4INNA

Protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
b'TVELPGIYQTQEFLYMKSSFVEFFEHNGKFYAYGISDVDGSKAKKDKLNPNPKLRNRSDKGVVFLSDLIKVGKRSYKGGKAYNFYDGKTYYVRVAQNSNGDLEFTSSYDKWGYMGKTFTWKRLSDEEIKNLKLKRFNLDEVLKTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HP1028
publication title Protein HP1028 from the human pathogen Helicobacter pylori belongs to the lipocalin family.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transport protein
total genus 38
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09917 DUF2147 Uncharacterized protein conserved in bacteria (DUF2147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.520 Mainly Beta Beta Barrel Lipocalin Lipocalin 4innA00
4INNA
chains in the Genus database with same CATH superfamily
2KW1A 3TGCA 4IMOA 2RTJA 1S44A 4CDEA 4EQAC 1Y53X 2CZUA 2RTOB 2R74A 1N7YA 1N9MA 4R0BA 2A13A 4YDBA 2F73A 4A60A 1KT4A 1VWEB 3BX8A 3FW5A 2MO5A 3NQ3A 5EEEA 4YGHA 1KL5A 3D95A 1EPAA 1Y9LA 2EU7X 1MVGA 1QY2A 1Y55X 4O4XA 5HWZA 1LPJA 2X8TA 4GDAA 4Z2PA 1RBPA 1JJXA 1MDCA 1SRGA 1VWIB 1GT4A 1PMPA 3BSZE 4I9RA 2POAA 4Z2VA 4ES7A 5EDBA 1EIOA 2AT6X 4GD9A 3EW1A 2KD2A 1HQQA 3VGWA 3IA8A 2Y3FA 1EUOA 4AZMA 2NNQA 2P8GA 1OSPO 1B8EA 4TQ2A 3BDRA 3NPOA 4GZVA 3B2HA 3WJEA 5BVTA 2BS5A 3TGBA 2RA6A 4NNSA 3TGAA 4Z2OA 3NBXX 5FFHA 2IZIA 1K24A 4BX7B 1RXJA 3CBSA 1LUQA 4LKPA 1FENA 2E4JA 3ZWEA 3KFGA 3NP1A 5FENA 3P6FA 1AVEA 4GE1A 1LNMA 5HZ5A 2IZLB 3F6ZB 4NV8A 1BRQA 1DZMA 3ZI8A 1BRPA 2X46A 3GAQA 2IZGB 3PDFA 1VWQB 1RXHA 4OMWA 1VWCB 3RDSA 1LIEA 1RXKA 1VYOA 4OS8A 4ALBA 1X8OA 3RE6A 1NDJA 1G74A 4WHIA 2GTLO 2UZ2A 3RY2A 4ML7B 4YGZA 1SLFB 4ORSA 3WZQA 3CKGA 4MVLA 4ORYA 2PY1A 4OMXA 4PSQA 1T0VA 2RTIB 1EW3A 2RTGB 2UYWA 3FDCA 1AVDA 3MVFA 1BSQA 2QO6A 5IO5A 1X8UA 5F7GA 5B27A 3ZW0A 1ACDA 2YG2A 4OKAA 4COTA 5HZ9A 1LDQA 1VWDB 1Y9TA 3BS2A 1GX9A 2JW1A 4QGVA 4L3RA 2Z4IA 3WZNA 3T6LA 4UU2A 1SA8A 2IFBA 3RE5A 1JIWI 1B56A 3CKFA 1N9YA 2OFMX 5FQ7E 4GDZA 2CAMA 4FBRA 5K67A 1O8VA 2MHDA 5D48A 1CBIA 2KTDA 1IJ8A 3KQ0A 3AKMA 1HMSA 4KCAA 5LJCA 4QNIA 1SWOA 1K3BA 1A18A 1SXYA 5HZ6A 1ALBA 5HA1A 1MOYA 2OF8A 2RTLA 2IZDB 2PI3O 3NR3A 4GRJA 4MVIA 5H9NA 2LBVA 3WBGA 2OL8O 1OBPA 2X55A 1L6MA 1I06A 1YWCA 4ZFXA 5AJBA 2MJIA 1S2PA 1FE3A 1QFVA 2GH7A 1N43A 1VYFA 4O4SA 5B10O 5HAEA 4D6BA 1OBUA 3EBWA 1ZNGA 1U18A 1OEEA 1S7DA 2AL0X 2LFOA 3EBKA 3NX2A 5F6BA 1KT6A 3I17A 5HA0A 1AELA 5LJGA 1EALA 4Y5DA 5CHKA 1X8PA 3APXA 5AJCA 4CPHB 3D96A 3OJYC 3AUMO 4LZUA 3WZOA 2CZTA 4IBAA 3OE3A 3KFIA 1VWKB 1CBSA 3WJCA 1PBYA 4GNYA 3VG7A 2A8GA 4NLIA 1JJUA 4QGXA 5JD2A 2ALLX 5L3YA 3FLLA 1OPBA 3FIQA 1SY2A 1YP7A 4U8UO 1VWHB 1DZPA 3P6DA 1XCAA 2JOZA 3MBTA 3WYPA 1I9HA 2HNXA 2AT5X 2IZEB 3FYFA 4EDEA 4NP1A 4ZHDA 1GM6A 2OY7A 1N0SA 1SY1A 5K06A 1HMRA 3VHHA 3DTQA 3IFBA 1D3SA 4GGRA 2MF6A 1NQNA 4RUNA 3WJBA 1XKIA 4IAXA 2L9CA 1MUPA 5BVSA 4RUUA 5HCEC 1BJ7A 1SWJA 4BOEA 3CMPA 5DG4A 2RTCB 3PH5A 2WEWA 3EMMA 1VWRB 2I5ZO 2KT4B 2W2AA 3VG3A 2RTKA 4NW4A 2ZAIA 2RTEB 4WFUA 4BJ8A 1ICNA 1IW2A 1CBRA 4ZCBA 3B2LA 3VE1A 1MK5A 1HQPA 4GGZA 2IZFB 5L8IA 2LKKA 2KTSA 1RSTB 2GTLN 4GK9A 3PK2A 3QKGA 4LQZA 4ZHGA 4ORRA 5FAZA 1LIFA 5H9AA 2FTBA 2A3FX 2W2FA 4OELA 1EQDA 1LFOA 4ODDA 5DPQA 1KL4A 1IFCA 1KQXA 5D4AA 5IRAA 1HY2A 5HCCC 1SWHA 4Y0QA 1G5WA 3SOTA 4YBPA 4HFOA 4KC8A 2HKDA 2IZCB 3APVA 3S5VA 4ARHA 3S5XA 1CRBA 2Y32A 3EC5A 4ZGFA 3P6EA 2FWVA 1PM1X 3TF6A 1SY3A 4FBVA 3K3LA 4BX7A 1ZNHA 2OZQA 2Y3EA 4WBKA 3SLTA 2AT3X 4BX6A 1LCZA 3WJDA 3X00A 4I6SA 1X89A 3P24A 3OD9A 4I3DA 4KT5A 5F6ZA 4B55A 1YIVA 1SWDA 1ZNEA 1NC9A 4XMEA 5LKEA 2AMMX 4CPFA 4DQ3A 1NP1A 3APWA 1FJ1E 3B2JA 3P6GA 4TKBA 1EIIA 1BSYA 4CDCA 1VWFB 1NP4A 1VWOB 2FT9A 2WR6A 2WUTA 4WFVA 5FQ8E 4BX6B 1N4JA 3MX7A 1LKEA 5B5GA 2IZBA 4Y0SA 3FEPA 1GKAB 1IIUA 1JYDA 2JU8A 5H9KA 4YVBA 2FS7A 1TOWA 3HWDA 3HK1A 1DFVA 1IFBA 3RSWA 2L68A 4XMHA 1HXLA 3VG6A 2XSTA 1GXAA 1SREA 1STPA 4UU3A 1SWCA 3LHNA 1SWQA 2A0AA 4OS3A 2WQ9A 1SWUA 4CDDA 4K19A 1QFTA 4DNEA 1UREA 2OFBA 4MVEA 3S26A 1LF7A 4HPBA 2LBAA 2N93A 2OL7A 2FKJA 1T68X 2NP1A 3HTYA 2FRSA 3QQ2A 2IZHB 2K23A 2AT0X 3PEDA 1I05A 3FENA 1SXUA 5HZQA 3RDOA 4ZHCA 2BC3A 1SLDB 3VG5A 4IB8A 2X8FA 3UEUA 3CR6A 5IO7A 