4INNA

Protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
TVELPGIYQTQEFLYMKSSFVEFFEHNGKFYAYGISDVDGSKAKKDKLNPNPKLRNRSDKGVVFLSDLIKVGKRSYKGGKAYNFYDGKTYYVRVAQNSNGDLEFTSSYDKWGYMGKTFTWKRLSDEEIKNLKLKRFNLDEVLKTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords HP1028
publication title Protein HP1028 from the human pathogen Helicobacter pylori belongs to the lipocalin family.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 38
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09917 DUF2147 Uncharacterized protein conserved in bacteria (DUF2147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.520 Mainly Beta Beta Barrel Lipocalin Lipocalin 4innA00
4INNA
chains in the Genus database with same CATH superfamily
3ZW1B 3UEWA 1E5PA 3OE3A 1JJXA 3AEHA 4XMGA 1OBPA 2RTCB 1UZ2X 1EIIA 1SRJA 5B10O 3EC5A 1KFFA 2IZFB 1OPAA 1OBQA 2F01A 2L68A 4NYQA 3H3IA 3NBXX 1RXHA 1GT3A 5F1EA 1LKEA 4BGFA 5F7GA 2CM9A 3WJDA 3NX1A 2MO5A 4YGZA 5HA1A 1IJ8A 4LQZA 4QYNA 4BX5B 4DNEA 1JZUA 1Y0GA 1BLRA 1G85A 1EALA 3RDMA 4RUUA 4YCEA 1U17A 2FWVA 4U3QA 2RD7C 5AJBA 1X8QA 3RSWA 3SZIA 3FW4A 1LDOA 2Y32A 4ID2A 1JJJA 4EXZA 1HQPA 1K3BA 1STRB 3CQNA 4O3WA 2W2BA 2A2UA 2MHDA 3EW1A 2FTBA 4K19A 2FR2A 2GTLO 4AZNA 4BX6B 2HMBA 1VYGA 2AT8X 3APWA 2X46A 1MK5A 2CZUA 3TGAA 3C76X 1SWPA 4O3XB 4O4XA 1NBXA 1R0UA 4YDAA 4YGGA 2K23A 1I05A 1MEPA 4BX7A 5H9LA 5FQ8E 5EEEA 2IZDB 3U9PC 1SWGA 4Z28A 3E3CA 2QO6A 1RLBE 1RAVA 3S5VA 2IZAA 2JOZA 3BX8A 2IZGB 1EPBA 4I9SA 3VG6A 4PSQA 1SLDB 1AVGI 1UYOX 2K62A 4WFUA 1JYDA 4MISA 4MEEA 4OS3A 2R56A 3EYCA 3NX2A 4CPFA 1VWFB 1LF7A 2GJ5A 1OEKA 4CDCA 5L3YA 4U46A 5CE4A 3UEUA 1SWEA 1ERXA 2HLVA 2MM3A 2G79A 3EBWA 3RBYA 1E00A 