  1SXY A;  2A0A A;  1BSO A;  1OEE A;  2YG2 A;  4EEJ A;  2JOZ A;  1HBQ A;  3FR2 A;  5HZ8 A;  1R0U A;  2HMB A;  4ZR2 A;  4YDA A;  1U18 A;  3P6H A;  1YP7 A;  1KQX A;  4DQ4 A;  1AVG I;  1SA8 A;  3NX2 A;  1X8U A;  3FEL A;  1EXS A;  4I3D A;  1NGL A;  4HPC A;  2N93 A;  4NLJ A;  4NYR A;  1EPA A;  2FS6 A;  2NP1 A;  3PH6 A;  4I9R A;  5IO7 A;  3B2I A;  1SY1 A;  1EII A;  3MVF A;  3P6E A;  5IO6 A;  2JU3 A;  2FR2 A;  1H91 A;  1ERB A;  2CBR A;  1LIE A;  1D3S A;  1HBP A;  2RCT A;  2X45 A;  4K19 A;  4QGV A;  3I0A A;  1PMP A;  2XST A;  4ZH9 A;  1FEL A;  1DZM A;  1OEJ A;  4LKP A;  4TKB A;  1KT7 A;  1LPJ A;  4IAW A;  3WVM A;  3S26 A;  2FT9 A;  4YFR A;  2QM9 A;  3F8A A;  2A13 A;  3T1D A;  3NX1 A;  4AZQ A;  3NQ3 A;  4AYH A;  4IAX A;  1MX8 A;  2Q39 A;  5LJC A;  4ORS A;  4ALO A;  4ORU A;  5L8N A;  5D4A A;  2OFR X;  1ZND A;  4AZM A;  1OEK A;  1IFB A;  3JS1 A;  1G5W A;  3FA7 A;  4YCH A;  1IFC A;  1BSQ A;  2AT5 X;  3QKG A;  1X8Q A;  1VPR A;  1A57 A;  5EZ2 A;  3ZUI A;  3C78 X;  4QYP A;  4ORW A;  1SXX A;  5EDB A;  1KZW A;  4MVI A;  4Y0Q A;  4EFG A;  2IFB A;  3P6D A;  1AB0 A;  1SXU A;  2G79 A;  3APX A;  2GJ5 A;  4EXZ A;  1KOI A;  3D97 A;  5F7G A;  2OVD A;  3FEK A;  3PP6 A;  4ORY A;  2AMM X;  2CZT A;  3AKM A;  2G7B A;  1A3Y A;  1KT6 A;  5HCC C;  1DFV A;  1GT4 A;  2Q2M A;  1QAB E;  3VG4 A;  4OS3 A;  2MJI A;  5HCD C;  2OZQ A;  1ALB A;  1I04 A;  3ELX A;  4ZHH A;  3B2K A;  1YP6 A;  1T8V A;  3PH5 A;  5D45 A;  2GC9 A;  5HTE A;  1GM6 A;  1EW3 A;  1KQW A;  2GTF X;  1RBP A;  5F6B A;  5KHP A;  2W2A A;  1D2U A;  1X71 A;  3U9P C;  3BSZ E;  5FFH A;  2RD7 C;  5LJB A;  2MM3 A;  2QO6 A;  5EPQ A;  5HZ9 A;  1O1V A;  3WJB A;  2Q2P A;  4QZU A;  5D48 A;  2LBA A;  1E00 A;  5IO5 A;  3TGC A;  1TXL A;  4IBA A;  3HWD A;  3PPT A;  3WJG A;  1LF7 A;  3D95 A;  2WSJ A;  1G85 A;  1MX7 A;  5H8T A;  4XMF A;  1IIU A;  3WJD A;  2CM9 A;  2CZU A;  3FW5 A;  5F6Z A;  1LID A;  2L68 A;  1PM1 X;  2L67 A;  3STK A;  4AZP A;  1ERX A;  4GET A;  3CBC A;  5EEE A;  1NP1 A;  4ZFX A;  1QWD A;  1I06 A;  1B8E A;  1YWA A;  4LZU A;  1EIO A;  5F58 A;  1JYD A;  3AKN A;  1BRQ A;  4ZHG A;  1SY2 A;  4RUN A;  5H9L A;  1JJJ A;  3CWK A;  1CJ5 A;  1Z24 A;  4WFU A;  4YGZ A;  2F73 A;  2NNE A;  1DZP A;  4TNN A;  1BLR A;  1U0X A;  4NNS A;  1O1U A;  4AW8 A;  2WQ9 A;  3KQ0 A;  5K06 A;  3BU9 A;  2EU7 X;  1OBP A;  3BLG A;  5DG4 A;  1GX9 A;  4XMD A;  2RQ0 A;  1E5P A;  3WJE A;  1BRP A;  1ML7 A;  1FE3 A;  1DZK A;  1LNM A;  1YWC A;  3IFB A;  5L8I A;  1SY3 A;  3FW4 A;  3EBK A;  2NND A;  1CRB A;  3BX7 A;  2WQA E;  1QQS A;  1S7D A;  3KZA A;  5H9A A;  2AT3 X;  2A3F X;  5B29 A;  1ICN A;  2WWP A;  1X8O A;  2KT4 B;  4EDE A;  2R56 A;  3SAO A;  2FRS A;  5HZQ A;  5JR8 A;  3CBS A;  2A2G A;  1DZJ A;  3BS2 A;  2FS7 A;  4A8Z A;  4BQU A;  5HAE A;  2XKL A;  1S2P A;  4HPB A;  5HBS A;  5KID A;  5H9N A;  4YKO A;  1AQB A;  1FDQ A;  4IB7 A;  4TLJ A;  5LKE A;  2X46 