1K24A

Crystal structure of the opca outer membrane adhesin/invasin from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
249
structure length
249
Chain Sequence
QTANEFTVHTDLSSISSTRAFLKEKHKAAKHIGVRADIPFDANQGIRLEAGFGRSKKNIINLETDENKLGKTKNVKLPTGVPENRIDLYTGYTYTQTLSDSLNFRVGAGLGFESSKDSIKTTKHTLHSSRQSWLAKVHADLLSQLGNGWYINPWSEVKFDLNSRYKLNTGVTNLKKDINQKTNGWGFGLGANIGKKLGESASIEAGPFYKQRTYKESGEFSVTTKSGDVSLTIPKTSIREYGLRVGIKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords outer membrane protein
publication title Crystal structure of the OpcA integral membrane adhesin from Neisseria meningitidis.
pubmed doi rcsb
total genus 52
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2001-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07239 OpcA Outer membrane protein OpcA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.100 Mainly Beta Beta Barrel Lipocalin OPCA outer membrane adhesin/invasin 1k24A00
2VDFA 1K24A
chains in the Genus database with same CATH superfamily
4NP1A 5HZ6A 2E4JA 4GGTA 2X46A 2YMSA 4ARHA 4COTA 3C78X 1AVGI 4CV7A 3FA7A 2RTHB 1SWAA 3N91A 4OMXA 1MVGA 4NV8A 4QYPA 1AB0A 5HA1A 3UEVA 1HQQA 2ZAIA 2C1QA 1PMPA 1ZNEA 1HY2A 2AT6X 3KFHA 4YVBA 1OBUA 2FGSA 3TGBA 3CBCA 2XKLA 5K06A 1IKJA 2L67A 1VYFA 1LICA 2KTSA 1QY2A 1SRFA 4OS0A 5H8TA 5H9AA 3I17A 1LCVA 1LIFA 4B55A 5B29A 2UYWA 3RDXA 1HMTA 1NP1A 3PECA 4ZGFA 5JR8A 1SWEA 1JBHA 1GKAB 1DF8A 1ICMA 4Z2VA 4A1YA 1G85A 1KL4A 3T6FA 2RTCB 3AKNA 2OFAA 1DV9A 1N9MA 4U8UN 2FR3A 4Y0QA 4KH8A 2W2FA 2ACPX 4MVEA 4NV7A 3APWA 5H9NA 5L8IA 3SLJA 3WJBA 4XMEA 5B11O 3TGAA 2KT4B 3CKGA 5D48A 1BSYA 1BSQA 2RTRB 2I5VO 2OL8O 1E02A 2Q9SA 2MM3A 5LJDA 2BSZA 3FW4A 1A57A 1XCAA 4ZHCA 1SLEB 1A18A 3P6CA 2W2BA 2WEWA 1SWBA 4BX5B 3NQ9A 4ZJ0A 3BS2A 4XMDA 1RAVA 4OKAA 3TGCA 4BBOA 1Y52X 1U18A 1IFBA 1GT3A 1KQWA 1BWYA 4I60A 3BY0A 2FKGA 1TXLA 3WVMA 1DFVA 4WFVA 1LIEA 1KZXA 1A2DA 1G7NA 4HWMA 2JU8A 2K62A 1KGLA 3VG4A 1NC9A 1Y9TA 2JOZA 3FR4A 3MBTA 3T1DA 1NQNA 2QOMA 1ZNKA 2F73A 2OL7A 1UYNX 3CWKA 1NQMA 2OY8A 4IMNA 2BT9A 1SMPI 1SWCA 2KTDA 3EC5A 4ORWA 2HKDA 5LJEA 1KOIA 4TQ2A 3VE1A 4CDFA 1LNMA 2BHVA 2FT9A 2BS5A 1BBPA 1QFTA 3BSZE 4GD9A 1JJUA 2WQAE 1EXSA 3PQSA 4MVIA 2X8FA 4GDAA 3FA9A 4NYQA 1U0XA 2M4LA 4GNWA 4YBPA 1MOYA 4O4UA 2A8GA 1ZNGA 2RTKA 5FFHA 4Z2OA 4ALBA 2WR6A 2DJGA 1RSTB 1PBYA 2QMIA 3IFBA 2FHLA 1VWHB 5DG4A 2LFOA 2RQ0A 4XMFA 2CZUA 1ADLA 1B56A 1X8PA 3B2KA 3BX7A 1SRJA 2HYSA 2UZ2A 3CR6A 2XSTA 2RTLA 3P24A 4ORRA 5HA0A 5IO7A 