1EQDA 2BS5A 1MOYA 3NQKA 2RTEB 3IFBA 4KH8A 4EDEA 1QFVA 2BS6A 4ODDA 1IW2A 1SRHA 3P6EA 2F09A 3FEPA 4GDZA 3P6HA 2OVAA 3P6CA 1KXOA 4YGHA 1VYFA 1SY3A 5L8NA 3NP1A 2HZQA 1ALBA 1SWFA 2OY7A 4NYRA 1O1UA 1RXKA 3FW5A 2GTLM 4GDAA 3AUMO 3I0AA 3BS2A 4R0BA 2BT9A 2FS6A 2QCBA 1O8VA 1VWAB 2G8CO 3VPJE 3B2JA 4L1NA 1BSQA 1LIFA 2ACOA 1I04A 3VG7A 4WBKA 4GUZA 4NP1A 3SAOA 3F9DA 2GH7A 4Z2OA 1LIBA 4KC7A 1KGLA 1STSB 2ANSA 4OS8A 5F2BA 1HBQA 5K68A 2OY5O 3KFGA 3BX7A 4MVEA 4ZH6A 3VHHA 4BX7B 4ZGUA 4WFVA 5HAEA 4GNYA 5B29A 5B27A 2Q4NA 1GX3A 1ZNEA 2I5ZO 4N7DA 2JGSA 3O19A 1X8UA 1GX8A 4GGZA 4NV8A 1SWOA 1NP4A 1SWHA 3HOLA 4ORWA 1LCZA 1WBIA 4OEMA 1YP7A 4QGWA 3FLLA 1KT3A 1XKIA 1TVQA 2RTNB 3VHIA 1DZMA 3MX7A 1MM9A 4TKBA 1X71A 1QQSA 1SY2A 2FHLA 1SMPI 2NP1A 5CSEA 5FQ7E 2IZEB 1HQQA 4ZJ0A 4YFPA 2IZLB 2FHNX 3CQRA 4I95A 4CPHB 1ICMA 1I06A 4ORYA 3T6LA 4NLJA 4AW8A 4HPCA 1LDQA 3CR6A 3GAQA 1QFTA 2Q39A 2ZSCA 1PBYA 1U0XA 4YDBA 4A60A 4EQAC 3FYFA 5HZ9A 1SWAA 1QY0A 4QGXA 3TGBA 1S44A 1SWDA 2Z4IA 4TNNA 2RTRB 2GTLN 1MX8A 2KT4B 1FENA 2DJFA 1N0SA 4FBVA 4IAWA 3RKGA 4M6SA 4AZPA 3L4RA 2OVDA 4ZHCA 3AKNA 4YKMA 4I60A 5D45A 1YWDA 4NLIA 1QABE 1SXXA 4LKPA 5FQ6E 5H9NA 3UAQA 1TXLA 5B2AO 3FA6A 4YVBA 4CDEA 1VWGB 4Y5DA 2Z4HA 4QYPA 2AL0X 1SA8A 4YFQA 4GJVA 1LCVA 4GU8A 4HPDA 4QQ1A 4JHQA 3STKA 3QKGA 1JQPA 4O4OA 1SLGB 4DQ3A 4IB8A 1NQMA 3WOVA 2L9CA 1VWIB 3HOEA 1DZJA 2A2GA 5F58A 1ZNKA 2FR3A 3PK2A 5L8OA 2OFBA 1AQBA 3HK1A 3KFHA 4O4UA 3ZUOA 3D9WA 5LJEA 3D4RA 1SXYA 2IZCB 4MVIA 2CBRA 1YUPA 2RCTA 4OELA 4ORRA 2AT5X 1PM1X 5IO6A 3P24A 1YWBA 1Z24A 4COTA 1PTSA 1NDJA 2ZAIA 1OSPO 2WUTA 1KL3A 2WQ9A 1YP6A 1KQWA 3FEKA 5FAZA 5HTEA 4QGVA 2FT9A 2AF5A 2JU3A 1KQXA 2C1SA 3APUA 4O49A 3TF6A 2AKQA 3JQOA 3KVNA 3LTWA 3NPOA 1ZRYA 5LJDA 5LKFA 3F6ZB 5AJCA 3WJCA 1CBRA 3ZQ3A 4AZMA 3OJYC 4AZOA 2LBVA 2OL6O 1DF8A 4Z2VA 1D2UA 4YH0A 1Y55X 4I6SA 3RY2A 4U8UO 1MDCA 1SWLA 1W6FA 3HWGA 3NQ9A 5EPQA 4CPEA 3NR3A 2C1QA 4GETA 1P6PA 1QY2A 1UREA 2R73A 4ZHFA 5HTDA 1KT4A 4GGTA 4TJZA 1O1VA 4B55A 4HFOA 1CBIA 1I4UA 2E4JA 2WR6A 4GGRA 5D48A 1LICA 5H9AA 2A5CA 3Q34A 5KICA 4QRLA 1VYOA 1ACDA 2KTSA 3KFFA 4FBOA 5BVTA 2X8TA 3BU1A 2AMMX 4Y59A 4UU3A 4DCBA 3RDQA 1QY1A 4Y0PA 3VG2A 2QO4A 2KW1A 4TLJA 1HBPA 5CHKA 2RTHB 4EKVA 1H91A 1VPRA 1BRPA 1MVGA 1VWBB 2BHVA 2L67A 2RTBB 2RTFB 1N7YA 3U0DA 2OF9A 2PY1A 4BQUA 4CPHA 3MG5A 5EDBA 1G5WA 1BEBA 2W2AA 3B2IA 4ML7B 5HA0A 1VWPB 3AKMA 4IB9A 3APVA 1G74A 4ORUA 3X00A 2UZ2A 2IZBA 1DZPA 4M7MA 4ZGFA 2QOMA 4Z2PA 1EXSA 1I9HA 2WSJA 1AB0A 1LFOA 1DC9A 1ERBA 2F73A 5HZQA 5K06A 1ZNLA 3BSZE 5EZ2A 4BVMA 4XMDA 3BU9A 3T1DA 1LNMA 1AVEA 1GKAA 5DPQA 3LV4A 3TZSA 2RTAA 2RTJA 4FGIB 4JNJA 4BBOA 4HPAA 1OEJA 2IFBA 4XMHA 3FELA 1N43A 3BRNA 1X89A 1SWKA 3JSQA 5BYPA 4GKCA 3CMPA 4U9CA 2LBAA 3WBGA 1SWTA 1LIEA 1FJ1E 4TKHA 4LZVA 4CV7A 3SZJA 2RTMA 4Z6JA 5FFHA 3FR2A 3SOTA 1VWRB 3APXA 1B8EA 5H9KA 4L3RA 5AEOA 4HWMA 4GE1A 4IAXA 4NNTA 4DQ4A 5JR8A 2WPUA 2XKLA 5LJGA 4A8ZA 5B3MO 5IRWA 4ZR2A 1S2PA 3PDFA 3WJGA 5LKEA 1LUQA 2ZAGA 1SLEB 1HY2A 2ASNX 1NGLA 1GT1A 3OBLA 1B0OA 4O3ZA 3T2WA 3CBCA 4ARHA 1Y52X 2G5LA 3ELZA 1U18A 2DM5A 1GT5A 1OPBA 4AZRA 1OBUA 3VG3A 1GM6A 4D6BA 2X55A 1SRGA 3FIQA 2UYWA 1JMZA 4NW4A 1A57A 1E06A 1FDQA 1KOIA 1VWQB 3KZAA 1DV9A 5DG4A 1RXJA 3WYPA 3ZWEA 1FE3A 1HMSA 4FQBB 4I3BA 2JN3A 2RTGB 3DSZA 4KT5A 4U8UN 1B4MA 2XSTA 1N9YA 2YG2A 1JYJA 2OY1O 3PP6A 4XMFA 5H8TA 1ZNGA 1OEEA 3QQ2A 3GE2A 2A8GA 2OYBO 5FENA 1GKAB 2A13A 1PEEA 1Y53X 