2Q2MA 2BHVA 2RCTA 2HLVA 3O2YA 4U8UN 1QABE 1LCVA 2HZRA 4I3CA 4MVKA 3UEVA 4BCSA 2C1QA 1HBPA 1DZJA 1STRB 4I9SA 4MIRA 4AZPA 1X71A 4GETA 4O3WA 4BQUA 4ZHHA 5CSEA 1HBQA 4A1HA 1ML7A 1VWGB 3SAOA 1GX8A 3FIDA 4TJZA 3NQ9A 2AF5A 4GU8A 1VWNB 1SY0A 1P6PA 1SWTA 2JN3A 2RD7C 4GGTA 3G7XA 1RAVA 4IB6A 4N7CA 3KVNA 4YBUA 4YMYA 2DJGA 1OEJA 1TXLA 2RQ0A 2RTMA 2AT8X 4XMDA 1LIDA 5L8NA 1STSB 1PBOA 2W2BA 4JO6A 4CPHA 5IRWA 3C78X 2G8CO 5IO6A 3U0DA 5EEDA 1JZUA 1QG5A 4M6SA 4O3ZA 4CV7A 1SMPI 1BBPA 4OS0A 1IKEA 2OVDA 3EYCA 3PP6A 1I4UA 4O4OA 4XMGA 2F01A 1YUPA 4U9CA 4NV7A 3CBCA 4PJ2A 2Q39A 1SXWA 3JSQA 3PECA 3CQNA 4AZNA 4BVMA 4HPCA 3UEWA 2RTNB 1HN2A 3D97A 1SWEA 3FR4A 4QYPA 1TVQA 1YWDA 4LKTA 4MEEA 3SZHA 4YFRA 4QAEA 3SLJA 1FTPA 1UZ2X 3AEHA 3SZIA 1Y0GA 2ZAGA 4INNA 2WQAE 5AEOA 1BM5A 1EXSA 4ORWA 1W6FA 4ZR2A 3VG2A 4U3QA 2FS6A 3PQUA 4Y0RA 2A2GA 4QGWA 5IXGA 2FLJA 4Y59A 2I5VO 5KHPA 4ZGUA 2Q9SA 4AYHA 4D6AA 3LTWA 1D2UA 3SLOA 4BBOA 1I04A 2VFBA 2CBSA 3D4RA 4TKJA 3T1DA 1SWPA 1T8VA 2WWPA 1KXOA 1HMTA 1O1UA 1RLBE 2OF9A 1MX7A 3WJFA 2FHNX 3RDQA 1CBQA 2C1SA 3PH6A 3ZW1A 1PTSA 3FW4A 3PQSA 2AH7X 4CPIA 3I0AA 5EPQA 1BEBA 1GT1A 1JMZA 4HWMA 2WPUA 1SRJA 3RY1A 3RZYA 1DV9A 3HWGA 5KIDA 1JV4A 3WZPA 1JYJA 2RTDB 4YFPA 2QMIA 3NQKA 2K62A 3Q34A 1X8NA 3JS1A 3EW2A 2RCQA 4HPAA 4I3BA 4N7DA 4CPEA 5LKFA 1AB0A 1SWGA 1KZXA 1SRFA 2VFCA 4HPDA 2ACOA 5B11O 2GJ5A 4ORXA 2XKLA 4QZUA 1G7NA 4O3YA 4GJSA 3ZW1B 3ZZVA 3DSZA 3KFHA 1KGLA 1A2DA 4IRWA 4IMNA 1SWAA 2RTBB 2X45A 2JU3A 4EFGA 3V8UA 1X8QA 3RDXA 1E5PA 4QRLA 1VWAB 1GT5A 4NNTA 1NQMA 1ZRYA 3F8AA 1AVGI 4GNWA 4Z28A 2RTFB 5EZ2A 3UEXA 1EPBA 4ZH6A 2X34A 2OY5O 3RBYA 2ASNX 2GTLM 1UYOX 3RKGA 1ERXA 2HMBA 4ZHFA 3L4RA 5LJHA 4AW8A 1KOIA 1E00A 1QY1A 2X4MA 3FA6A 3LV4A 3NADA 5D8JA 2MM3A 2QO4A 3FR5A 2QM9A 2X32A 3HOLA 5L8OA 3FMZA 3BU1A 1GKAA 2IZJA 1KZWA 2CM9A 4OEMA 1MM9A 2DM5A 3MG5A 4QYNA 3APUA 3SZJA 1KT3A 2CBRA 2ACPX 2QOMA 4BX5B 4C5PA 5LJEA 1LDOA 5K68A 1WBIA 4LZVA 3BRNA 1KQWA 3VHIA 4EKVA 1KFFA 4TNNA 2HYSA 3BLGA 4IB7A 1H91A 4GUZA 5H8TA 3TZSA 4U46A 3EM0A 2F09A 5B2AO 5FQ6E 2ZSCA 4O9SA 3ZUIA 2QO5A 1SWLA 2NNEA 2Q4NA 3ELXA 3WYQA 1W4TA 1SLEB 4FQBB 4JHQA 4CK4A 4DQ4A 4ZH9A 1DZKA 4O49A 1UYNX 1LIBA 2AKQA 4DCBA 5F58A 1YWBA 3Q6LA 3JQOA 3GE2A 4QZTA 3STKA 2G7BA 3C76X 3KZAA 2OY1O 4IAWA 2M4LA 4TKHA 3T2WA 3HOEA 3WOVA 2OVEA 1SWRA 3WXQA 2CM4A 1W5RA 3ZW2A 4NYRA 2O62A 3BY0A 3P6HA 4TLJA 2BSZA 5KICA 3RWXA 1Z24A 4YKMA 4MISA 4YH0A 3T2XA 5LJBA 5LJDA 3WJGA 4GH7A 5B3MO 3E3CA 5BVQA 1NGLA 4O3XB 2X8SA 4AZQA 1E2TA 4IB9A 2RTAA 1NBXA 1TW4A 2R73A 1AQBA 1OEKA 4O4UA 3H3IA 5BYPA 3D9WA 1FEMA 1VWPB 2MWHA 4NLJA 4KH8A 4ALOA 2FR2A 1VWMB 4ORUA 3NX1A 2QOSC 3O22A 3C77X 4I60A 3U03A 1Y52X 4ZJ0A 4QQ1A 1QY0A 1KL3A 4XMCA 1OPAA 2OVAA 1BLRA 4I95A 1JMXA 2A5BA 1U17A 2HZQA 1SRIA 3PPTA 3VHMA 1ICMA 1QQSA 3P02A 1ZNDA 4IABA 1MX8A 5B5FA 3P6CA 1MEPA 5C0NA 5HTDA 5JR8A 5HTEA 1PEEA 2OY8A 5B29A 4FGIB 4U8UM 1VPRA 3FA7A 3CQRA 1FDQA 1FELA 2ANSA 3HWEA 4L1NA 3KFFA 4YCEA 1SWNA 4KIIA 1LCWA 3MM0A 2A5CA 1DF8A 1ERBA 4ID2A 2RN4A 1IKJA 2FKGA 4AZOA 1GT3A 4ON1A 1BSOA 3B2KA 5IRUA 3RDUA 1U0XA 3HPEA 3UAQA 1SLGB 4EXZA 2BT9A 2X56A 3ZW0B 4M7MA 3HWFA 2L5PA 1RSUB 2JMBA 4AZRA 2OYBO 3FA8A 1VWLB 5H9LA 1JBHA 5HBSA 1JQPA 2WSJA 2GC9A 4GJVA 1R0UA 4Z27A 2AVIA 3FA9A 5CE4A 4CSBA 1I78A 3VE2A 1JJJA 4EEJA 1A3YA 1LELA 2RTPB 1SWBA 2WEXA 2LA7A 3S60A 2A2UA 3AKNA 1ZNKA 4FBOA 4NYQA 2IZKA 2FR3A 1SRHA 1E06A 1TOUA 3FR2A 3WVMA 5D47A 1SWFA 1EI5A 2G79A 2RTRB 3ZQ3A 2YMSA 2GTFX 1YWAA 3F9DA 2LB6A 2RTQB 4GKCA 5AQ6A 1SXXA 4CDFA 4A1YA 5CYBA 1SWSA 1HXZA 3CWKA 2OL6O 1B0OA 3STMX 3OBLA 5D45A 4Z6JA 5HCDC 4BGFA 2QCBA 4JNJA 2FGSA 3T6FA 1DF3A 2NNDA 1VWBB 1VWJB 2JGSA 3BU9A 3RDMA 4KC7A 3B2IA 5EDCA 5F1EA 1BWYA 3ELZA 2Z4HA 2G78A 2RTHB 1OBQA 2VDFA 1QWDA 4YFQA 3U9PC 2JU7A 4A8ZA 2L67A 2C4IA 3N91A 4XMFA 4YDAA 4YKOA 3ZUOA 1B4MA 2DJFA 1YP6A 2BLGA 3FEKA 4YCHA 2G5LA 1G85A 2OVSA 3O19A 5HZ8A 2R56A 1GGLA 3BX7A 3VPJE 1WUBA 1O1VA 2OFAA 2OFRX 5F2BA 3VU1A 5LJKA 2IZAA 4YGGA 1E02A 2FHLA 4Y0PA 1CJ5A 1A57A 1KT7A 3STNA 1LICA 4BX5A 3FELA 1ZNLA 2BS6A 3VG4A 1DC9A 1ADLA 1SWKA 2Q2PA 4JGLA 1VYGA 1GX3A 1KT5A
chains in the Genus database with same CATH topology