3FA6A 3BLGA 3FEPA 4JO6A 4U3QA 4A1HA 2RTFB 1O8VA 2F09A 1S2PA 1DZJA 2X34A 1Y55X 3P6HA 2AT8X 3RBYA 1LIDA 2WEXA 4YCHA 3VHMA 4HPAA 1E5PA 1DZKA 2X8SA 3VG2A 1QWDA 2IZBA 3CKFA 4U46A 5IRUA 1W6FA 1EI5A 2GC9A 3PK2A 2Q39A 3RDQA 4C5PA 3O22A 3VE2A 2G5LA 3WJCA 4L1NA 3D97A 1GX8A 2A2GA 3ELZA 4ODDA 4O4OA 1X8QA 3SLOA 4ZHDA 3NQ3A 2RD7C 4N7CA 1JMZA 3OD9A 1PEEA 4QGVA 2RTDB 3P6EA 3FYFA 4GU8A 2MHDA 1T8VA 1KFFA 3RE5A 4O3ZA 2OVEA 2QO5A 4MISA 2A5CA 1JMXA 3D4RA 4O9SA 1SLFB 3ZW1A 2ACOA 2P8GA 4ZHGA 4U8UO 4BOEA 4OS8A 5IRWA 4I6SA 5HZ8A 1EUOA 4O3XB 4ZH6A 3WYPA 4WHIA 1T0VA 3MM0A 1YWDA 2AT5X 1VWMB 2L9CA 4JNJA 2VDFA 4TLJA 1VWFB 2JU7A 3NR3A 2NNQA 4RUUA 1I04A 2OF9A 2X55A 3NPOA 4ORYA 3RKGA 1PBOA 2NP1A 4QQ1A 1SXWA 2FLJA 2MJIA 1SWKA 4YGGA 1SREA 2OYBO 4EFGA 5BVQA 5DPQA 1KT6A 3RY2A 3B2JA 3BU9A 3OJYC 3FMZA 3FW5A 4ZCBA 2NNDA 1SWQA 3ZQ3A 4I3BA 1LDOA 1KT3A 1SWPA 1OBQA 2JW1A 5HZQA 3O2YA 5LJCA 1IJ8A 1LKEA 4BX6B 3B2IA 1T68X 3DTQA 5EEDA 1BRQA 1RLBE 3EW1A 4ORSA 1JJXA 2IZDB 3NBXX 1LFOA 5B5GA 1JYJA 4ZGUA 4QRLA 1EIOA 2X56A 4ORXA 4MIRA 1EPAA 1MDCA 2RTOB 4UU3A 4Y5DA 2EU7X 2IZHB 3ZUIA 4R0BA 4IB8A 4O3WA 5HCEC 2CM4A 4ZHFA 4YH0A 2IZCB 3TF6A 3NADA 1W5RA 2X4MA 1YWBA 3TZSA 4GNYA 5HTEA 5F6ZA 5EZ2A 2OVAA 5LJGA 1HXLA 3KVNA 1ALBA 2OFMX 4HPCA 3SZJA 2HMBA 4QZUA 5CYBA 3AKMA 5F1EA 2HZRA 2IZAA 3CMPA 4TKJA 1BJ7A 1OSPO 3VG5A 1NBXA 4M6SA 1SWDA 1DZPA 1YIVA 2OFBA 1HBQA 5B5FA 4CK4A 5L8NA 4ORUA 1S7DA 2C1SA 2WUTA 1CJ5A 1D3SA 2I5ZO 4ON1A 4CPHB 2ZSCA 3F6ZB 1LPJA 3FR5A 2HLVA 4GJSA 4BX7B 1ERBA 4GJVA 5B3MO 3MX7A 2ASNX 1SWOA 1HQPA 4O4XA 4KIIA 4RUNA 2KW1A 3ZW0A 5D45A 2JGSA 2RTMA 1ML7A 3EYCA 3QQ2A 2RTBB 3LTWA 4YGHA 1I78A 3VPJE 5KHPA 1X8OA 3F9DA 2JMBA 1B0OA 1QG5A 1K3BA 4ALOA 1LCZA 2AF5A 2HNXA 1TVQA 2RTPB 1QY0A 3L4RA 3RDSA 1RXJA 2RTAA 5D8JA 1FENA 4A60A 1SWGA 3HTYA 4D6BA 1OEJA 4YFQA 5LJKA 1QY1A 4Y0PA 3HWFA 1VWEB 4ZR2A 3WJFA 2WSJA 2VFCA 3KZAA 3B2HA 2Y3EA 5D4AA 2KD2A 5BVTA 2AT3X 3RE6A 2QCBA 4TNNA 2Y3FA 1N4JA 1X8NA 3FIDA 3MG5A 1SWTA 3AUMO 4IMOA 4QYNA 3WJEA 5HCCC 2LB6A 2LBAA 4YCEA 3U0DA 1AQBA 4EQAC 3VU1A 1HMSA 1NGLA 5KICA 2LKKA 3C76X 1VYGA 3UEWA 2Z4IA 3FELA 1G74A 2GJ5A 2RTJA 1GT4A 4YBUA 2OFRX 2X32A 3SZHA 1SRGA 4CPFA 4CSBA 4ZFXA 5AEOA 1VWAB 2OL6O 3PQUA 4ES7A 1SRHA 3JQOA 2JU3A 1DZMA 2A2UA 1ICNA 3JSQA 3FLLA 1GT5A 2QOSC 3F8AA 4GUZA 3E3CA 5B27A 1N9YA 2FWVA 1QFVA 5F7GA 3WOVA 1SWNA 1LF7A 4I3DA 2JN3A 5H9KA 2IZFB 2IZGB 4YFRA 3WJGA 3AEHA 4TKHA 3NX1A 3KFGA 3SZIA 3EMMA 1G5WA 1ZNLA 1VWBB 3HWEA 3HPEA 2PI3O 4JHQA 5FQ8E 