1SLFB 1YWAA 2A0AA 4O9SA 2QO5A 4QAEA 1EW3A 3V8UA 4CDDA 5HZ5A 2FS7A 4I9RA 3FA9A 4Z27A 4Y0RA 4CK4A 5HCCC 1CBSA 2WEXA 1IFBA 1ZNDA 3CKGA 1SWSA 1BRQA 3CKFA 4FBRA 3VE2A 3CWKA 4I3CA 1VWNB 1RSUB 1CJ5A 1HXLA 1I78A 3PEDA 2RN4A 1BSYA 3P6FA 3S5XA 2FLJA 1X8OA 4XMCA 5CYBA 5HCDC 5IO5A 3ZW2A 2LA7A 4IMNA 4C5PA 2FRSA 3RE6A 4BJ8A 1G7NA 3B2LA 1VWKB 2RQ0A 5D47A 4CDFA 4TQ2A 1KL4A 2IZIA 2R74A 2OZQA 4IB7A 1ZNHA 3BDRA 2A5BA 2X34A 2JU7A 1EI5A 3WZPA 1LELA 1VWEB 2JU8A 1SREA 4Y0SA 2OY8A 2NNQA 2X56A 4YKOA 3RDSA 1VWOB 2I5VO 4IBAA 1E2TA 3FMZA 4GRJA 4OKAA 5EEDA 4Y0QA 3MVFA 2QM9A 3O22A 1GX9A 4HPBA 1GGLA 1Y9TA 2IZKA 3KFIA 4I3DA 4QZTA 5EDCA 5F6BA 2GTFX 3UEVA 3ZI8A 5K67A 2A3FX 2HZRA 2Y3EA 2AT3X 4ZCBA 1PMPA 3WZNA 3TGCA 1KZWA 1SWCA 1IKEA 1SWBA 3RDUA 3WYQA 1GXAA 2MJIA 3STMX 4PJ2A 2M4LA 2OVSA 3LHNA 4MIRA 3UEXA 3ZW0B 3VG5A 2VFCA 3NQ3A 1BJ7A 4ZHGA 2VDFA 3HPEA 3CBSA 1STPA 1FELA 1SY0A 1K24A 1ICNA 2OVEA 2W2FA 2LB6A 2AT6X 3C78X 3KQ0A 4CSBA 2X32A 3B2HA 1N4JA 3BLGA 3ZUIA 4EFGA 2EU7X 1VWHB 1DZKA 3SLJA 4MVKA 5IRAA 4OMXA 1ML7A 4CPIA 1PBOA 4KC8A 1MX7A 3OD9A 4ORSA 1IIUA 1WUBA 4ZFXA 5AQ6A 1RSTB 2MF6A 3SZHA 5HZ8A 4IABA 3FA7A 3N91A 4BOEA 2FKGA 5HZ6A 2Q9SA 4INNA 1S7DA 2OFMX 2WWPA 1VWCB 1W5RA 4YCHA 2HNXA 5L8IA 2JMBA 3VG4A 5B5FA 2MWHA 2HKDA 1SXUA 1IKJA 4WHIA 5IO7A 2X8SA 1YIVA 2AVIA 3DTQA 4YBPA 3SLTA 2IZJA 3HTYA 3P6DA 4OMWA 2POAA 4U8UM 5D8JA 4ALOA 4NNSA 3RY1A 2OF8A 3FENA 3BY0A 1BWYA 2OL8O 1LIDA 1MUPA 2PI3O 1SWRA 3WJBA 1X8NA 2RTQB 1BM5A 1VWMB 2FKJA 2L5PA 1YWCA 1JBHA 1TOUA 1EPAA 1L6MA 2RTKA 5HWZA 1HXZA 3VHMA 1GT4A 2Q2MA 1JJUA 4QNIA 2KD2A 2AT0X 2WEWA 2QMIA 4ZH9A 2IZHB 5B5GA 1ADLA 2G7BA 3ZZVA 4GH7A 4ZHHA 4NV7A 3JS1A 2FGSA 2C4IA 5HBSA 5LJHA 1CBQA 2OL7A 