A;  2LKK A;  1S44 A;  3JSQ A;  4WFV A;  4OMW A;  4TQ2 A;  1B56 A;  4ARH A;  1EUO A;  1GT5 A;  1FEN A;  1O8V A;  4TKJ A;  4YFQ A;  1GT3 A;  2CM4 A;  3O19 A;  3F9D A;  1KT4 A;  1DC9 A;  1URE A;  3CQR A;  3O2Y A;  2HLV A;  2FR3 A;  4XMG A;  4YBU A;  1MUP A;  3L4R A;  4QYN A;  3KFF A;  4N7D A;  1E02 A;  4ORR A;  2LFO A;  2ACP X;  2HNX A;  1YUP A;  2OVA A;  4ALB A;  3Q6L A;  4ZHF A;  1BJ7 A;  1YWD A;  2K23 A;  3BU1 A;  1JYJ A;  3DSZ A;  5HWZ A;  1DF3 A;  4I9S A;  4YKM A;  1T68 X;  5FEN A;  1CBR A;  1QY2 A;  5LJE A;  4ZHC A;  1FEM A;  1MVG A;  1B0O A;  3FEN A;  4XMC A;  4YH0 A;  1GX8 A;  1G74 A;  3P6C A;  1X89 A;  4BOE A;  1LIB A;  2OFM X;  5HA0 A;  2AH7 X;  1N0S A;  1JZU A;  3EMM A;  3WXQ A;  2ALL X;  4YCE A;  4GE1 A;  1QFV A;  5BVQ A;  1HMR A;  1GKA A;  1LIC A;  5FAZ A;  5HZ5 A;  2LBV A;  2BLG A;  4IMO A;  4NP1 A;  5H9K A;  1PEE A;  3MBT A;  3OJY C;  3APV A;  4MVK A;  4OS0 A;  3BDR A;  4M6S A;  1IKE A;  2Q4N A;  4GNY A;  4DQ3 A;  3TGB A;  3STM X;  3BX8 A;  3KFG A;  1ZNE A;  3GAQ A;  3HWE A;  1CBQ A;  2HZR A;  1NP4 A;  3FA9 A;  3U0D A;  3VG6 A;  5D8J A;  4NYQ A;  4TKH A;  4RUU A;  2WEX A;  3HWF A;  4M7M A;  3RZY A;  1EAL A;  3STN A;  1EQD A;  4IB9 A;  3VG7 A;  4BVM A;  1VYG A;  1A2D A; 
#chains in the Genus database with same CATH topology
 4GDA A;  4A1H A;  1RLB E;  4LKT A;  4OS8 A;  2JU7 A;  3DTQ A;  3SLO A;  1OPA A;  4CDE A;  1I4U A;  3EBW A;  4XMH A;  1A18 A;  1KFF A;  4PSQ A;  2RA6 A;  2I5V O;  3U03 A;  2HKD A;  3VHH A;  1JJU A;  1BM5 A;  4I3C A;  3TZS A;  2FWV A;  2Q9S A;  2E4J A;  4Y0R A;  1JMZ A;  3TF6 A;  4IB8 A;  2AKQ A;  2Y3E A;  2C4I A;  3RDX A;  3QQ2 A;  1Y0G A;  2L5P A;  3VPJ E;  3ZUO A;  3CQN A;  4CPH A;  3FEP A;  4LZV A;  3VG2 A;  1RXJ A;  4D6A A;  1HXZ A;  2O62 A;  3KFI A;  3RY1 A;  3ZW0 A;  2M4L A;  2GTL N;  2MWH A;  1ZNG A;  1ZNH A;  4YFP A;  2HYS A;  5KIC A;  5B5G A;  3RDS A;  2DM5 A;  2MF6 A;  3RBY A;  1HQP A;  1KGL A;  1QY1 A;  2A2U A;  2RTB B;  1X8P A;  1IW2 A;  1G7N A;  2WUT A;  1U17 A;  3APU A;  2MO5 A;  4AZO A;  2RTG B;  3V8U A;  1FJ1 E;  3FMZ A;  4O3W A;  4GNW A;  3RY2 A;  4CK4 A;  3ELZ A;  4GRJ A;  2R73 A;  2LB6 A;  2RTN B;  2FGS A;  1CBS A;  3KVN A;  1YIV A;  4U8U N;  3WJF A;  1JJX A;  3WBG A;  1VWR B;  2W2B A;  1SWP A;  5DPQ A;  2X8T A;  4BX5 B;  1YWB A;  2Z4I A;  4A60 A;  5LJK A;  1BWY A;  2L9C A;  3E3C A;  1GKA B;  1BBP A;  4NLI A;  1SXW A;  2PY1 A;  1ACD A;  1KT3 A;  2R74 A;  5BVT A;  4MVL A;  1B4M A;  1VYF A;  2RCQ A;  4JGL A;  4ORX A;  3UAQ A;  2G5L A;  3ZW1 B;  4ES7 A;  2AT6 X;  5L3Y A;  1WUB A;  3I17 A;  5LJG A;  3OBL A;  5BYP A;  3NAD A;  5FQ7 E;  3K3L A;  4UU3 A;  4HPA A;  1TW4 A;  1STR B;  4OEM A;  1UYN X;  1GGL A;  3VG5 A;  4YGG A;  1Y55 X;  3FIQ A;  1W6F A;  1X8N A;  2G78 A;  1K24 A;  2Y3F A;  1MDC A;  3NP1 A;  3C76 X;  1RXH A;  5AQ6 A;  2W2F A;  2X8F A;  5B27 A;  3WZN A;  1SWG A;  3O22 A;  3NR3 A;  