2KW1A 3TGCA 4IMOA 1S44A 4EQAC 2CZUA 4R0BA 2R74A 4YDBA 4A60A 2A13A 2F73A 1KT4A 3BX8A 3NQ3A 3FW5A 2MO5A 5EEEA 4YGHA 3D95A 1EPAA 1Y9LA 2EU7X 1MVGA 1QY2A 4O4XA 5HWZA 1LPJA 2X8TA 1RBPA 1JJXA 1MDCA 1GT4A 1PMPA 3BSZE 4I9RA 2POAA 4ES7A 5EDBA 1EIOA 2AT6X 2KD2A 3IA8A 1EUOA 4AZMA 2NNQA 2P8GA 1B8EA 4TQ2A 3BDRA 3NPOA 4GZVA 3B2HA 3WJEA 5BVTA 2BS5A 3TGBA 2RA6A 4NNSA 3TGAA 3NBXX 5FFHA 3CBSA 4LKPA 1FENA 2E4JA 3ZWEA 3KFGA 3NP1A 5FENA 3P6FA 4GE1A 1LNMA 5HZ5A 3F6ZB 1BRQA 1DZMA 3ZI8A 1BRPA 2X46A 3GAQA 4OMWA 1LIEA 4OS8A 4ALBA 1X8OA 1G74A 4WHIA 2GTLO 4ML7B 4YGZA 4ORSA 4MVLA 4ORYA 2PY1A 4OMXA 4PSQA 1T0VA 1EW3A 3MVFA 1BSQA 2QO6A 5IO5A 1X8UA 5F7GA 5B27A 3ZW0A 1ACDA 2YG2A 5HZ9A 4COTA 1Y9TA 3BS2A 1GX9A 2JW1A 4QGVA 4L3RA 2Z4IA 4UU2A 1SA8A 2IFBA 1JIWI 1B56A 5FQ7E 2OFMX 4FBRA 4GDZA 1O8VA 2MHDA 5D48A 1CBIA 2KTDA 3KQ0A 3AKMA 1HMSA 4KCAA 5LJCA 4QNIA 1A18A 1SXYA 5HZ6A 1ALBA 5HA1A 5H9NA 3NR3A 4GRJA 4MVIA 2LBVA 3WBGA 1OBPA 1L6MA 1I06A 1YWCA 4ZFXA 5AJBA 2MJIA 1S2PA 1FE3A 1QFVA 1VYFA 4O4SA 5HAEA 4D6BA 1OBUA 3EBWA 1ZNGA 1U18A 1OEEA 1S7DA 2AL0X 2LFOA 3EBKA 3NX2A 5F6BA 1KT6A 3I17A 5HA0A 1AELA 5LJGA 1EALA 1X8PA 3APXA 5AJCA 3D96A 3OJYC 4LZUA 2CZTA 4IBAA 3OE3A 3KFIA 3WJCA 1CBSA 4GNYA 3VG7A 4NLIA 4QGXA 2ALLX 3FLLA 1OPBA 3FIQA 1SY2A 1YP7A 4U8UO 1DZPA 3P6DA 1XCAA 2JOZA 3MBTA 2HNXA 2AT5X 3FYFA 4EDEA 4NP1A 4ZHDA 1GM6A 1N0SA 1SY1A 5K06A 1HMRA 3DTQA 3IFBA 1D3SA 4RUNA 3WJBA 1XKIA 4IAXA 2L9CA 1MUPA 5BVSA 4RUUA 5HCEC 1BJ7A 4BOEA 3CMPA 5DG4A 3PH5A 2WEWA 3EMMA 2KT4B 2W2AA 3VG3A 4NW4A 2ZAIA 4WFUA 1ICNA 1IW2A 1CBRA 4ZCBA 3B2LA 3VE1A 1HQPA 5L8IA 2LKKA 2KTSA 2GTLN 4GK9A 4ZHGA 3QKGA 4LQZA 4ORRA 5FAZA 1LIFA 5H9AA 2FTBA 2A3FX 2W2FA 1EQDA 1LFOA 4ODDA 5DPQA 1IFCA 1KQXA 5D4AA 5HCCC 4Y0QA 1G5WA 3SOTA 4YBPA 4HFOA 4KC8A 3S5VA 3APVA 4ARHA 3S5XA 1CRBA 4ZGFA 3P6EA 2FWVA 1PM1X 3TF6A 1SY3A 4FBVA 3K3LA 1ZNHA 2OZQA 4WBKA 2AT3X 3WJDA 4I6SA 1X89A 3P24A 3OD9A 4I3DA 4KT5A 5F6ZA 1YIVA 1ZNEA 4XMEA 5LKEA 2AMMX 4DQ3A 1NP1A 3APWA 3P6GA 3B2JA 4TKBA 1EIIA 1BSYA 2WR6A 1NP4A 2FT9A 2WUTA 4WFVA 5FQ8E 3MX7A 1LKEA 4Y0SA 3FEPA 1GKAB 1IIUA 1JYDA 2JU8A 5H9KA 2FS7A 1TOWA 3HWDA 3HK1A 1DFVA 1IFBA 3RSWA 2L68A 4XMHA 3VG6A 2XSTA 1GXAA 4UU3A 3LHNA 2A0AA 4OS3A 2WQ9A 4K19A 1QFTA 1UREA 4MVEA 3S26A 1LF7A 4HPBA 2LBAA 2N93A 1T68X 2NP1A 3HTYA 2FRSA 2K23A 2AT0X 3PEDA 1I05A 3FENA 1SXUA 5HZQA 4ZHCA 3VG5A 4IB8A 2X8FA 3UEUA 3CR6A 5IO7A 2Q2MA 2BHVA 2RCTA 2HLVA 3O2YA 4U8UN 1QABE 4YKOA 2HZRA 4I3CA 4MVKA 3UEVA 1HBPA 1DZJA 4MIRA 4I9SA 4AZPA 4BQUA 1X71A 4GETA 4O3WA 4ZHHA 1HBQA 4A1HA 1ML7A 3SAOA 1GX8A 4TJZA 3NQ9A 4GU8A 2JN3A 1SY0A 1P6PA 2RD7C 4IB6A 4N7CA 4YMYA 3G7XA 4YBUA 1OEJA 1TXLA 2RQ0A 2AT8X 4XMDA 1LIDA 5L8NA 1PBOA 2W2BA 3C78X 5IO6A 3U0DA 5EEDA 1JZUA 1QG5A 4M6SA 4O3ZA 4CV7A 1SMPI 1BBPA 4OS0A 1IKEA 2OVDA 3EYCA 3PP6A 1I4UA 4O4OA 4XMGA 1YUPA 4U9CA 4PJ2A 3CBCA 4BVMA 2Q39A 1SXWA 3JSQA 3PECA 3CQNA 4AZNA 4HPCA 3UEWA 4QYPA 1HN2A 3D97A 3FR4A 4YFRA 1TVQA 1YWDA 4LKTA 4QAEA 1FTPA 1UZ2X 2ZAGA 4INNA 2WQAE 5AEOA 1BM5A 1EXSA 4ORWA 4ZR2A 3VG2A 4U3QA 2FS6A 3PQUA 4Y0RA 2A2GA 4QGWA 2FLJA 5KHPA 4ZGUA 2Q9SA 4AYHA 4D6AA 1D2UA 1I04A 2CBSA 3D4RA 4TKJA 3T1DA 1T8VA 2WWPA 1KXOA 1HMTA 1O1UA 1RLBE 3WJFA 1MX7A 1CBQA 3PH6A 3ZW1A 3FW4A 3PQSA 2AH7X 3I0AA 5EPQA 1BEBA 1GT1A 4HWMA 3RZYA 1DV9A 3HWGA 5KIDA 1JV4A 1JYJA 4YFPA 2QMIA 3NQKA 2K62A 1X8NA 3JS1A 4I3BA 2RCQA 4HPAA 4N7DA 5LKFA 1AB0A 1KZXA 4HPDA 2ACOA 2GJ5A 4ORXA 2XKLA 4QZUA 1G7NA 4O3YA 3ZW1B 1KGLA 3ZZVA 3DSZA 3KFHA 1A2DA 4IMNA 2X45A 2JU3A 4EFGA 3V8UA 1X8QA 1E5PA 4QRLA 1GT5A 4NNTA 3F8AA 1ZRYA 1AVGI 4GNWA 5EZ2A 3UEXA 1EPBA 4ZH6A 3RBYA 2ASNX 2GTLM 3RKGA 4ZHFA 1ERXA 2HMBA 5LJHA 3L4RA 4AW8A 1KOIA 1E00A 1QY1A 3FA6A 3LV4A 3NADA 5D8JA 2MM3A 2QO4A 3FR5A 2QM9A 3HOLA 5L8OA 3FMZA 3BU1A 1GKAA 1KZWA 2CM9A 2DM5A 4QYNA 3APUA 1KT3A 2CBRA 2ACPX 5LJEA 4LZVA 3BRNA 1KQWA 4TNNA 2HYSA 3BLGA 4IB7A 1H91A 5H8TA 3TZSA 3EM0A 2F09A 5FQ6E 4O9SA 3ZUIA 2QO5A 2NNEA 2Q4NA 3ELXA 4FQBB 4CK4A 4DQ4A 4ZH9A 1DZKA 4O49A 2AKQA 1LIBA 5F58A 1YWBA 3Q6LA 3JQOA 3GE2A 4QZTA 3STKA 2G7BA 3C76X 3KZAA 4IAWA 2M4LA 4TKHA 3HOEA 3WOVA 2OVEA 3WXQA 2CM4A 3ZW2A 4NYRA 2O62A 3BY0A 3P6HA 