2RTDB 3C77X 1A3YA 2X8FA 3ELXA 5BVQA 2NNEA 2X45A 3S60A 1D3SA 4GJSA 4RUNA 3FR4A 2CM4A 4ORXA 3PQUA 1KT5A 1SRFA 2ACPX 2BLGA 2CZTA 3P02A 5IRUA 4ZHDA 1SWNA 2CBSA 1VWJB 1T68X 2G78A 2VFBA 2ALLX 3PPTA 3PH6A 2X4MA 4KIIA 1CRBA 1TOWA 2N93A 1A18A 2O62A 3D96A 4JGLA 1HN2A 1SWQA 1TW4A 5IXGA 1BBPA 4OS0A 2Y3FA 2OFRX 5LJKA 1NQNA 2QOSC 1LCWA 4A1YA 3I17A 1KZXA 3VGWA 1LPJA 3NADA 5F6ZA 1N9MA 4XMEA 2DJGA 4QZUA 3WJEA 2WQAE 1JV4A 2HYSA 3HWEA 3PQSA 3RWXA 2CAMA 1FEMA 4AZQA 1T8VA 1QWDA 1QG5A 2Q2PA 4BCSA 1EIOA 1DF3A 2RTPB 4O4SA 3G7XA 3RE5A 4GD9A 1NP1A 2P8GA 2BSZA 4O3YA 2GC9A 3D95A 3VE1A 3ZW1A 1SXWA 3HWDA 4YMYA 3RDOA 3ZW0A 1VWLB 3EBKA 1FTPA 4GZVA 5C0NA 2LKKA 1SWJA 4D6AA 1JMXA 4GNWA 3D97A 4A1HA 1SWUA 2RTIB 5LJCA 3WVMA 5B11O 3WXQA 1JIWI 2YMSA 3VU1A 4BX5A 3Q6LA 3RDXA 4ES7A 1A2DA 3STNA 3EW2A 1KL5A 1SY1A 2LFOA 5JD2A 5D4AA 5LJBA 1AELA 2KTDA 1UYNX 3PECA 3B2KA 3EM0A 3S26A 4MVLA 1EUOA 3MBTA 3IA8A 1AVDA 4GK9A 2AH7X 3WJFA 3FR5A 3RZYA 2RA6A 3U03A 4BX6A 2OFAA 4JO6A 2BC3A 4IMOA 4ON1A 2NNDA 1KT7A 3WZOA 3PH5A 4IB6A 3SLOA 4YBUA 3P6GA 3EMMA 1B56A 4YFRA 5HCEC 3O2YA 4KCAA 1HMRA 2JW1A 5BVSA 3T2XA 3T6FA 4IRWA 5KIDA 1RBPA 1XCAA 2RCQA 3HWFA 1DFVA 1T0VA 3F8AA 4LKTA 1VWDB 1NC9A 4ALBA 1HMTA 1E02A 1Y9LA 3FA8A 1SRIA 4AYHA 3FDCA 4N7CA 5KHPA 1KT6A 1BSOA 1W4TA 4EEJA 2RTLA 3MM0A 3WZQA 1X8PA 4UU2A 3FIDA 1IFCA 2RTOB 4LZUA 3K3LA 4TKJA
chains in the Genus database with same CATH topology
3ZW1B 3UEWA 1E5PA 3OE3A 1JJXA 4XMGA 1OBPA 1UZ2X 1EIIA 1OPAA 1OBQA 2L68A 4NYQA 3H3IA 3NBXX 1GT3A 5F1EA 1LKEA 5F7GA 2CM9A 3WJDA 3NX1A 2MO5A 4YGZA 5HA1A 4QYNA 4LQZA 1JZUA 1BLRA 1G85A 1EALA 4RUUA 4YCEA 1U17A 2FWVA 4U3QA 2RD7C 5AJBA 1X8QA 3RSWA 3ZQ3A 3FW4A 4ID2A 1JJJA 4EXZA 