2RTD B;  2POA A;  1KT5 A;  4ODD A;  4I6S A;  1E06 A;  3B2H A;  3TGA A;  1HMS A;  1HMT A;  1HN2 A;  1VWG B;  1ICM A;  3P24 A;  5BVS A;  4WHI A;  5LKF A;  2FLJ A;  4KII A;  1GT1 A;  3EM0 A;  4AZN A;  1VWF B;  2FHL A;  2A5B A;  3IA8 A;  4Z28 A;  4Y0P A;  3WJC A;  1TVQ A;  4NV7 A;  5EDC A;  3S5V A;  1DV9 A;  1IKJ A;  1SMP I;  2QOS C;  2BHV A;  3FR5 A;  3SOT A;  1Y53 X;  1VWM B;  5CE4 A;  4QZT A;  1GXA A;  1LEL A;  1AEL A;  4YGH A;  4A1Y A;  4MIR A;  1VYO A;  2AT8 X;  5K68 A;  1UZ2 X;  2IZI A;  2FTB A;  3D96 A;  4QGX A;  2AT0 X;  1TOU A;  2KTD A;  4CPH B;  4UU2 A;  1ZNK A;  4ZJ0 A;  3FA8 A;  4GH7 A;  3CR6 A;  3VE2 A;  3ZW0 B;  4HFO A;  4OMX A;  3H3I A;  1L6M A;  4L3R A;  4IRW A;  5HTD A;  4BX7 A;  2RTJ A;  5IXG A;  4GGR A;  4LQZ A;  3LTW A;  2QO5 A;  3C77 X;  4GUZ A;  2IZG B;  2HZQ A;  3KFH A;  4WBK A;  3FA6 A;  3MX7 A;  4ZGU A;  1OPB A;  2RTL A;  3NPO A;  1MOY A;  3UEW A;  3HK1 A;  3UEX A;  1ZNL A;  2BS6 A;  4IMN A;  2ACO A;  1QG5 A;  2NNQ A;  1PBO A;  5AJC A;  3EYC A;  1VWI B;  3PED A;  1QY0 A;  4QAE A;  3UEU A;  3P6G A;  2G8C O;  2LA7 A;  1I05 A;  4ZHD A;  4DNE A;  3UEV A;  5HCE C;  2F01 A;  5D47 A;  2QO4 A;  1SRI A;  2Z4H A;  2IZB A;  3B2J A;  4R0B A;  4XME A;  5C0N A;  2ANS A;  4PJ2 A;  3RSW A;  3VGW A;  1JBH A;  1XKI A;  1DF8 A;  4YMY A;  1IJ8 A;  3APW A;  4NNT A;  4CDC A;  1MM9 A;  3NQ9 A;  2OVE A;  1LIF A;  1OBU A;  2RTH B;  3WZP A;  4TJZ A;  4GJV A;  4AZR A;  2ASN X;  1VWP B;  3WYQ A;  4BJ8 A;  1SY0 A;  1P6P A;  2AL0 X;  1KXO A;  5F1E A;  5L8O A;  2K62 A;  4D6B A;  1OBQ A;  3ZQ3 A;  1FTP A;  1BEB A;  4YDB A;  3BY0 A;  2MHD A;  5LJD A;  1N43 A;  1ZRY A;  4QGW A;  3P6F A;  4NW4 A;  1SWJ A;  2JN3 A;  1QFT A;  4GKC A;  1JV4 A;  3B2L A;  1BSY A;  4O4S A;  5HA1 A;  3BRN A;  3FR4 A;  2WEW A;  1SWC A;  3X00 A;  1T0V A;  3HWG A;  1SWN A;  1KZX A;  2JU8 A;  2OY7 A;  4HPD A;  4Y59 A;  4ZCB A;  3VG3 A;  4ZH6 A;  4BBO A;  4KH8 A;  1ADL A;  3PEC A;  2AVI A;  2ZAI A;  3CMP A;  1XCA A;  3WYP A;  1EPB A;  5JD2 A;  2WR6 A;  4IB6 A;  1HQQ A;  5LJH A;  2RTQ B;  2UZ2 A;  3FLL A;  4I60 A;  4I3B A;  4MVE A;  5EED A;  1LFO A;  5IRW A;  4N7C A;  1SLE B;  2KD2 A;  5HZ6 A;  1TOW A;  1CBI A;  4YBP A;  2A8G A;  2CBS A;  1LKE A;  1LDO A;  2OF8 A;  4YBU A;  3G7X A;  2P8G A;  1VWA B;  4O9S A;  4BX7 B;  4Y0S A;  4BX6 A;  1SXY A;  4KC7 A;  5B5F A;  2A0A A;  1BSO A;  1OEE A;  2YG2 A;  2FHN X;  2OYB O;  4DCB A;  2AF5 A;  4EEJ A;  2JOZ A;  1HBQ A;  2X8S A;  3FR2 A;  5HZ8 A;  1R0U A;  2HMB A;  4ZR2 A;  3WZQ A;  4YDA A;  4JHQ A;  1VWL B;  1U18 A;  2IZF B;  5CSE A;  3P6H A;  4CPI A;  1YP7 A;  1KQX A;  4DQ4 A;  1AVG I;  1SA8 A;  3NX2 A;  1X8U A;  2OFA A;  3FEL A;  5K67 A;  1EXS A;  1HXL A;  3D4R A;  4I3D A;  1NGL A;  4HPC A;  2N93 A;  4NLJ A;  4NYR A;  1EPA A;  2OL6 O;  2C1S A;  2FS6 A;  2NP1 A;  3PH6 A;  4I9R A;  1VWC B;  3B2I A;  1SY1 A;  5IO7 A;  1EII A;  3GE2 A;  3MVF