4TLJA 5KICA 3RWXA 1Z24A 4YKMA 4MISA 4YH0A 5LJBA 5LJDA 3WJGA 4GH7A 5BVQA 3E3CA 1NGLA 4O3XB 2X8SA 4AZQA 4IB9A 1TW4A 2R73A 1AQBA 1OEKA 4O4UA 3H3IA 5BYPA 1FEMA 2MWHA 4NLJA 4KH8A 4ALOA 2FR2A 4ORUA 3NX1A 2QOSC 3O22A 3C77X 3U03A 4ZJ0A 4QQ1A 1QY0A 4XMCA 1OPAA 2OVAA 1BLRA 4I95A 1U17A 2HZQA 3PPTA 1ICMA 1QQSA 3P02A 1ZNDA 4IABA 1MX8A 3P6CA 5C0NA 5HTDA 5JR8A 5HTEA 1PEEA 5B29A 4FGIB 4U8UM 1VPRA 3FA7A 3CQRA 1FDQA 1FELA 2ANSA 3HWEA 4L1NA 3KFFA 4YCEA 4KIIA 1ERBA 4ID2A 2RN4A 1IKJA 4AZOA 1GT3A 4ON1A 1BSOA 3B2KA 1U0XA 3UAQA 4EXZA 2BT9A 3ZW0B 4M7MA 3HWFA 2L5PA 4AZRA 2JMBA 3FA8A 5H9LA 1JBHA 5HBSA 2WSJA 2GC9A 1R0UA 5CE4A 3FA9A 4CSBA 3VE2A 1JJJA 4EEJA 1A3YA 3S60A 2WEXA 2LA7A 2A2UA 3AKNA 1ZNKA 4FBOA 4NYQA 2FR3A 1TOUA 1E06A 3FR2A 3WVMA 5D47A 1EI5A 2G79A 3ZQ3A 2YMSA 2GTFX 1YWAA 3F9DA 2LB6A 4GKCA 5AQ6A 1SXXA 4A1YA 5CYBA 3CWKA 5HCDC 1B0OA 3STMX 3OBLA 5D45A 1DF3A 2NNDA 3BU9A 4KC7A 3B2IA 5EDCA 5F1EA 1BWYA 3ELZA 2Z4HA 2G78A 1OBQA 1QWDA 4YFQA 3U9PC 2JU7A 4A8ZA 2L67A 3N91A 4XMFA 4YDAA 3ZUOA 1B4MA 1YP6A 2BLGA 3FEKA 4YCHA 1G85A 2OVSA 3O19A 5HZ8A 2R56A 1GGLA 3BX7A 3VPJE 3VU1A 1O1VA 5LJKA 2OFRX 4YGGA 1E02A 4Y0PA 1CJ5A 1A57A 1KT7A 3STNA 1LICA 3FELA 1ZNLA 2BS6A 3VG4A 1DC9A 1ADLA 2Q2PA 4JGLA 1VYGA 1KT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INN A; 
#chains in the Genus database with same CATH topology
 2KW1 A;  3TGC A;  4IMO A;  2RTJ A;  1S44 A;  4CDE A;  4EQA C;  1Y53 X;  2CZU A;  2RTO B;  2R74 A;  1N7Y A;  1N9M A;  4R0B A;  2A13 A;  4YDB A;  2F73 A;  4A60 A;  1KT4 A;  1VWE B;  3BX8 A;  3FW5 A;  2MO5 A;  3NQ3 A;  5EEE A;  4YGH A;  1KL5 A;  3D95 A;  1EPA A;  1Y9L A;  2EU7 X;  1MVG A;  1QY2 A;  1Y55 X;  4O4X A;  5HWZ A;  1LPJ A;  2X8T A;  4GDA A;  4Z2P A;  1RBP A;  1JJX A;  1MDC A;  1SRG A;  1VWI B;  1GT4 A;  1PMP A;  3BSZ E;  4I9R A;  2POA A;  4Z2V A;  4ES7 A;  5EDB A;  1EIO A;  2AT6 X;  4GD9 A;  3EW1 A;  2KD2 A;  1HQQ A;  3VGW A;  3IA8 A;  2Y3F A;  1EUO A;  4AZM A;  2NNQ A;  2P8G A;  1OSP O;  1B8E A;  4TQ2 A;  3BDR A;  3NPO A;  4GZV A;  3B2H A;  3WJE A;  5BVT A;  2BS5 A;  3TGB A;  2RA6 A;  4NNS A;  3TGA A;  4Z2O A;  3NBX X;  5FFH A;  2IZI A;  1K24 A;  4BX7 B;  1RXJ A;  3CBS A;  1LUQ A;  4LKP A;  1FEN A;  2E4J A;  3ZWE A;  3KFG A;  3NP1 A;  5FEN A;  3P6F A;  1AVE A;  4GE1 A;  1LNM A;  5HZ5 A;  2IZL B;  3F6Z B;  4NV8 A;  1BRQ A;  1DZM A;  3ZI8 A;  1BRP A;  2X46 A;  3GAQ A;  2IZG B;  3PDF A;  1VWQ B;  1RXH A;  4OMW A;  1VWC B;  3RDS A;  1LIE A;  1RXK A;  1VYO A;  4OS8 A;  4ALB A;  1X8O A;  3RE6 A;  1NDJ A;  1G74 A;  4WHI A;  2GTL O;  2UZ2 A;  3RY2 A;  4ML7 B;  4YGZ A;  1SLF B;  4ORS A;  3WZQ A;  3CKG A;  4MVL A;  4ORY A;  2PY1 A;  4OMX A;  4PSQ A;  1T0V A;  2RTI B;  1EW3 A;  2RTG B;  2UYW A;  3FDC A;  1AVD A;  3MVF A;  1BSQ A;  2QO6 A;  5IO5 A;  1X8U A;  5F7G A;  5B27 A;  3ZW0 A;  1ACD A;  2YG2 A;  4OKA A;  4COT A;  5HZ9 A;  1LDQ A;  1VWD B;  1Y9T A;  3BS2 A;  1GX9 A;  2JW1 A;  4QGV A;  4L3R A;  2Z4I A;  3WZN A;  3T6L A;  4UU2 A;  1SA8 A;  2IFB A;  3RE5 A;  1JIW I;  1B56 A;  3CKF A;  1N9Y A;  2OFM X;  5FQ7 E;  4GDZ A;  2CAM A;  4FBR A;  5K67 A;  1O8V A;  2MHD A;  5D48 A;  1CBI A;  2KTD A;  1IJ8 A;  3KQ0 A;  3AKM A;  1HMS A;  4KCA A;  5LJC A;  4QNI A;  1SWO A;  1K3B A;  1A18 A;  1SXY A;  5HZ6 A;  1ALB A;  5HA1 A;  1MOY A;  2OF8 A;  2RTL A;  2IZD B;  2PI3 O;  3NR3 A;  4GRJ A;  4MVI A;  5H9N A;  2LBV A;  3WBG A;  2OL8 O;  1OBP A;  2X55 A;  1L6M A;  1I06 A;  1YWC A;  4ZFX A;  5AJB A;  2MJI A;  1S2P A;  1FE3 A;  1QFV A;  2GH7 A;  1N43 A;  1VYF A;  4O4S A;  5B10 O;  5HAE A;  4D6B A;  1OBU A;  3EBW A;  1ZNG A;  1U18 A;  1OEE A;  1S7D A;  2AL0 X;  2LFO A;  3EBK A;  3NX2 A;  5F6B A;  1KT6 A;  3I17 A;  5HA0 A;  1AEL A;  5LJG A;  1EAL A;  4Y5D A;  5CHK A;  1X8P A;  3APX A;  5AJC A;  4CPH B;  3D96 A;  3OJY C;  3AUM O;  4LZU A;  3WZO A;  2CZT A;  4IBA A;  3OE3 A;  3KFI A;  1VWK B;  1CBS A;  3WJC A;  1PBY A;  4GNY A;  3VG7 A;  2A8G A;  4NLI A;  1JJU A;  4QGX A;  5JD2 A;  2ALL X;  5L3Y A;  3FLL A;  1OPB A;  3FIQ A;  1SY2 A;  1YP7 A;  4U8U O;  1VWH B;  1DZP A;  3P6D A;  1XCA A;  2JOZ A;  3MBT A;  3WYP A;  1I9H A;  2HNX A;  2AT5 X;  2IZE B;  3FYF A;  4EDE A;  4NP1 A;  4ZHD A;  1GM6 A;  2OY7 A;  1N0S A;  1SY1 A;  5K06 A;  1HMR A;  3VHH A;  3DTQ A;  3IFB A;  1D3S A;  4GGR A;  2MF6 A;  1NQN A;  4RUN A;  3WJB A;  1XKI A;  4IAX A;  2L9C A;  1MUP A;  5BVS A;  4RUU A;  5HCE C;  1BJ7 A;  1SWJ A;  4BOE A;  3CMP A;  5DG4 A;  2RTC B;  3PH5 A;  2WEW A;  3EMM A;  1VWR B;  2I5Z O;  2KT4 B;  2W2A A;  3VG3 A;  2RTK A;  4NW4 A;  2ZAI A;  2RTE B;  4WFU A;  4BJ8 A;  1ICN A;  1IW2 A;  1CBR A;  4ZCB A;  3B2L A;  3VE1 A;  1MK5 A;  1HQP A;  4GGZ A;  2IZF B;  5L8I A;  2LKK A;  2KTS A;  1RST B;  2GTL N;  4GK9 A;  3PK2 A;  3QKG A;  4LQZ A;  4ZHG A;  4ORR A;  5FAZ A;  1LIF A;  5H9A A;  2FTB A;  2A3F X;  2W2F A;  4OEL A;  1EQD A;  1LFO A;  4ODD A;  5DPQ A;  1KL4 A;  1IFC A;  1KQX A;  5D4A A;  5IRA A;  1HY2 A;  5HCC C;  1SWH A;  4Y0Q A;  1G5W A;  3SOT A;  4YBP A;  4HFO A;  4KC8 A;  2HKD A;  2IZC B;  3APV A;  3S5V A;  4ARH A;  3S5X A;  1CRB A;  2Y32 A;  3EC5 A;  4ZGF A;  3P6E A;  2FWV A;  1PM1 X;  3TF6 A;  1SY3 A;  4FBV A;  3K3L A;  4BX7 A;  1ZNH A;  2OZQ A;  2Y3E A;  4WBK A;  3SLT A;  2AT3 X;  4BX6 A;  1LCZ A;  3WJD A;  3X00 A;  4I6S A;  1X89 A;  3P24 A;  3OD9 A;  4I3D A;  4KT5 A;  5F6Z A;  4B55 A;  1YIV A;  1SWD A;  1ZNE A;  1NC9 A;  4XME A;  5LKE A;  2AMM X;  4CPF A;  4DQ3 A;  1NP1 A;  3APW A;  1FJ1 E;  3B2J A;  3P6G A;  4TKB A;  1EII A;  1BSY A;  4CDC A;  1VWF B;  1NP4 A;  1VWO B;  2FT9 A;  2WR6 A;  2WUT A;  4WFV A;  5FQ8 E;  4BX6 B;  1N4J A;  3MX7 A;  1LKE A;  5B5G A;  2IZB A;  4Y0S A;  3FEP A;  1GKA B;  1IIU A;  1JYD A;  2JU8 A;  5H9K A;  4YVB A;  2FS7 A;  1TOW A;  3HWD A;  3HK1 A;  1DFV A;  1IFB A;  3RSW A;  2L68 A;  4XMH A;  1HXL A;  3VG6 A;  2XST A;  1GXA A;  1SRE A;  1STP A;  4UU3 A;  1SWC A;  3LHN A;  1SWQ A;  2A0A A;  4OS3 A;  2WQ9 A;  1SWU A;  4CDD A;  4K19 A;  1QFT A;  4DNE A;  1URE A;  2OFB A;  4MVE A;  3S26 A;  1LF7 A;  4HPB A;  2LBA A;  2N93 A;  2OL7 A;  2FKJ A;  1T68 X;  2NP1 A;  3HTY A;  2FRS A;  3QQ2 A;  2IZH B;  2K23 A;  2AT0 X;  3PED A;  1I05 A;  3FEN A;  1SXU A;  5HZQ A;  3RDO A;  4ZHC A;  2BC3 A;  1SLD B;  3VG5 A;  4IB8 A;  2X8F A;  3UEU A;  3CR6 A;  5IO7 A;  2Q2M A;  2BHV A;  2RCT A;  2HLV A;  3O2Y A;  4U8U N;  1QAB E;  1LCV A;  2HZR A;  4I3C A;  4MVK A;  3UEV A;  4BCS A;  2C1Q A;  1HBP A;  1DZJ A;  1STR B;  4I9S A;  4MIR A;  4AZP A;  1X71 A;  4GET A;  4O3W A;  4BQU A;  4ZHH A;  5CSE A;  1HBQ A;  4A1H A;  1ML7 A;  1VWG B;  3SAO A;  1GX8 A;  3FID A;  4TJZ A;  3NQ9 A;  2AF5 A;  4GU8 A;  1VWN B;  1SY0 A;  1P6P A;  1SWT A;  2JN3 A;  2RD7 C;  4GGT A;  3G7X A;  1RAV A;  4IB6 A;  4N7C A;  3KVN A;  4YBU A;  4YMY A;  2DJG A;  1OEJ A;  1TXL A;  2RQ0 A;  2RTM A;  2AT8 X;  4XMD A;  1LID A;  5L8N A;  1STS B;  1PBO A;  2W2B A;  4JO6 A;  4CPH A;  5IRW A;  3C78 X;  2G8C O;  5IO6 A;  3U0D A;  5EED A;  1JZU A;  1QG5 A;  4M6S A;  4O3Z A;  4CV7 A;  1SMP I;  1BBP A;  4OS0 A;  1IKE A;  2OVD A;  3EYC A;  3PP6 A;  1I4U A;  4O4O A;  4XMG A;  2F01 A;  1YUP A;  4U9C A;  4NV7 A;  3CBC A;  4PJ2 A;  2Q39 A;  1SXW A;  3JSQ A;  3PEC A;  3CQN A;  4AZN A;  4BVM A;  4HPC A;  3UEW A;  2RTN B;  1HN2 A;  3D97 A;  1SWE A;  3FR4 A;  4QYP A;  1TVQ A;  1YWD A;  4LKT A;  4MEE A;  3SZH A;  4YFR A;  4QAE A;  3SLJ A;  1FTP A;  1UZ2 X;  3AEH A;  3SZI A;  1Y0G A;  2ZAG A;  4INN A;  2WQA E;  5AEO A;  1BM5 A;  1EXS A;  4ORW A;  1W6F A;  4ZR2 A;  3VG2 A;  4U3Q A;  2FS6 A;  3PQU A;  4Y0R A;  2A2G A;  4QGW A;  5IXG A;  2FLJ A;  4Y59 A;  2I5V O;  5KHP A;  4ZGU A;  2Q9S A;  4AYH A;  4D6A A;  3LTW A;  1D2U A;  3SLO A;  4BBO A;  1I04 A;  2VFB A;  2CBS A;  3D4R A;  4TKJ A;  3T1D A;  1SWP A;  1T8V A;  2WWP A;  1KXO A;  1HMT A;  1O1U A;  1RLB E;  2OF9 A;  1MX7 A;  3WJF A;  2FHN X;  3RDQ A;  1CBQ A;  2C1S A;  3PH6 A;  3ZW1 A;  1PTS A;  3FW4 A;  3PQS A;  2AH7 X;  4CPI A;  3I0A A;  5EPQ A;  1BEB A;  1GT1 A;  1JMZ A;  4HWM A;  2WPU A;  1SRJ A;  3RY1 A;  3RZY A;  1DV9 A;  3HWG A;  5KID A;  1JV4 A;  3WZP A;  1JYJ A;  2RTD B;  4YFP A;  2QMI A;  3NQK A;  2K62 A;  3Q34 A;  1X8N A;  3JS1 