1GT1A 3S60A 3STMX 2R56A 1A3YA 1VWGB 3BDRA 5K68A 2ZAGA 1VWJB 1VWQB 1OBPA 1PM1X 1SLDB 2DJFA 3EBKA 4YMYA 2IZIA 3EM0A 4PSQA 4XMGA 4FBVA 4AZMA 1KT7A 3U9PC 4GH7A 2ALLX 3HOEA 3WZOA 1WUBA 2RCQA 1VWPB 3UEUA 1MX7A 2YG2A 1IKEA 1BLRA 5F58A 3CQRA 3PEDA 1CBSA 1TOUA 3EBWA 1SLGB 4LQZA 4OEMA 1HBPA 1QABE 1VWKB 3HWGA 4IB7A 4NLIA 4O49A 1S44A 1FDQA 4YGZA 3WJDA 4AZPA 3SAOA 2BC3A 2Q2MA 1KT4A 2RN4A 1VYOA 4NNTA 4QZTA 1X89A 2O62A 1VWCB 4I9RA 3PPTA 1GGLA 3SOTA 1MEPA 1JIWI 4AZRA 5FAZA 3WZPA 4CDCA 1HN2A 4EXZA 2AVIA 2Q2PA 5LJBA 4QGXA 2FTBA 3ZWEA 3RSWA 3WBGA 1N43A 4HPDA 1P6PA 4CPIA 3HK1A 2NNEA 1ACDA 1KT5A 2W2AA 4INNA 3RY1A 5AJCA 4AYHA 1I4UA 3P6GA 4Y0SA 3APUA 5HWZA 1FELA 2CM9A 1EQDA 2Y32A 3BX8A 3CBSA 3GE2A 5EDBA 4M7MA 2CZTA 2ANSA 1R0UA 2FKJA 3WXQA 4D6AA 1SWHA 3U03A 1GKAA 1IFCA 4BVMA 3CQNA 1JQPA 2RA6A 5K67A 1EW3A 4IAXA 1I9HA 2OY7A 4L3RA 4N7DA 4EKVA 3KQ0A 4KC7A 4MVLA 1JJJA 1SWLA 1I06A 3LV4A 2OVSA 1VWLB 3LHNA 1AELA 1Y53X 3P6DA 2G8CO 1SXUA 4OELA 1GM6A 2GTFX 4EEJA 5HTDA 3PDFA 3T6LA 1YUPA 3KFFA 1STPA 2IZKA 3BU1A 4I9SA 1SA8A 4LZUA 1VWDB 4UU2A 5JD2A 2G78A 3D9WA 1KZWA 4KT5A 5HCDC 1OEKA 4IRWA 4OS3A 4Y59A 2QO4A 4AW8A 1RXHA 1STRB 4Z27A 1KQXA 3ZUOA 3RDMA 4BX5A 1DC9A 1SWFA 1VWRB 3HWDA 3SLTA 1AVDA 1KL5A 3OBLA 2IZEB 3G7XA 1SXYA 3Q6LA 4LKTA 1SWSA 3D96A 4GK9A 3T2WA 4QNIA 3D95A 2CBRA 4HFOA 5AJBA 3DSZA 3OE3A 3FR2A 2AL0X 1D2UA 1SXXA 3MVFA 1TOWA 1SY2A 2X45A 3ZZVA 5BVSA 1QQSA 5CHKA 4QAEA 1VWOB 5IO6A 2WPUA 4NW4A 5B2AO 2MO5A 1O1UA 1SY3A 3STNA 4NLJA 3KFIA 5EDCA 1FEMA 1AVEA 4XMCA 3RDUA 4A8ZA 2G79A 4OMWA 3Q34A 3NQKA 1SRIA 1SWRA 2MWHA 5IO5A 5L8OA 3RWXA 2OY1O 2WQ9A 5BYPA 1GX3A 4FBOA 4GDZA 2LBVA 1JYDA 3P6FA 1E06A 1BM5A 1BEBA 3I0AA 4O4SA 4IB6A 4TKBA 1MX8A 4BCSA 5HAEA 2GTLN 3H3IA 4CPEA 3B2LA 1JZUA 3C77X 4AZOA 3QKGA 1OEEA 4DQ4A 1O1VA 2RTIB 4YDAA 2AMMX 3FEKA 3VHHA 3IA8A 4KC8A 2FRSA 2CAMA 1GXAA 3FIQA 1CBRA 5AQ6A 2AH7X 3V8UA 3PP6A 2FS6A 3X00A 1YP6A 4IABA 1VPRA 1N0SA 1EPBA 4IAWA 5FQ6E 4DNEA 2LA7A 5CSEA 4MVKA 2L5PA 2L68A 1LDQA 2R74A 1FE3A 5C0NA 1E00A 1FTPA 3S5VA 5FENA 1LELA 2Q4NA 2FR2A 2RTQB 1SY1A 4WFUA 4FBRA 4FQBB 2GH7A 4FGIB 3VG6A 2Z4HA 3ZW2A 2A13A 3NP1A 4Y0RA 3FDCA 3UEXA 1MK5A 1JV4A 2IFBA 2RTNB 3RDOA 3ZW0B 5IXGA 5KIDA 1B8EA 1ZNDA 3S5XA 4BQUA 4DCBA 1E2TA 4GRJA 4I95A 5B10O 1I05A 1PTSA 2FHNX 4CDDA 1GX9A 2C4IA 1H91A 1W4TA 2IZJA 2OVDA 4HPBA 4U9CA 1BRPA 1ZRYA 1Y0GA 3NX2A 1IIUA 1LUQA 3ELXA 3FENA 4GGZA 3JS1A 4YKOA 2OY5O 2DM5A 4BJ8A 4CDEA 2RCTA 3HOLA 2K23A 2AKQA 1EIIA 1SWJA 1X8UA 4LKPA 