A;  2OFB A;  3VU1 A;  3P6E A;  4GU8 A;  5IO6 A;  2JU3 A;  2FR2 A;  2IZA A;  1H91 A;  2IZH B;  1ERB A;  1N7Y A;  1SWK A;  2CBR A;  1LIE A;  2JGS A;  1D3S A;  1HBP A;  2RCT A;  2RTA A;  1W4T A;  2X45 A;  4K19 A;  4QGV A;  3EW1 A;  4YVB A;  3I0A A;  1PMP A;  2A5C A;  2ZAG A;  3CKF A;  2XST A;  1SLF B;  4ZH9 A;  2GH7 A;  1RSU B;  1FEL A;  1SWL A;  1DZM A;  1OEJ A;  4QNI A;  4LKP A;  3S5X A;  4L1N A;  4I95 A;  3SLJ A;  3RE6 A;  4TKB A;  4CV7 A;  1KT7 A;  1LPJ A;  2FKG A;  4Z27 A;  4IAW A;  3WVM A;  1SLG B;  3S26 A;  2FKJ A;  2FT9 A;  4YFR A;  2QM9 A;  2IZJ A;  3F8A A;  2A13 A;  3T1D A;  3T2W A;  1NC9 A;  3NX1 A;  4AZQ A;  4Z2V A;  3NQ3 A;  3T6L A;  4AYH A;  4IAX A;  1MX8 A;  1PTS A;  2Q39 A;  5LJC A;  3HPE A;  3JQO A;  4ORS A;  4ALO A;  2RTM A;  2DJF A;  4ORU A;  5B11 O;  4BX6 B;  5L8N A;  3EW2 A;  5D4A A;  2OFR X;  1ZND A;  4AZM A;  1OEK A;  1IFB A;  2OY8 A;  3JS1 A;  3WZO A;  1G5W A;  3FA7 A;  4YCH A;  1IFC A;  3RDQ A;  1BSQ A;  2AT5 X;  3QKG A;  2JMB A;  1X8Q A;  2OY1 O;  5CHK A;  1VPR A;  3VE1 A;  1A57 A;  1RAV A;  5EZ2 A;  3ZUI A;  3C78 X;  2OF9 A;  4QYP A;  3PQU A;  4ORW A;  1SXX A;  5EDB A;  4GJS A;  2F09 A;  4Z2P A;  1SWU A;  1KZW A;  2BT9 A;  4ZGF A;  4MVI A;  1SWS A;  4Y0Q A;  4EFG A;  3LV4 A;  1SRF A;  2IFB A;  1PBY A;  1JIW I;  2PI3 O;  3P6D A;  1AB0 A;  4FBO A;  1SXU A;  2G79 A;  2QCB A;  3APX A;  2GJ5 A;  5FQ8 E;  4EXZ A;  1KOI A;  1Y9T A;  2VFC A;  3D97 A;  2OVD A;  5F7G A;  3HOE A;  3FEK A;  4INN A;  3PP6 A;  4ORY A;  2AMM X;  2CZT A;  3AKM A;  3SZI A;  2OL8 O;  3NBX X;  4C5P A;  3FID A;  4GGZ A;  2G7B A;  1A3Y A;  1KT6 A;  1VWH B;  5HCC C;  1DFV A;  1N4J A;  1GT4 A;  2Q2M A;  1JMX A;  1QAB E;  3MG5 A;  3VG4 A;  4IAB A;  1WBI A;  4OS3 A;  2MJI A;  3AEH A;  1KL3 A;  2IZL B;  3RDO A;  5HCD C;  2OZQ A;  4O3X B;  1ALB A;  4GGT A;  1I04 A;  3ELX A;  1OSP O;  4ZHH A;  2CAM A;  3B2K A;  1E2T A;  1T8V A;  1YP6 A;  3PH5 A;  3T6F A;  5D45 A;  2GC9 A;  5HTE A;  1W5R A;  1VWD B;  1GM6 A;  1EW3 A;  1KQW A;  3SZH A;  2GTF X;  1RBP A;  4JO6 A;  5F6B A;  1VWB B;  2W2A A;  1D2U A;  1X71 A;  3U9P C;  3BSZ E;  5KHP A;  2C1Q A;  5FFH A;  1VWJ B;  2RD7 C;  4COT A;  5LJB A;  3MM0 A;  2MM3 A;  2QO6 A;  1LDQ A;  5EPQ A;  5HZ9 A;  1O1V A;  3WJB A;  2Q2P A;  4OEL A;  4QZU A;  5D48 A;  2LBA A;  1E00 A;  5CYB A;  3ZZV A;  2I5Z O;  5IO5 A;  4MEE A;  3TGC A;  1TXL A;  4Y5D A;  2DJG A;  1SRJ A;  3HWD A;  3PPT A;  4IBA A;  3WJG A;  2UYW A;  1LF7 A;  3D95 A;  3P02 A;  1SWQ A;  2WSJ A;  3PQS A;  1G85 A;  1MX7 A;  1SWO A;  5H8T A;  4XMF A;  4Z6J A;  1IIU A;  3WJD A;  2CM9 A;  5JR8 A;  4QQ1 A;  2CZU A;  3FW5 A;  1SWE A;  5F6Z A;  1LID A;  4JNJ A;  4BCS A;  2L68 A;  1PM1 X;  4FQB B;  2L67 A;  3LHN A;  3STK A;  4AZP A;  1ERX A;  1STS B;  1VWQ B;  4GET A;  2YMS A;  1LUQ A;  3CBC A;  4U9C A;  1Y52 X;  1NP1 A;  2RTK A;  5EEE A;  2RTC B;  4ZFX A;  1QWD A;  1I06 A;  