1HQPA 4O3WA 3CQNA 2W2BA 2A2UA 2MHDA 2FTBA 4K19A 2FR2A 2GTLO 4AZNA 2HMBA 1VYGA 2AT8X 3APWA 2X46A 2CZUA 3TGAA 3C76X 4O3XB 4O4XA 1R0UA 4YDAA 4YGGA 2K23A 1I05A 5H9LA 5FQ8E 5EEEA 3U9PC 3E3CA 2QO6A 1RLBE 3S5VA 2JOZA 3BX8A 1EPBA 4I9SA 3VG6A 4PSQA 1AVGI 2K62A 4WFUA 1JYDA 4MISA 4OS3A 2R56A 3EYCA 3NX2A 1LF7A 2GJ5A 1OEKA 5CE4A 3UEUA 3RBYA 1ERXA 2HLVA 2MM3A 2G79A 3EBWA 4EDEA 1E00A 1EQDA 2BS5A 3NQKA 4KH8A 4ZHDA 3IFBA 1QFVA 2BS6A 4ODDA 1IW2A 3P6EA 2F09A 3FEPA 4GDZA 3P6HA 2OVAA 3P6CA 1KXOA 4YGHA 1VYFA 1SY3A 5L8NA 3NP1A 2HZQA 1ALBA 4NYRA 1O1UA 3FW5A 2GTLM 3I0AA 3BS2A 4R0BA 2BT9A 2FS6A 1O8VA 3VPJE 3B2JA 4L1NA 1BSQA 1LIFA 2ACOA 1I04A 3VG7A 4WBKA 4NP1A 3SAOA 3F9DA 1LIBA 4KC7A 1KGLA 2ANSA 4OS8A 1HBQA 4ZGUA 3KFGA 3BX7A 4MVEA 4ZH6A 5HAEA 4WFVA 4GNYA 5B29A 5B27A 2Q4NA 1ZNEA 4N7DA 3O19A 1X8UA 1GX8A 4ORWA 1NP4A 3HOLA 1YP7A 4QGWA 3FLLA 1KT3A 1XKIA 1TVQA 1DZMA 3MX7A 4TKBA 1X71A 1QQSA 1SY2A 1SMPI 2NP1A 5FQ7E 4ZJ0A 4YFPA 3CQRA 4I95A 1ICMA 1I06A 4ORYA 4AW8A 4NLJA 4HPCA 3GAQA 3CR6A 1QFTA 2Q39A 4YDBA 1U0XA 4A60A 4EQAC 3FYFA 5HZ9A 4QGXA 1QY0A 3TGBA 1S44A 2Z4IA 4TNNA 2GTLN 1MX8A 2KT4B 1FENA 4AZPA 1N0SA 4FBVA 4IAWA 3RKGA 4M6SA 4ZHCA 3L4RA 2OVDA 3AKNA 4YKMA 5D45A 1YWDA 4NLIA 1QABE 1SXXA 4LKPA 5FQ6E 5H9NA 3UAQA 1TXLA 3FA6A 2Z4HA 4QYPA 2AL0X 1SA8A 4YFQA 4GU8A 4HPDA 4QQ1A 3STKA 3QKGA 4O4OA 4DQ3A 4IB8A 3WOVA 2L9CA 3HOEA 1DZJA 2A2GA 5F58A 1ZNKA 2FR3A 5L8OA 3HK1A 1AQBA 3KFHA 3ZUOA 4O4UA 5LJEA 3D4RA 1SXYA 4MVIA 2CBRA 1YUPA 2RCTA 4ORRA 2AT5X 1PM1X 5IO6A 3P24A 1YWBA 1Z24A 4COTA 2ZAIA 2WUTA 2WQ9A 3FEKA 1YP6A 1KQWA 5FAZA 4QGVA 5HTEA 2FT9A 2JU3A 1KQXA 3APUA 3TF6A 4O49A 2AKQA 3JQOA 3NPOA 1ZRYA 5LJDA 5LKFA 3F6ZB 5AJCA 3WJCA 1CBRA 4AZOA 