1BSOA 1NP4A 1N7YA 5LJHA 4GE1A 1ERXA 1NDJA 4GZVA 5F6BA 4GGRA 4U8UM 3RZYA 3ZI8A 2CBSA 5EPQA 1UREA 1Z24A 3APXA 4Z2PA 4NNSA 1DF3A 1VWIB 5HZ5A 5IRAA 3S26A 5EEEA 3WZNA 2GTLM 2POAA 1LCWA 5F2BA 2RTEB 3EW2A 3PH5A 1XKIA 2N93A 2A0AA 5HBSA 1UYOX 2X8TA 1KL3A 4QGWA 3VGWA 2OF8A 1SWUA 4LZVA 2VFBA 1YP7A 4I3CA 1FJ1E 4XMHA 5LKEA 1OPAA 4KCAA 4WBKA 3VG7A 4BX6A 5H9LA 1MUPA 1YWCA 3UAQA 5FQ7E 1ZNHA 1KXOA 3STKA 5HZ9A 1SY0A 3VHIA 2IZLB 1RXKA 1X71A 2FS7A 2MF6A 2BS6A 4Z6JA 1RBPA 2WWPA 1WBIA 2AT0X 2HZQA 5L3YA 4MEEA 1B4MA 2R73A 4GKCA 1UZ2X 4AZQA 1EALA 1L6MA 4IB9A 2PY1A 5D47A 3K3LA 2F01A 4ZHHA 1MM9A 1K24A 4O3YA 4IBAA 3WZQA 1RSUB 4ML7B 4BGFA 1YWAA 1CRBA 4GETA 4EDEA 3BRNA 1STSB 4YKMA 5LKFA 3GAQA 4YDBA 2GTLO 1U17A 1HMRA 2A3FX 2BLGA 2RTGB 5CE4A 3T2XA 1HXZA 4JGLA 4Z28A 3VG3A 4K19A 3O19A 4AZNA 4ZH9A 1VWNB 3P02A 3PH6A 3FA8A 3APVA 3ZW1B 4YFPA 4ID2A 1IW2A 4CPHA 1Y9LA 2OZQA 2QO6A 1LIBA 4BX7A 4DQ3A 1CBIA 1TW4A 4NYRA 4PJ2A 1CBQA 4TJZA 3WYQA 2A5BA 2QM9A 1OPBA 2G7BA
chains in the Genus database with same CATH topology
2VDFA 1K24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDF A;  1K24 A; 
#chains in the Genus database with same CATH topology
 4NP1 A;  5HZ6 A;  2E4J A;  4GGT A;  2X46 A;  2YMS A;  4ARH A;  4COT A;  3C78 X;  1AVG I;  4CV7 A;  3FA7 A;  2RTH B;  1SWA A;  3N91 A;  4OMX A;  1MVG A;  4NV8 A;  4QYP A;  1AB0 A;  5HA1 A;  3UEV A;  1HQQ A;  2ZAI A;  2C1Q A;  1PMP A;  1ZNE A;  1HY2 A;  2AT6 X;  3KFH A;  4YVB A;  1OBU A;  2FGS A;  3TGB A;  3CBC A;  2XKL A;  5K06 A;  1IKJ A;  2L67 A;  1VYF A;  1LIC A;  2KTS A;  1QY2 A;  1SRF A;  4OS0 A;  5H8T A;  5H9A A;  3I17 A;  1LCV A;  1LIF A;  4B55 A;  5B29 A;  2UYW A;  3RDX A;  1HMT A;  1NP1 A;  3PEC A;  4ZGF A;  5JR8 A;  1SWE A;  1JBH A;  1GKA B;  1DF8 A;  1ICM A;  4Z2V A;  4A1Y A;  1G85 A;  1KL4 A;  3T6F A;  2RTC B;  3AKN A;  2OFA A;  1DV9 A;  1N9M A;  4U8U N;  2FR3 A;  4Y0Q A;  4KH8 A;  2W2F A;  2ACP X;  4MVE A;  4NV7 A;  3APW A;  5H9N A;  5L8I A;  3SLJ A;  3WJB A;  4XME A;  5B11 O;  3TGA A;  2KT4 B;  3CKG A;  5D48 A;  1BSY A;  1BSQ A;  2RTR B;  2I5V O;  2OL8 O;  1E02 A;  2Q9S A;  2MM3 A;  5LJD A;  2BSZ A;  3FW4 A;  1A57 A;  1XCA A;  4ZHC A;  1SLE B;  1A18 A;  3P6C A;  2W2B A;  2WEW A;  1SWB A;  4BX5 B;  3NQ9 A;  4ZJ0 A;  3BS2 A;  4XMD A;  1RAV A;  4OKA A;  3TGC A;  4BBO A;  1Y52 X;  1U18 A;  1IFB A;  1GT3 A;  1KQW A;  1BWY A;  4I60 A;  3BY0 A;  2FKG A;  1TXL A;  3WVM A;  1DFV A;  4WFV A;  1LIE A;  1KZX