1B8E A;  1YWA A;  4LZU A;  5IRU A;  2X32 A;  4HWM A;  3ZI8 A;  1EIO A;  5F58 A;  1JYD A;  3AKN A;  1SWA A;  1BRQ A;  1I9H A;  4CDF A;  2IZK A;  1UYO X;  4ZHG A;  2BSZ A;  5B10 O;  1SY2 A;  4O4U A;  4RUN A;  4O3Z A;  4GZV A;  5H9L A;  4O3Y A;  1JJJ A;  2RTO B;  3CWK A;  1CJ5 A;  1Z24 A;  4WFU A;  4YGZ A;  1RXK A;  1SRE A;  2F73 A;  1VWK B;  1SWF A;  2KTS A;  2NNE A;  3PDF A;  4FBV A;  1DZP A;  5B3M O;  1AVE A;  2Y32 A;  4TNN A;  1BLR A;  1U0X A;  4NNS A;  1O1U A;  4AW8 A;  2VFB A;  2WQ9 A;  3KQ0 A;  5K06 A;  2RTP B;  3BU9 A;  2EU7 X;  4GDZ A;  1N9M A;  1JQP A;  3EC5 A;  4EKV A;  1OBP A;  2X34 A;  2IZE B;  3BLG A;  4CDD A;  5DG4 A;  1GX9 A;  1LCV A;  4XMD A;  2RQ0 A;  4BGF A;  3CKG A;  1SWD A;  3Q34 A;  1E5P A;  3WJE A;  1BRP A;  3RWX A;  1ML7 A;  1FE3 A;  1DZK A;  1LNM A;  1YWC A;  3IFB A;  4KC8 A;  5IRA A;  5L8I A;  4CPF A;  2OY5 O;  1SY3 A;  3FW4 A;  3EBK A;  1GX3 A;  2NND A;  1CRB A;  3BX7 A;  2WQA E;  1QQS A;  1S7D A;  3PK2 A;  3KZA A;  4O49 A;  4B55 A;  5H9A A;  4ON1 A;  2AT3 X;  4CPE A;  2OVS A;  2A3F X;  1KL5 A;  2BC3 A;  2X4M A;  5B29 A;  1K3B A;  4ID2 A;  3NQK A;  4KT5 A;  1ICN A;  2WWP A;  3VHM A;  1X8O A;  2KT4 B;  4FBR A;  4EDE A;  2R56 A;  2ZSC A;  3ZWE A;  4U46 A;  3SAO A;  2FRS A;  5HZQ A;  4KCA A;  3CBS A;  1SWR A;  2A2G A;  4U3Q A;  3SLT A;  4ML7 B;  3T2X A;  4YFQ A;  1DZJ A;  3BS2 A;  1SWH A;  2FS7 A;  4MIS A;  1LCZ A;  5AJB A;  1SLD B;  4A8Z A;  4BQU A;  5HAE A;  2VDF A;  2XKL A;  1S2P A;  4HPB A;  5HBS A;  5KID A;  5H9N A;  2RN4 A;  4YKO A;  2RTR B;  1AQB A;  1FDQ A;  1MEP A;  3HTY A;  4IB7 A;  2BS5 A;  4TLJ A;  2X46 A;  2WPU A;  4GK9 A;  5LKE A;  2LKK A;  1VWE B;  1NDJ A;  1S44 A;  3JSQ A;  1KL4 A;  4WFV A;  4OMW A;  4TQ2 A;  1B56 A;  1SWT A;  4ARH A;  1EUO A;  1Y9L A;  1GT5 A;  1FEN A;  1O8V A;  2RTE B;  3FDC A;  4TKJ A;  1GT3 A;  1NQM A;  2CM4 A;  3RDM A;  3O19 A;  3S60 A;  4CSB A;  1STP A;  4FGI B;  5FQ6 E;  3F9D A;  1KT4 A;  1DC9 A;  1URE A;  3CQR A;  3O2Y A;  2HLV A;  2FR3 A;  4GD9 A;  4OKA A;  1MUP A;  1VWN B;  3L4R A;  4QYN A;  4XMG A;  4NV8 A;  3RE5 A;  3KFF A;  4Z2O A;  4N7D A;  1E02 A;  4ORR A;  2RTI B;  4QRL A;  2LFO A;  2ACP X;  2HNX A;  1YUP A;  2OVA A;  4ALB A;  3WOV A;  1LCW A;  2JW1 A;  1SRG A;  3Q6L A;  3F6Z B;  4ZHF A;  1BJ7 A;  2QOM A;  3OE3 A;  1MK5 A;  1YWD A;  3HOL A;  2K23 A;  3BU1 A;  1JYJ A;  3DSZ A;  5HWZ A;  1DF3 A;  1SRH A;  4I9S A;  4YKM A;  2IZD B;  1T68 X;  4EQA C;  3N91 A;  1CBR A;  1QY2 A;  5FEN A;  5LJE A;  3OD9 A;  3SZJ A;  4ZHC A;  1FEM A;  1I78 A;  1MVG A;  1B0O A;  3ZW2 A;  3FEN A;  4XMC A;  2X55 A;  4YH0 A;  1GX8 A;  3RKG A;  1G74 A;  3P6C A;  5B2A O;  2KW1 A;  1X89 A;  2OL7 A;  1LIB A;  2OFM X;  3FYF A;  4BOE A;  2QMI A;  5HA0 A;  2AH7 X;  1N0S A;  1JZU A;  4BX5 A;  3EMM A;  4O4X A;  3WXQ A;  2ALL X;  4YCE A;  4GE1 A;  1QFV A;  5BVQ A;  3VHI A;  1HMR A;  1GKA A;  1LIC A;  5FAZ A;  