A;  3EW2 A;  2RCQ A;  4HPA A;  4I3B A;  4N7D A;  4CPE A;  5LKF A;  1AB0 A;  1SWG A;  1KZX A;  1SRF A;  2VFC A;  4HPD A;  2ACO A;  5B11 O;  2GJ5 A;  4ORX A;  2XKL A;  4QZU A;  1G7N A;  4O3Y A;  4GJS A;  3ZW1 B;  3ZZV A;  3DSZ A;  3KFH A;  1KGL A;  1A2D A;  4IRW A;  4IMN A;  1SWA A;  2RTB B;  2X45 A;  2JU3 A;  4EFG A;  3V8U A;  1X8Q A;  3RDX A;  1E5P A;  4QRL A;  1VWA B;  1GT5 A;  4NNT A;  1NQM A;  1ZRY A;  3F8A A;  1AVG I;  4GNW A;  4Z28 A;  2RTF B;  5EZ2 A;  3UEX A;  1EPB A;  4ZH6 A;  2X34 A;  2OY5 O;  3RBY A;  2ASN X;  2GTL M;  1UYO X;  3RKG A;  1ERX A;  2HMB A;  4ZHF A;  3L4R A;  5LJH A;  4AW8 A;  1KOI A;  1E00 A;  1QY1 A;  2X4M A;  3FA6 A;  3LV4 A;  3NAD A;  5D8J A;  2MM3 A;  2QO4 A;  3FR5 A;  2QM9 A;  2X32 A;  3HOL A;  5L8O A;  3FMZ A;  3BU1 A;  1GKA A;  2IZJ A;  1KZW A;  2CM9 A;  4OEM A;  1MM9 A;  2DM5 A;  3MG5 A;  4QYN A;  3APU A;  3SZJ A;  1KT3 A;  2CBR A;  2ACP X;  2QOM A;  4BX5 B;  4C5P A;  5LJE A;  1LDO A;  5K68 A;  1WBI A;  4LZV A;  3BRN A;  1KQW A;  3VHI A;  4EKV A;  1KFF A;  4TNN A;  2HYS A;  3BLG A;  4IB7 A;  1H91 A;  4GUZ A;  5H8T A;  3TZS A;  4U46 A;  3EM0 A;  2F09 A;  5B2A O;  5FQ6 E;  2ZSC A;  4O9S A;  3ZUI A;  2QO5 A;  1SWL A;  2NNE A;  2Q4N A;  3ELX A;  3WYQ A;  1W4T A;  1SLE B;  4FQB B;  4JHQ A;  4CK4 A;  4DQ4 A;  4ZH9 A;  1DZK A;  4O49 A;  1UYN X;  1LIB A;  2AKQ A;  4DCB A;  5F58 A;  1YWB A;  3Q6L A;  3JQO A;  3GE2 A;  4QZT A;  3STK A;  2G7B A;  3C76 X;  3KZA A;  2OY1 O;  4IAW A;  2M4L A;  4TKH A;  3T2W A;  3HOE A;  3WOV A;  2OVE A;  1SWR A;  3WXQ A;  2CM4 A;  1W5R A;  3ZW2 A;  4NYR A;  2O62 A;  3BY0 A;  3P6H A;  4TLJ A;  2BSZ A;  5KIC A;  3RWX A;  1Z24 A;  4YKM A;  4MIS A;  4YH0 A;  3T2X A;  5LJB A;  5LJD A;  3WJG A;  4GH7 A;  5B3M O;  3E3C A;  5BVQ A;  1NGL A;  4O3X B;  2X8S A;  4AZQ A;  1E2T A;  4IB9 A;  2RTA A;  1NBX A;  1TW4 A;  2R73 A;  1AQB A;  1OEK A;  4O4U A;  3H3I A;  5BYP A;  3D9W A;  1FEM A;  1VWP B;  2MWH A;  4NLJ A;  4KH8 A;  4ALO A;  2FR2 A;  1VWM B;  4ORU A;  3NX1 A;  2QOS C;  3O22 A;  3C77 X;  4I60 A;  3U03 A;  1Y52 X;  4ZJ0 A;  4QQ1 A;  1QY0 A;  1KL3 A;  4XMC A;  1OPA A;  2OVA A;  1BLR A;  4I95 A;  1JMX A;  2A5B A;  1U17 A;  2HZQ A;  1SRI A;  3PPT A;  3VHM A;  1ICM A;  1QQS A;  3P02 A;  1ZND A;  4IAB A;  1MX8 A;  5B5F A;  3P6C A;  1MEP A;  5C0N A;  5HTD A;  5JR8 A;  5HTE A;  1PEE A;  2OY8 A;  5B29 A;  4FGI B;  4U8U M;  1VPR A;  3FA7 A;  3CQR A;  1FDQ A;  1FEL A;  2ANS A;  3HWE A;  4L1N A;  3KFF A;  4YCE A;  1SWN A;  4KII A;  1LCW A;  3MM0 A;  2A5C A;  1DF8 A;  1ERB A;  4ID2 A;  2RN4 A;  1IKJ A;  2FKG A;  4AZO A;  1GT3 A;  4ON1 A;  1BSO A;  3B2K A;  5IRU A;  3RDU A;  1U0X A;  3HPE A;  3UAQ A;  1SLG B;  4EXZ A;  2BT9 A;  2X56 A;  3ZW0 B;  4M7M A;  3HWF A;  2L5P A;  1RSU B;  2JMB A;  4AZR A;  2OYB O;  3FA8 A;  1VWL B;  5H9L A;  1JBH A;  5HBS A;  1JQP A;  2WSJ A;  2GC9 A;  4GJV A;  1R0U A;  4Z27 A;  2AVI A;  3FA9 A;  5CE4 A;  4CSB A;  1I78 A;  3VE2 A;  1JJJ A;  4EEJ A;  1A3Y A;  1LEL A;  2RTP B;  1SWB A;  2WEX A;  2LA7 A;  3S60 A;  2A2U A;  3AKN A;  1ZNK A;  4FBO A;  4NYQ A;  2IZK A;  2FR3 A;  1SRH A;  1E06 A;  1TOU A;  3FR2 A;  3WVM A;  5D47 A;  1SWF A;  1EI5 A;  2G79 A;  2RTR B;  3ZQ3 A;  2YMS A;  2GTF X;  1YWA A;  3F9D A;  2LB6 A;  2RTQ B;  4GKC A;  5AQ6 A;  1SXX A;  4CDF A;  4A1Y A;  5CYB A;  1SWS A;  1HXZ A;  3CWK A;  2OL6 O;  1B0O A;  3STM X;  3OBL A;  5D45 A;  4Z6J A;  5HCD C;  4BGF A;  2QCB A;  4JNJ A;  2FGS A;  3T6F A;  1DF3 A;  2NND A;  1VWB B;  1VWJ B;  2JGS A;  3BU9 A;  3RDM A;  4KC7 A;  3B2I A;  5EDC A;  5F1E A;  1BWY A;  3ELZ A;  2Z4H A;  2G78 A;  2RTH B;  1OBQ A;  2VDF A;  1QWD A;  4YFQ A;  3U9P C;  2JU7 A;  4A8Z A;  2L67 A;  2C4I A;  3N91 A;  4XMF A;  4YDA A;  4YKO A;  3ZUO A;  1B4M A;  2DJF A;  1YP6 A;  2BLG A;  3FEK A;  4YCH A;  2G5L A;  1G85 A;  2OVS A;  3O19 A;  5HZ8 A;  2R56 A;  1GGL A;  3BX7 A;  3VPJ E;  1WUB A;  1O1V A;  2OFA A;  2OFR X;  5F2B A;  3VU1 A;  5LJK A;  2IZA A;  4YGG A;  1E02 A;  2FHL A;  4Y0P A;  1CJ5 A;  1A57 A;  1KT7 A;  3STN A;  1LIC A;  4BX5 A;  3FEL A;  1ZNL A;  2BS6 A;  3VG4 A;  1DC9 A;  1ADL A;  1SWK A;  2Q2P A;  4JGL A;  1VYG A;  1GX3 A;  1KT5 A; 