A;  1A2D A;  1G7N A;  4HWM A;  2JU8 A;  2K62 A;  1KGL A;  3VG4 A;  1NC9 A;  1Y9T A;  2JOZ A;  3FR4 A;  3MBT A;  3T1D A;  1NQN A;  2QOM A;  1ZNK A;  2F73 A;  2OL7 A;  1UYN X;  3CWK A;  1NQM A;  2OY8 A;  4IMN A;  2BT9 A;  1SMP I;  1SWC A;  2KTD A;  3EC5 A;  4ORW A;  2HKD A;  5LJE A;  1KOI A;  4TQ2 A;  3VE1 A;  4CDF A;  1LNM A;  2BHV A;  2FT9 A;  2BS5 A;  1BBP A;  1QFT A;  3BSZ E;  4GD9 A;  1JJU A;  2WQA E;  1EXS A;  3PQS A;  4MVI A;  2X8F A;  4GDA A;  3FA9 A;  4NYQ A;  1U0X A;  2M4L A;  4GNW A;  4YBP A;  1MOY A;  4O4U A;  2A8G A;  1ZNG A;  2RTK A;  5FFH A;  4Z2O A;  4ALB A;  2WR6 A;  2DJG A;  1RST B;  1PBY A;  2QMI A;  3IFB A;  2FHL A;  1VWH B;  5DG4 A;  2LFO A;  2RQ0 A;  4XMF A;  2CZU A;  1ADL A;  1B56 A;  1X8P A;  3B2K A;  3BX7 A;  1SRJ A;  2HYS A;  2UZ2 A;  3CR6 A;  2XST A;  2RTL A;  3P24 A;  4ORR A;  5HA0 A;  5IO7 A;  3FA6 A;  3BLG A;  3FEP A;  4JO6 A;  4U3Q A;  4A1H A;  2RTF B;  1O8V A;  2F09 A;  1S2P A;  1DZJ A;  2X34 A;  1Y55 X;  3P6H A;  2AT8 X;  3RBY A;  1LID A;  2WEX A;  4YCH A;  3VHM A;  4HPA A;  1E5P A;  1DZK A;  2X8S A;  3VG2 A;  1QWD A;  2IZB A;  3CKF A;  4U46 A;  5IRU A;  1W6F A;  1EI5 A;  2GC9 A;  3PK2 A;  2Q39 A;  3RDQ A;  4C5P A;  3O22 A;  3VE2 A;  2G5L A;  3WJC A;  4L1N A;  3D97 A;  1GX8 A;  2A2G A;  3ELZ A;  4ODD A;  4O4O A;  1X8Q A;  3SLO A;  4ZHD A;  3NQ3 A;  2RD7 C;  4N7C A;  1JMZ A;  3OD9 A;  1PEE A;  4QGV A;  2RTD B;  3P6E A;  3FYF A;  4GU8 A;  2MHD A;  1T8V A;  1KFF A;  3RE5 A;  4O3Z A;  2OVE A;  2QO5 A;  4MIS A;  2A5C A;  1JMX A;  3D4R A;  4O9S A;  1SLF B;  3ZW1 A;  2ACO A;  2P8G A;  4ZHG A;  4U8U O;  4BOE A;  4OS8 A;  5IRW A;  4I6S A;  5HZ8 A;  1EUO A;  4O3X B;  4ZH6 A;  3WYP A;  4WHI A;  1T0V A;  3MM0 A;  1YWD A;  2AT5 X;  1VWM B;  2L9C A;  4JNJ A;  2VDF A;  4TLJ A;  1VWF B;  2JU7 A;  3NR3 A;  2NNQ A;  4RUU A;  1I04 A;  2OF9 A;  2X55 A;  3NPO A;  4ORY A;  3RKG A;  1PBO A;  2NP1 A;  4QQ1 A;  1SXW A;  2FLJ A;  2MJI A;  1SWK A;  4YGG A;  1SRE A;  2OYB O;  4EFG A;  5BVQ A;  5DPQ A;  1KT6 A;  3RY2 A;  3B2J A;  3BU9 A;  3OJY C;  3FMZ A;  3FW5 A;  4ZCB A;  2NND A;  1SWQ A;  3ZQ3 A;  4I3B A;  1LDO A;  1KT3 A;  1SWP A;  1OBQ A;  2JW1 A;  5HZQ A;  3O2Y A;  5LJC A;  1IJ8 A;  1LKE A;  4BX6 B;  3B2I A;  1T68 X;  3DTQ A;  5EED A;  1BRQ A;  1RLB E;  3EW1 A;  4ORS A;  1JJX A;  2IZD B;  3NBX X;  1LFO A;  5B5G A;  1JYJ A;  4ZGU A;  4QRL A;  1EIO A;  2X56 A;  4ORX A;  4MIR A;  1EPA A;  1MDC A;  2RTO B;  