5HZ5 A;  2LBV A;  2BLG A;  4IMO A;  4NP1 A;  5H9K A;  1PEE A;  3D9W A;  1EI5 A;  1VWO B;  2RTF B;  2GTL O;  3MBT A;  3APV A;  3OJY C;  4MVK A;  4OS0 A;  3ZW1 A;  3BDR A;  4M6S A;  1IKE A;  2X56 A;  1NBX A;  2GTL M;  2Q4N A;  3AUM O;  4GNY A;  3RDU A;  4DQ3 A;  3STM X;  1SWB A;  3BX8 A;  5AEO A;  3KFG A;  1ZNE A;  3GAQ A;  3TGB A;  1RST B;  1NQN A;  1CBQ A;  2HZR A;  1NP4 A;  3FA9 A;  3HWE A;  5F2B A;  3VG6 A;  5D8J A;  3U0D A;  4NYQ A;  4TKH A;  4U8U O;  2IZC B;  4RUU A;  2WEX A;  4O4O A;  1AVD A;  4U8U M;  1HY2 A;  3HWF A;  4M7M A;  3RZY A;  1EAL A;  3STN A;  1EQD A;  4IB9 A;  3VG7 A;  1N9Y A;  4BVM A;  1VYG A;  1A2D A; 
#chains in the Genus database with same CATH homology
 4A1H A;  1RLB E;  4LKT A;  4OS8 A;  2JU7 A;  3DTQ A;  1OPA A;  1I4U A;  3EBW A;  4XMH A;  1A18 A;  4PSQ A;  2RA6 A;  3U03 A;  1BM5 A;  4I3C A;  3TZS A;  2FWV A;  2Q9S A;  2E4J A;  4Y0R A;  3TF6 A;  4IB8 A;  2AKQ A;  2L5P A;  3VPJ E;  3ZUO A;  3CQN A;  3FEP A;  4LZV A;  3VG2 A;  4D6A A;  2O62 A;  3KFI A;  3ZW0 A;  2M4L A;  2GTL N;  2MWH A;  1ZNG A;  1ZNH A;  4YFP A;  2HYS A;  5KIC A;  1KGL A;  2DM5 A;  3RBY A;  1HQP A;  1QY1 A;  2A2U A;  4AZO A;  1X8P A;  1IW2 A;  1G7N A;  2WUT A;  1U17 A;  3APU A;  2MO5 A;  3V8U A;  3FMZ A;  4O3W A;  4CK4 A;  4GNW A;  3ELZ A;  4GRJ A;  2R73 A;  2LB6 A;  3WJF A;  4U8U N;  1CBS A;  1JJX A;  1YIV A;  3WBG A;  2W2B A;  5DPQ A;  2X8T A;  1YWB A;  2Z4I A;  4A60 A;  5LJK A;  1BWY A;  2L9C A;  3E3C A;  1GKA B;  1BBP A;  4NLI A;  1SXW A;  2PY1 A;  1ACD A;  1KT3 A;  2R74 A;  5BVT A;  4MVL A;  1B4M A;  1VYF A;  2RCQ A;  4JGL A;  4ORX A;  3UAQ A;  3ZW1 B;  4ES7 A;  2AT6 X;  3I17 A;  5LJG A;  3OBL A;  5BYP A;  3NAD A;  5FQ7 E;  3K3L A;  4UU3 A;  4HPA A;  1TW4 A;  1GGL A;  3VG5 A;  4YGG A;  3FIQ A;  1X8N A;  2G78 A;  3NP1 A;  1MDC A;  3C76 X;  5B27 A;  5AQ6 A;  2W2F A;  2X8F A;  3O22 A;  3NR3 A;  2POA A;  1KT5 A;  4ODD A;  4I6S A;  1E06 A;  3B2H A;  3TGA A;  1HMS A;  1HMT A;  1HN2 A;  1ICM A;  3P24 A;  5BVS A;  4WHI A;  5LKF A;  2FLJ A;  4KII A;  1GT1 A;  3EM0 A;  4AZN A;  3IA8 A;  4Y0P A;  3WJC A;  1TVQ A;  5EDC A;  3S5V A;  1DV9 A;  1IKJ A;  1SMP I;  2QOS C;  2BHV A;  3FR5 A;  3SOT A;  5CE4 A;  4QZT A;  1GXA A;  1AEL A;  4YGH A;  4A1Y A;  4MIR A;  2AT8 X;  1UZ2 X;  4QGX A;  2FTB A;  3D96 A;  2AT0 X;  1TOU A;  2KTD A;  4UU2 A;  1ZNK A;  4ZJ0 A;  3FA8 A;  4GH7 A;  3CR6 A;  3VE2 A;  3ZW0 B;  4HFO A;  4OMX A;  3H3I A;  1L6M A;  4L3R A;  5HTD A;  4LQZ A;  2QO5 A;  3C77 X;  2HZQ A;  3KFH A;  4WBK A;  3FA6 A;  3MX7 A;  4ZGU A;  1OPB A;  3NPO A;  3UEW A;  3HK1 A;  3UEX A;  1ZNL A;  2BS6 A;  4IMN A;  2ACO A;  1QG5 A;  2NNQ A;  1PBO A;  5AJC A;  3EYC A;  3PED A;  4QAE A;  1QY0 A;  3UEU A;  3P6G A;  4ZHD A;  2LA7 A;  1I05 A;  3UEV A;  5HCE C;  5D47 A;  2QO4 A;  2Z4H A;  5C0N A;  3B2J A;  4R0B A;  4XME A;  2ANS A;  4PJ2 A;  3RSW A;  1JBH A;  1XKI A;  4YMY