#chains in the Genus database with same CATH homology
 2KW1 A;  3TGC A;  4IMO A;  1S44 A;  4EQA C;  2CZU A;  4R0B A;  2R74 A;  4YDB A;  4A60 A;  2A13 A;  2F73 A;  1KT4 A;  3BX8 A;  3NQ3 A;  3FW5 A;  2MO5 A;  5EEE A;  4YGH A;  3D95 A;  1EPA A;  1Y9L A;  2EU7 X;  1MVG A;  1QY2 A;  4O4X A;  5HWZ A;  1LPJ A;  2X8T A;  1RBP A;  1JJX A;  1MDC A;  1GT4 A;  1PMP A;  3BSZ E;  4I9R A;  2POA A;  4ES7 A;  5EDB A;  1EIO A;  2AT6 X;  2KD2 A;  3IA8 A;  1EUO A;  4AZM A;  2NNQ A;  2P8G A;  1B8E A;  4TQ2 A;  3BDR A;  3NPO A;  4GZV A;  3B2H A;  3WJE A;  5BVT A;  2BS5 A;  3TGB A;  2RA6 A;  4NNS A;  3TGA A;  3NBX X;  5FFH A;  3CBS A;  4LKP A;  1FEN A;  2E4J A;  3ZWE A;  3KFG A;  3NP1 A;  5FEN A;  3P6F A;  4GE1 A;  1LNM A;  5HZ5 A;  3F6Z B;  1BRQ A;  1DZM A;  3ZI8 A;  1BRP A;  2X46 A;  3GAQ A;  4OMW A;  1LIE A;  4OS8 A;  4ALB A;  1X8O A;  1G74 A;  4WHI A;  2GTL O;  4ML7 B;  4YGZ A;  4ORS A;  4MVL A;  4ORY A;  2PY1 A;  4OMX A;  4PSQ A;  1T0V A;  1EW3 A;  3MVF A;  1BSQ A;  2QO6 A;  5IO5 A;  1X8U A;  5F7G A;  5B27 A;  3ZW0 A;  1ACD A;  2YG2 A;  5HZ9 A;  4COT A;  1Y9T A;  3BS2 A;  1GX9 A;  2JW1 A;  4QGV A;  4L3R A;  2Z4I A;  4UU2 A;  1SA8 A;  2IFB A;  1JIW I;  1B56 A;  5FQ7 E;  2OFM X;  4FBR A;  4GDZ A;  1O8V A;  2MHD A;  5D48 A;  1CBI A;  2KTD A;  3KQ0 A;  3AKM A;  1HMS A;  4KCA A;  5LJC A;  4QNI A;  1A18 A;  1SXY A;  5HZ6 A;  1ALB A;  5HA1 A;  5H9N A;  3NR3 A;  4GRJ A;  4MVI A;  2LBV A;  3WBG A;  1OBP A;  1L6M A;  1I06 A;  1YWC A;  4ZFX A;  5AJB A;  2MJI A;  1S2P A;  1FE3 A;  1QFV A;  1VYF A;  4O4S A;  5HAE A;  4D6B A;  1OBU A;  3EBW A;  1ZNG A;  1U18 A;  1OEE A;  1S7D A;  2AL0 X;  2LFO A;  3EBK A;  3NX2 A;  5F6B A;  1KT6 A;  3I17 A;  5HA0 A;  1AEL A;  5LJG A;  1EAL A;  1X8P A;  3APX A;  5AJC A;  3D96 A;  3OJY C;  4LZU A;  2CZT A;  4IBA A;  3OE3 A;  3KFI A;  3WJC A;  1CBS A;  4GNY A;  3VG7 A;  4NLI A;  4QGX A;  2ALL X;  3FLL A;  1OPB A;  3FIQ A;  1SY2 A;  1YP7 A;  4U8U O;  1DZP A;  3P6D A;  1XCA A;  2JOZ A;  3MBT A;  2HNX A;  2AT5 X;  3FYF A;  4EDE A;  4NP1 A;  4ZHD A;  1GM6 A;  1N0S A;  1SY1 A;  5K06 A;  1HMR A;  3DTQ A;  3IFB A;  1D3S A;  4RUN A;  3WJB A;  1XKI A;  4IAX A;  2L9C A;  1MUP A;  5BVS A;  4RUU A;  5HCE C;  1BJ7 A;  4BOE A;  3CMP A;  5DG4 A;  3PH5 A;  2WEW A;  3EMM A;  2KT4 B;  2W2A A;  3VG3 A;  4NW4 A;  2ZAI A;  4WFU A;  1ICN A;  1IW2 A;  1CBR A;  4ZCB A;  3B2L A;  3VE1 A;  1HQP A;  5L8I A;  2LKK A;  2KTS A;  2GTL N;  4GK9 A;  4ZHG A;  3QKG A;  4LQZ A;  4ORR A;  5FAZ A;  1LIF A;  5H9A A;  2FTB A;  2A3F X;  2W2F A;  1EQD A;  1LFO A;  4ODD A;  5DPQ A;  1IFC A;  1KQX A;  5D4A A;  5HCC C;  4Y0Q A;  1G5W A;  3SOT A;  4YBP A;  4HFO A;  4KC8 A;  3S5V A;  3APV A;  4ARH A;  3S5X A;  1CRB A;  4ZGF A;  3P6E A;  2FWV A;  1PM1 X;  3TF6 A;  1SY3 A;  4FBV A;  3K3L A;  1ZNH A;  2OZQ A;  4WBK A;  2AT3 X;  3WJD A;  4I6S A;  1X89 A;  3P24 A;  3OD9 A;  4I3D A;  4KT5 A;  5F6Z A;  1YIV A;  1ZNE A;  4XME A;  5LKE A;  2AMM X;  4DQ3 A;  1NP1 A;  3APW A;  3P6G A;  3B2J A;  4TKB A;  1EII A;  1BSY A;  2WR6 A;  1NP4 A;  2FT9 A;  2WUT A;  4WFV A;  5FQ8 E;  3MX7 A;  1LKE A;  4Y0S A;  3FEP A;  1GKA B;  1IIU A;  1JYD A;  2JU8 A;  5H9K A;  2FS7 A;  1TOW A;  3HWD A;  3HK1 A;  1DFV A;  1IFB A;  3RSW A;  2L68 A;  4XMH A;  3VG6 A;  2XST A;  1GXA A;  4UU3 A;  3LHN A;  2A0A A;  4OS3 A;  2WQ9 A;  4K19 A;  1QFT A;  1URE A;  4MVE A;  3S26 A;  1LF7 A;  4HPB A;  2LBA A;  2N93 A;  1T68 X;  2NP1 A;  3HTY A;  2FRS A;  2K23 A;  2AT0 X;  3PED A;  1I05 A;  3FEN A;  1SXU A;  5HZQ A;  4ZHC A;  3VG5 A;  4IB8 A;  2X8F A;  3UEU A;  3CR6 A;  5IO7 A;  2Q2M A;  2BHV A;  2RCT A;  2HLV A;  3O2Y A;  4U8U N;  1QAB E;  4YKO A;  2HZR A;  4I3C A;  4MVK A;  3UEV A;  1HBP A;  1DZJ A;  4MIR A;  4I9S A;  4AZP A;  4BQU A;  1X71 A;  4GET A;  4O3W A;  4ZHH A;  1HBQ A;  4A1H A;  1ML7 A;  3SAO A;  1GX8 A;  4TJZ A;  3NQ9 A;  4GU8 A;  2JN3 A;  1SY0 A;  1P6P A;  2RD7 C;  4IB6 A;  4N7C A;  4YMY A;  3G7X A;  4YBU A;  1OEJ A;  1TXL A;  