4UU3 A;  4Y5D A;  2EU7 X;  2IZH B;  3ZUI A;  4R0B A;  4IB8 A;  4O3W A;  5HCE C;  2CM4 A;  4ZHF A;  4YH0 A;  2IZC B;  3TF6 A;  3NAD A;  1W5R A;  2X4M A;  1YWB A;  3TZS A;  4GNY A;  5HTE A;  5F6Z A;  5EZ2 A;  2OVA A;  5LJG A;  1HXL A;  3KVN A;  1ALB A;  2OFM X;  4HPC A;  3SZJ A;  2HMB A;  4QZU A;  5CYB A;  3AKM A;  5F1E A;  2HZR A;  2IZA A;  3CMP A;  4TKJ A;  1BJ7 A;  1OSP O;  3VG5 A;  1NBX A;  4M6S A;  1SWD A;  1DZP A;  1YIV A;  2OFB A;  1HBQ A;  5B5F A;  4CK4 A;  5L8N A;  4ORU A;  1S7D A;  2C1S A;  2WUT A;  1CJ5 A;  1D3S A;  2I5Z O;  4ON1 A;  4CPH B;  2ZSC A;  3F6Z B;  1LPJ A;  3FR5 A;  2HLV A;  4GJS A;  4BX7 B;  1ERB A;  4GJV A;  5B3M O;  3MX7 A;  2ASN X;  1SWO A;  1HQP A;  4O4X A;  4KII A;  4RUN A;  2KW1 A;  3ZW0 A;  5D45 A;  2JGS A;  2RTM A;  1ML7 A;  3EYC A;  3QQ2 A;  2RTB B;  3LTW A;  4YGH A;  1I78 A;  3VPJ E;  5KHP A;  1X8O A;  3F9D A;  2JMB A;  1B0O A;  1QG5 A;  1K3B A;  4ALO A;  1LCZ A;  2AF5 A;  2HNX A;  1TVQ A;  2RTP B;  1QY0 A;  3L4R A;  3RDS A;  1RXJ A;  2RTA A;  5D8J A;  1FEN A;  4A60 A;  1SWG A;  3HTY A;  4D6B A;  1OEJ A;  4YFQ A;  5LJK A;  1QY1 A;  4Y0P A;  3HWF A;  1VWE B;  4ZR2 A;  3WJF A;  2WSJ A;  2VFC A;  3KZA A;  3B2H A;  2Y3E A;  5D4A A;  2KD2 A;  5BVT A;  2AT3 X;  3RE6 A;  2QCB A;  4TNN A;  2Y3F A;  1N4J A;  1X8N A;  3FID A;  3MG5 A;  1SWT A;  3AUM O;  4IMO A;  4QYN A;  3WJE A;  5HCC C;  2LB6 A;  2LBA A;  4YCE A;  3U0D A;  1AQB A;  4EQA C;  3VU1 A;  1HMS A;  1NGL A;  5KIC A;  2LKK A;  3C76 X;  1VYG A;  3UEW A;  2Z4I A;  3FEL A;  1G74 A;  2GJ5 A;  2RTJ A;  1GT4 A;  4YBU A;  2OFR X;  2X32 A;  3SZH A;  1SRG A;  4CPF A;  4CSB A;  4ZFX A;  5AEO A;  1VWA B;  2OL6 O;  3PQU A;  4ES7 A;  1SRH A;  3JQO A;  2JU3 A;  1DZM A;  2A2U A;  1ICN A;  3JSQ A;  3FLL A;  1GT5 A;  2QOS C;  3F8A A;  4GUZ A;  3E3C A;  5B27 A;  1N9Y A;  2FWV A;  1QFV A;  5F7G A;  3WOV A;  1SWN A;  1LF7 A;  4I3D A;  2JN3 A;  5H9K A;  2IZF B;  2IZG B;  4YFR A;  3WJG A;  3AEH A;  4TKH A;  3NX1 A;  3KFG A;  3SZI A;  3EMM A;  1G5W A;  1ZNL A;  1VWB B;  3HWE A;  3HPE A;  2PI3 O;  4JHQ A;  5FQ8 E;  1GT1 A;  3S60 A;  3STM X;  2R56 A;  1A3Y A;  1VWG B;  3BDR A;  5K68 A;  2ZAG A;  1VWJ B;  1VWQ B;  1OBP A;  1PM1 X;  1SLD B;  2DJF A;  3EBK A;  4YMY A;  2IZI A;  3EM0 A;  4PSQ A;  4XMG A;  4FBV A;  4AZM A;  1KT7 A;  3U9P C;  4GH7 A;  2ALL X;  3HOE A;  3WZO A;  1WUB A;  2RCQ A;  1VWP B;  3UEU A;  1MX7 A;  2YG2 A;  1IKE A;  1BLR A;  5F58 A;  3CQR