A;  3APW A;  4NNT A;  3NQ9 A;  2OVE A;  1LIF A;  1OBU A;  4TJZ A;  4AZR A;  2ASN X;  1SY0 A;  1P6P A;  2AL0 X;  1KXO A;  5F1E A;  5L8O A;  2K62 A;  4D6B A;  1OBQ A;  3ZQ3 A;  1FTP A;  1BEB A;  4YDB A;  3BY0 A;  2MHD A;  5LJD A;  1ZRY A;  4QGW A;  3P6F A;  4NW4 A;  4GKC A;  2JN3 A;  1QFT A;  1JV4 A;  3B2L A;  1BSY A;  4O4S A;  5HA1 A;  3BRN A;  3FR4 A;  2WEW A;  1T0V A;  3HWG A;  1KZX A;  2JU8 A;  4HPD A;  4ZCB A;  3VG3 A;  4ZH6 A;  4KH8 A;  1ADL A;  3PEC A;  2ZAI A;  3CMP A;  1XCA A;  1EPB A;  2WR6 A;  4IB6 A;  5LJH A;  3FLL A;  5EED A;  4I3B A;  4MVE A;  1LFO A;  4N7C A;  2KD2 A;  5HZ6 A;  1TOW A;  1CBI A;  4YBP A;  2CBS A;  1LKE A;  3G7X A;  2P8G A;  4O9S A;  4Y0S A;  1SXY A;  4KC7 A;  2A0A A;  1BSO A;  1OEE A;  2YG2 A;  4EEJ A;  2JOZ A;  1HBQ A;  2X8S A;  3FR2 A;  5HZ8 A;  1R0U A;  2HMB A;  4ZR2 A;  4YDA A;  1U18 A;  3P6H A;  1YP7 A;  1KQX A;  4DQ4 A;  1AVG I;  1SA8 A;  3NX2 A;  1X8U A;  3FEL A;  1EXS A;  3D4R A;  4I3D A;  1NGL A;  4HPC A;  2N93 A;  4NLJ A;  4NYR A;  1EPA A;  2FS6 A;  2NP1 A;  3PH6 A;  4I9R A;  5IO7 A;  3B2I A;  1SY1 A;  1EII A;  3GE2 A;  3MVF A;  3VU1 A;  3P6E A;  4GU8 A;  5IO6 A;  2JU3 A;  2FR2 A;  1H91 A;  1ERB A;  2CBR A;  1LIE A;  1D3S A;  1HBP A;  2RCT A;  2X45 A;  4K19 A;  4QGV A;  3I0A A;  1PMP A;  2ZAG A;  2XST A;  4ZH9 A;  1FEL A;  1DZM A;  1OEJ A;  4QNI A;  4LKP A;  3S5X A;  4L1N A;  4I95 A;  4TKB A;  4CV7 A;  1KT7 A;  1LPJ A;  4IAW A;  3WVM A;  3S26 A;  2FT9 A;  4YFR A;  2QM9 A;  3F8A A;  2A13 A;  3T1D A;  3NX1 A;  4AZQ A;  3NQ3 A;  4AYH A;  4IAX A;  1MX8 A;  2Q39 A;  5LJC A;  3JQO A;  4ORS A;  4ALO A;  4ORU A;  5L8N A;  5D4A A;  2OFR X;  1ZND A;  4AZM A;  1OEK A;  1IFB A;  3JS1 A;  1G5W A;  3FA7 A;  4YCH A;  1IFC A;  1BSQ A;  2AT5 X;  3QKG A;  2JMB A;  1X8Q A;  1VPR A;  3VE1 A;  1A57 A;  5EZ2 A;  3ZUI A;  3C78 X;  4QYP A;  3PQU A;  4ORW A;  1SXX A;  5EDB A;  2F09 A;  1KZW A;  2BT9 A;  4ZGF A;  4MVI A;  4Y0Q A;  4EFG A;  3LV4 A;  2IFB A;  1JIW I;  3P6D A;  1AB0 A;  4FBO A;  1SXU A;  2G79 A;  3APX A;  2GJ5 A;  5FQ8 E;  4EXZ A;  1KOI A;  1Y9T A;  3D97 A;  5F7G A;  2OVD A;  3HOE A;  3FEK A;  4INN A;  3PP6 A;  4ORY A;  2AMM X;  2CZT A;  3AKM A;  3NBX X;  2G7B A;  1A3Y A;  1KT6 A;  5HCC C;  1DFV A;  1GT4 A;  2Q2M A;  1QAB E;  3VG4 A;  4IAB A;  4OS3 A;  2MJI A;  5HCD C;  2OZQ A;  4O3X B;  1ALB A;  1I04 A;  3ELX A;  4ZHH A;  3B2K A;  1YP6 A;  1T8V A;  3PH5 A;  5D45 A;  2GC9 A;  5HTE A;  1GM6 A;  1EW3 A;  1KQW A;  2GTF X;  1RBP A;  5F6B A;  5KHP A;  2W2A A;  1D2U A;  1X71 A;  3U9P C;  3BSZ E;  5FFH A;  2RD7 C;  4COT A;  5LJB A;  2MM3 A;  2QO6 A;  5EPQ A;  5HZ9 A;  1O1V A;  3WJB A;  2Q2P A;  4QZU A;  5D48 A;  2LBA A;  1E00 A;  5CYB A;  3ZZV A;  5IO5 A;  3TGC A;  1TXL A;  4IBA A;  3HWD A;  3PPT A;  3WJG A;  1LF7 A;  3D95 A;  3P02 A;  2WSJ A;  3PQS A;  1G85 A;  1MX7 A;  5H8T A;  4XMF A;  1IIU A;  3WJD A;  2CM9 A;  