2RQ0 A;  2AT8 X;  4XMD A;  1LID A;  5L8N A;  1PBO A;  2W2B A;  3C78 X;  5IO6 A;  3U0D A;  5EED A;  1JZU A;  1QG5 A;  4M6S A;  4O3Z A;  4CV7 A;  1SMP I;  1BBP A;  4OS0 A;  1IKE A;  2OVD A;  3EYC A;  3PP6 A;  1I4U A;  4O4O A;  4XMG A;  1YUP A;  4U9C A;  4PJ2 A;  3CBC A;  4BVM A;  2Q39 A;  1SXW A;  3JSQ A;  3PEC A;  3CQN A;  4AZN A;  4HPC A;  3UEW A;  4QYP A;  1HN2 A;  3D97 A;  3FR4 A;  4YFR A;  1TVQ A;  1YWD A;  4LKT A;  4QAE A;  1FTP A;  1UZ2 X;  2ZAG A;  4INN A;  2WQA E;  5AEO A;  1BM5 A;  1EXS A;  4ORW A;  4ZR2 A;  3VG2 A;  4U3Q A;  2FS6 A;  3PQU A;  4Y0R A;  2A2G A;  4QGW A;  2FLJ A;  5KHP A;  4ZGU A;  2Q9S A;  4AYH A;  4D6A A;  1D2U A;  1I04 A;  2CBS A;  3D4R A;  4TKJ A;  3T1D A;  1T8V A;  2WWP A;  1KXO A;  1HMT A;  1O1U A;  1RLB E;  3WJF A;  1MX7 A;  1CBQ A;  3PH6 A;  3ZW1 A;  3FW4 A;  3PQS A;  2AH7 X;  3I0A A;  5EPQ A;  1BEB A;  1GT1 A;  4HWM A;  3RZY A;  1DV9 A;  3HWG A;  5KID A;  1JV4 A;  1JYJ A;  4YFP A;  2QMI A;  3NQK A;  2K62 A;  1X8N A;  3JS1 A;  4I3B A;  2RCQ A;  4HPA A;  4N7D A;  5LKF A;  1AB0 A;  1KZX A;  4HPD A;  2ACO A;  2GJ5 A;  4ORX A;  2XKL A;  4QZU A;  1G7N A;  4O3Y A;  3ZW1 B;  1KGL A;  3ZZV A;  3DSZ A;  3KFH A;  1A2D A;  4IMN A;  2X45 A;  2JU3 A;  4EFG A;  3V8U A;  1X8Q A;  1E5P A;  4QRL A;  1GT5 A;  4NNT A;  3F8A A;  1ZRY A;  1AVG I;  4GNW A;  5EZ2 A;  3UEX A;  1EPB A;  4ZH6 A;  3RBY A;  2ASN X;  2GTL M;  3RKG A;  4ZHF A;  1ERX A;  2HMB A;  5LJH A;  3L4R A;  4AW8 A;  1KOI A;  1E00 A;  1QY1 A;  3FA6 A;  3LV4 A;  3NAD A;  5D8J A;  2MM3 A;  2QO4 A;  3FR5 A;  2QM9 A;  3HOL A;  5L8O A;  3FMZ A;  3BU1 A;  1GKA A;  1KZW A;  2CM9 A;  2DM5 A;  4QYN A;  3APU A;  1KT3 A;  2CBR A;  2ACP X;  5LJE A;  4LZV A;  3BRN A;  1KQW A;  4TNN A;  2HYS A;  3BLG A;  4IB7 A;  1H91 A;  5H8T A;  3TZS A;  3EM0 A;  2F09 A;  5FQ6 E;  4O9S A;  3ZUI A;  2QO5 A;  2NNE A;  2Q4N A;  3ELX A;  4FQB B;  4CK4 A;  4DQ4 A;  4ZH9 A;  1DZK A;  4O49 A;  2AKQ A;  1LIB A;  5F58 A;  1YWB A;  3Q6L A;  3JQO A;  3GE2 A;  4QZT A;  3STK A;  2G7B A;  3C76 X;  3KZA A;  4IAW A;  2M4L A;  4TKH A;  3HOE A;  3WOV A;  2OVE A;  3WXQ A;  2CM4 A;  3ZW2 A;  4NYR A;  2O62 A;  3BY0 A;  3P6H A;  4TLJ A;  5KIC A;  3RWX A;  1Z24 A;  4YKM A;  4MIS A;  4YH0 A;  5LJB A;  5LJD A;  3WJG A;  4GH7 A;  5BVQ A;  3E3C A;  1NGL A;  4O3X B;  2X8S A;  4AZQ A;  4IB9 A;  1TW4 A;  2R73 A;  1AQB A;  1OEK A;  4O4U A;  3H3I A;  5BYP A;  1FEM A;  2MWH A;  4NLJ A;  4KH8 A;  4ALO A;  2FR2 A;  4ORU A;  3NX1 A;  2QOS C;  3O22 A;  3C77 X;  3U03 A;  4ZJ0 A;  4QQ1 A;  1QY0 A;  4XMC A;  1OPA A;  2OVA A;  1BLR A;  4I95 A;  1U17 A;  2HZQ A;  3PPT A;  1ICM A;  1QQS A;  3P02 A;  1ZND A;  4IAB A;  1MX8 A;  3P6C A;  5C0N A;  5HTD A;  5JR8 A;  5HTE A;  1PEE A;  5B29 A;  4FGI B;  4U8U M;  1VPR A;  3FA7 A;  3CQR A;  1FDQ A;  1FEL A;  2ANS A;  3HWE A;  4L1N A;  3KFF A;  4YCE A;  4KII A;  1ERB A;  4ID2 A;  2RN4 A;  1IKJ A;  4AZO A;  1GT3 A;  4ON1 A;  1BSO A;  3B2K A;  1U0X A;  3UAQ A;  4EXZ A;  2BT9 A;  3ZW0 B;  4M7M A;  3HWF A;  2L5P A;  4AZR A;  2JMB A;  3FA8 A;  5H9L A;  1JBH A;  5HBS A;  2WSJ A;  2GC9 A;  1R0U A;  5CE4 A;  3FA9 A;  4CSB A;  3VE2 A;  1JJJ A;  4EEJ A;  1A3Y A;  3S60 A;  2WEX A;  2LA7 A;  2A2U A;  3AKN A;  1ZNK A;  4FBO A;  4NYQ A;  2FR3 A;  1TOU A;  1E06 A;  3FR2 A;  3WVM A;  5D47 A;  1EI5 A;  2G79 A;  3ZQ3 A;  2YMS A;  2GTF X;  1YWA A;  3F9D A;  2LB6 A;  4GKC A;  5AQ6 A;  1SXX A;  4A1Y A;  5CYB A;  3CWK A;  5HCD C;  1B0O A;  3STM X;  3OBL A;  5D45 A;  1DF3 A;  2NND A;  3BU9 A;  4KC7 A;  3B2I A;  5EDC A;  5F1E A;  1BWY A;  3ELZ A;  2Z4H A;  2G78 A;  1OBQ A;  1QWD A;  4YFQ A;  3U9P C;  2JU7 A;  4A8Z A;  2L67 A;  3N91 A;  4XMF A;  4YDA A;  3ZUO A;  1B4M A;  1YP6 A;  2BLG A;  3FEK A;  4YCH A;  1G85 A;  2OVS A;  3O19 A;  5HZ8 A;  2R56 A;  1GGL A;  3BX7 A;  3VPJ E;  3VU1 A;  1O1V A;  5LJK A;  2OFR X;  4YGG A;  1E02 A;  4Y0P A;  1CJ5 A;  1A57 A;  1KT7 A;  3STN A;  1LIC A;  3FEL A;  1ZNL A;  2BS6 A;  3VG4 A;  1DC9 A;  1ADL A;  2Q2P A;  4JGL A;  1VYG A;  1KT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...