A;  3PED A;  1CBS A;  1TOU A;  3EBW A;  1SLG B;  4LQZ A;  4OEM A;  1HBP A;  1QAB E;  1VWK B;  3HWG A;  4IB7 A;  4NLI A;  4O49 A;  1S44 A;  1FDQ A;  4YGZ A;  3WJD A;  4AZP A;  3SAO A;  2BC3 A;  2Q2M A;  1KT4 A;  2RN4 A;  1VYO A;  4NNT A;  4QZT A;  1X89 A;  2O62 A;  1VWC B;  4I9R A;  3PPT A;  1GGL A;  3SOT A;  1MEP A;  1JIW I;  4AZR A;  5FAZ A;  3WZP A;  4CDC A;  1HN2 A;  4EXZ A;  2AVI A;  2Q2P A;  5LJB A;  4QGX A;  2FTB A;  3ZWE A;  3RSW A;  3WBG A;  1N43 A;  4HPD A;  1P6P A;  4CPI A;  3HK1 A;  2NNE A;  1ACD A;  1KT5 A;  2W2A A;  4INN A;  3RY1 A;  5AJC A;  4AYH A;  1I4U A;  3P6G A;  4Y0S A;  3APU A;  5HWZ A;  1FEL A;  2CM9 A;  1EQD A;  2Y32 A;  3BX8 A;  3CBS A;  3GE2 A;  5EDB A;  4M7M A;  2CZT A;  2ANS A;  1R0U A;  2FKJ A;  3WXQ A;  4D6A A;  1SWH A;  3U03 A;  1GKA A;  1IFC A;  4BVM A;  3CQN A;  1JQP A;  2RA6 A;  5K67 A;  1EW3 A;  4IAX A;  1I9H A;  2OY7 A;  4L3R A;  4N7D A;  4EKV A;  3KQ0 A;  4KC7 A;  4MVL A;  1JJJ A;  1SWL A;  1I06 A;  3LV4 A;  2OVS A;  1VWL B;  3LHN A;  1AEL A;  1Y53 X;  3P6D A;  2G8C O;  1SXU A;  4OEL A;  1GM6 A;  2GTF X;  4EEJ A;  5HTD A;  3PDF A;  3T6L A;  1YUP A;  3KFF A;  1STP A;  2IZK A;  3BU1 A;  4I9S A;  1SA8 A;  4LZU A;  1VWD B;  4UU2 A;  5JD2 A;  2G78 A;  3D9W A;  1KZW A;  4KT5 A;  5HCD C;  1OEK A;  4IRW A;  4OS3 A;  4Y59 A;  2QO4 A;  4AW8 A;  1RXH A;  1STR B;  4Z27 A;  1KQX A;  3ZUO A;  3RDM A;  4BX5 A;  1DC9 A;  1SWF A;  1VWR B;  3HWD A;  3SLT A;  1AVD A;  1KL5 A;  3OBL A;  2IZE B;  3G7X A;  1SXY A;  3Q6L A;  4LKT A;  1SWS A;  3D96 A;  4GK9 A;  3T2W A;  4QNI A;  3D95 A;  2CBR A;  4HFO A;  5AJB A;  3DSZ A;  3OE3 A;  3FR2 A;  2AL0 X;  1D2U A;  1SXX A;  3MVF A;  1TOW A;  1SY2 A;  2X45 A;  3ZZV A;  5BVS A;  1QQS A;  5CHK A;  4QAE A;  1VWO B;  5IO6 A;  2WPU A;  4NW4 A;  5B2A O;  2MO5 A;  1O1U A;  1SY3 A;  3STN A;  4NLJ A;  3KFI A;  5EDC A;  1FEM A;  1AVE A;  4XMC A;  3RDU A;  4A8Z A;  2G79 A;  4OMW A;  3Q34 A;  3NQK A;  1SRI A;  1SWR A;  2MWH A;  5IO5 A;  5L8O A;  3RWX A;  2OY1 O;  2WQ9 A;  5BYP A;  1GX3 A;  4FBO A;  4GDZ A;  2LBV A;  1JYD A;  3P6F A;  1E06 A;  1BM5 A;  1BEB A;  3I0A A;  4O4S A;  4IB6 A;  4TKB A;  1MX8 A;  4BCS A;  5HAE A;  2GTL N;  3H3I A;  4CPE A;  3B2L A;  1JZU A;  3C77 X;  4AZO A;  3QKG A;  1OEE A;  4DQ4 A;  1O1V A;  2RTI B;  4YDA A;  2AMM X;  3FEK A;  3VHH A;  3IA8 A;  4KC8 A;  2FRS A;  2CAM A;  1GXA A;  3FIQ A;  1CBR A;  5AQ6 A;  2AH7 X;  3V8U A;  3PP6 A;  2FS6 A;  