4QQ1 A;  2CZU A;  3FW5 A;  5F6Z A;  1LID A;  2L68 A;  1PM1 X;  4FQB B;  2L67 A;  3LHN A;  3STK A;  4AZP A;  1ERX A;  4GET A;  2YMS A;  3CBC A;  4U9C A;  1NP1 A;  5EEE A;  4ZFX A;  1QWD A;  1I06 A;  1B8E A;  1YWA A;  4LZU A;  3ZI8 A;  1EIO A;  4HWM A;  5F58 A;  1JYD A;  3AKN A;  1BRQ A;  4ZHG A;  1SY2 A;  4O4U A;  4RUN A;  4O3Z A;  4GZV A;  5H9L A;  4O3Y A;  1JJJ A;  3CWK A;  1CJ5 A;  1Z24 A;  4WFU A;  4YGZ A;  2F73 A;  4FBV A;  2KTS A;  2NNE A;  1DZP A;  4TNN A;  1BLR A;  1U0X A;  4NNS A;  1O1U A;  4AW8 A;  2WQ9 A;  3KQ0 A;  5K06 A;  3BU9 A;  2EU7 X;  4GDZ A;  1OBP A;  3BLG A;  5DG4 A;  1GX9 A;  4XMD A;  2RQ0 A;  1E5P A;  3WJE A;  1BRP A;  3RWX A;  1ML7 A;  1FE3 A;  1DZK A;  1LNM A;  1YWC A;  3IFB A;  4KC8 A;  5L8I A;  1SY3 A;  3FW4 A;  3EBK A;  2NND A;  1CRB A;  3BX7 A;  2WQA E;  1QQS A;  1S7D A;  4O49 A;  3KZA A;  5H9A A;  4ON1 A;  2AT3 X;  2OVS A;  2A3F X;  5B29 A;  4ID2 A;  3NQK A;  4KT5 A;  1ICN A;  2WWP A;  1X8O A;  2KT4 B;  4FBR A;  4EDE A;  2R56 A;  3ZWE A;  3SAO A;  2FRS A;  5HZQ A;  4KCA A;  3CBS A;  4U3Q A;  2A2G A;  5JR8 A;  4ML7 B;  1DZJ A;  3BS2 A;  2FS7 A;  4MIS A;  5AJB A;  4A8Z A;  4BQU A;  5HAE A;  2XKL A;  1S2P A;  4HPB A;  5HBS A;  5KID A;  5H9N A;  2RN4 A;  4YKO A;  1AQB A;  1FDQ A;  3HTY A;  4IB7 A;  4TLJ A;  2BS5 A;  5LKE A;  2X46 A;  4GK9 A;  2LKK A;  1S44 A;  3JSQ A;  4WFV A;  4OMW A;  4TQ2 A;  1B56 A;  4ARH A;  1EUO A;  1GT5 A;  1FEN A;  1O8V A;  1Y9L A;  4TKJ A;  4YFQ A;  1GT3 A;  2CM4 A;  4CSB A;  3O19 A;  3S60 A;  4FGI B;  5FQ6 E;  3F9D A;  1KT4 A;  1DC9 A;  1URE A;  3CQR A;  3O2Y A;  2HLV A;  2FR3 A;  4XMG A;  4YBU A;  1MUP A;  3L4R A;  4QYN A;  3KFF A;  4N7D A;  1E02 A;  4ORR A;  4QRL A;  2LFO A;  2ACP X;  2HNX A;  1YUP A;  2OVA A;  4ALB A;  3WOV A;  2JW1 A;  3Q6L A;  3F6Z B;  4ZHF A;  1BJ7 A;  3OE3 A;  1YWD A;  3HOL A;  2K23 A;  3BU1 A;  1JYJ A;  3DSZ A;  5HWZ A;  1DF3 A;  4I9S A;  4YKM A;  1T68 X;  4EQA C;  3N91 A;  1CBR A;  1QY2 A;  5FEN A;  5LJE A;  3OD9 A;  4ZHC A;  1FEM A;  1MVG A;  1B0O A;  3ZW2 A;  3FEN A;  4XMC A;  4YH0 A;  1GX8 A;  3RKG A;  1G74 A;  3P6C A;  2KW1 A;  1X89 A;  3FYF A;  1LIB A;  2OFM X;  4BOE A;  2QMI A;  5HA0 A;  2AH7 X;  1N0S A;  1JZU A;  3EMM A;  4O4X A;  3WXQ A;  2ALL X;  4YCE A;  4GE1 A;  1QFV A;  5BVQ A;  1HMR A;  1GKA A;  1LIC A;  5FAZ A;  5HZ5 A;  2LBV A;  2BLG A;  4IMO A;  4NP1 A;  5H9K A;  1PEE A;  1EI5 A;  2GTL O;  3MBT A;  3APV A;  3OJY C;  4MVK A;  4OS0 A;  3ZW1 A;  3BDR A;  4M6S A;  1IKE A;  2GTL M;  2Q4N A;  4GNY A;  4DQ3 A;  3TGB A;  3STM X;  3BX8 A;  5AEO A;  3KFG A;  1ZNE A;  3GAQ A;  3HWE A;  1CBQ A;  2HZR A;  1NP4 A;  3FA9 A;  3U0D A;  3VG6 A;  5D8J A;  4NYQ A;  4TKH A;  4U8U O;  4RUU A;  2WEX A;  4O4O A;  4U8U M;  3HWF A;  4M7M A;  3RZY A;  1EAL A;  3STN A;  1EQD A;  4IB9 A;  3VG7 A;  4BVM A;  1VYG A;  1A2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...