3X00 A;  1YP6 A;  4IAB A;  1VPR A;  1N0S A;  1EPB A;  4IAW A;  5FQ6 E;  4DNE A;  2LA7 A;  5CSE A;  4MVK A;  2L5P A;  2L68 A;  1LDQ A;  2R74 A;  1FE3 A;  5C0N A;  1E00 A;  1FTP A;  3S5V A;  5FEN A;  1LEL A;  2Q4N A;  2FR2 A;  2RTQ B;  1SY1 A;  4WFU A;  4FBR A;  4FQB B;  2GH7 A;  4FGI B;  3VG6 A;  2Z4H A;  3ZW2 A;  2A13 A;  3NP1 A;  4Y0R A;  3FDC A;  3UEX A;  1MK5 A;  1JV4 A;  2IFB A;  2RTN B;  3RDO A;  3ZW0 B;  5IXG A;  5KID A;  1B8E A;  1ZND A;  3S5X A;  4BQU A;  4DCB A;  1E2T A;  4GRJ A;  4I95 A;  5B10 O;  1I05 A;  1PTS A;  2FHN X;  4CDD A;  1GX9 A;  2C4I A;  1H91 A;  1W4T A;  2IZJ A;  2OVD A;  4HPB A;  4U9C A;  1BRP A;  1ZRY A;  1Y0G A;  3NX2 A;  1IIU A;  1LUQ A;  3ELX A;  3FEN A;  4GGZ A;  3JS1 A;  4YKO A;  2OY5 O;  2DM5 A;  4BJ8 A;  4CDE A;  2RCT A;  3HOL A;  2K23 A;  2AKQ A;  1EII A;  1SWJ A;  1X8U A;  4LKP A;  1BSO A;  1NP4 A;  1N7Y A;  5LJH A;  4GE1 A;  1ERX A;  1NDJ A;  4GZV A;  5F6B A;  4GGR A;  4U8U M;  3RZY A;  3ZI8 A;  2CBS A;  5EPQ A;  1URE A;  1Z24 A;  3APX A;  4Z2P A;  4NNS A;  1DF3 A;  1VWI B;  5HZ5 A;  5IRA A;  3S26 A;  5EEE A;  3WZN A;  2GTL M;  2POA A;  1LCW A;  5F2B A;  2RTE B;  3EW2 A;  3PH5 A;  1XKI A;  2N93 A;  2A0A A;  5HBS A;  1UYO X;  2X8T A;  1KL3 A;  4QGW A;  3VGW A;  2OF8 A;  1SWU A;  4LZV A;  2VFB A;  1YP7 A;  4I3C A;  1FJ1 E;  4XMH A;  5LKE A;  1OPA A;  4KCA A;  4WBK A;  3VG7 A;  4BX6 A;  5H9L A;  1MUP A;  1YWC A;  3UAQ A;  5FQ7 E;  1ZNH A;  1KXO A;  3STK A;  5HZ9 A;  1SY0 A;  3VHI A;  2IZL B;  1RXK A;  1X71 A;  2FS7 A;  2MF6 A;  2BS6 A;  4Z6J A;  1RBP A;  2WWP A;  1WBI A;  2AT0 X;  2HZQ A;  5L3Y A;  4MEE A;  1B4M A;  2R73 A;  4GKC A;  1UZ2 X;  4AZQ A;  1EAL A;  1L6M A;  4IB9 A;  2PY1 A;  5D47 A;  3K3L A;  2F01 A;  4ZHH A;  1MM9 A;  1K24 A;  4O3Y A;  4IBA A;  3WZQ A;  1RSU B;  4ML7 B;  4BGF A;  1YWA A;  1CRB A;  4GET A;  4EDE A;  3BRN A;  1STS B;  4YKM A;  5LKF A;  3GAQ A;  4YDB A;  2GTL O;  1U17 A;  1HMR A;  2A3F X;  2BLG A;  2RTG B;  5CE4 A;  3T2X A;  1HXZ A;  4JGL A;  4Z28 A;  3VG3 A;  4K19 A;  3O19 A;  4AZN A;  4ZH9 A;  1VWN B;  3P02 A;  3PH6 A;  3FA8 A;  3APV A;  3ZW1 B;  4YFP A;  4ID2 A;  1IW2 A;  4CPH A;  1Y9L A;  2OZQ A;  2QO6 A;  1LIB A;  4BX7 A;  4DQ3 A;  1CBI A;  1TW4 A;  4NYR A;  4PJ2 A;  1CBQ A;  4TJZ A;  3WYQ A;  2A5B A;  2QM9 A;  1OPB A;  2G7B A; 
#chains in the Genus database with same CATH homology
 2VDF A;  1K24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...