4AZMA 3OJYC 2LBVA 1D2UA 4YH0A 4I6SA 4U8UO 1MDCA 3HWGA 3NQ9A 5EPQA 3NR3A 4GETA 1P6PA 1QY2A 1UREA 2R73A 4ZHFA 5HTDA 1KT4A 4TJZA 1O1VA 4HFOA 1CBIA 1I4UA 2E4JA 2WR6A 5D48A 1LICA 5H9AA 5KICA 4QRLA 2KTSA 1ACDA 3KFFA 4FBOA 5BVTA 2X8TA 3BU1A 2AMMX 4UU3A 1QY1A 4Y0PA 3VG2A 2QO4A 2KW1A 4TLJA 1HBPA 1H91A 1VPRA 1BRPA 1MVGA 2BHVA 2L67A 3U0DA 2PY1A 4BQUA 1G5WA 5EDBA 1BEBA 2W2AA 3B2IA 4ML7B 5HA0A 3AKMA 4IB9A 3APVA 1G74A 4ORUA 4M7MA 1DZPA 4ZGFA 1EXSA 2WSJA 1AB0A 1LFOA 1DC9A 1ERBA 2F73A 5HZQA 5K06A 1ZNLA 3BSZE 5EZ2A 4BVMA 4XMDA 3BU9A 3T1DA 1LNMA 1GKAA 5DPQA 3LV4A 3TZSA 4FGIB 4HPAA 1OEJA 2IFBA 4XMHA 3FELA 3BRNA 1X89A 3JSQA 5BYPA 4GKCA 3CMPA 4U9CA 2LBAA 3WBGA 4TKHA 1LIEA 4CV7A 4LZVA 5FFHA 3FR2A 3SOTA 3APXA 1B8EA 5H9KA 4L3RA 5AEOA 4HWMA 4GE1A 4IAXA 4NNTA 4DQ4A 5JR8A 2XKLA 5LJGA 4A8ZA 4ZR2A 1S2PA 3WJGA 5LKEA 2ZAGA 2ASNX 1NGLA 1GT1A 3OBLA 1B0OA 4O3ZA 4ARHA 3CBCA 3ELZA 1U18A 2DM5A 1GT5A 1OPBA 4AZRA 1OBUA 3VG3A 1GM6A 4D6BA 3FIQA 1A57A 4NW4A 1DV9A 1E06A 1FDQA 1KOIA 3KZAA 5DG4A 3ZWEA 1FE3A 1HMSA 4FQBB 4I3BA 2JN3A 1B4MA 3DSZA 4KT5A 4U8UN 2XSTA 2YG2A 1JYJA 3PP6A 4XMFA 5H8TA 1ZNGA 1OEEA 3GE2A 5FENA 1GKAB 2A13A 1PEEA 2A0AA 1YWAA 4O9SA 3V8UA 2QO5A 4QAEA 1EW3A 5HZ5A 2FS7A 4I9RA 3FA9A 4Y0RA 4CK4A 5HCCC 1CBSA 2WEXA 1IFBA 1ZNDA 1BRQA 3VE2A 3CWKA 4I3CA 1CJ5A 3PEDA 2RN4A 1BSYA 3P6FA 3S5XA 2FLJA 1X8OA 4XMCA 5CYBA 5HCDC 5IO5A 3ZW2A 2LA7A 4IMNA 2FRSA 4TQ2A 1G7NA 3B2LA 2RQ0A 5D47A 2R74A 2OZQA 4IB7A 1ZNHA 3BDRA 2JU7A 1EI5A 2JU8A 4Y0SA 2NNQA 4YKOA 4IBAA 3FMZA 4GRJA 5EEDA 4Y0QA 3MVFA 2QM9A 3O22A 1GX9A 4HPBA 1GGLA 1Y9TA 3KFIA 4I3DA 4QZTA 5EDCA 5F6BA 3UEVA 2GTFX 3ZI8A 3TGCA 2A3FX 2HZRA 2AT3X 4ZCBA 1PMPA 1KZWA 1IKEA 1GXAA 2MJIA 3STMX 4PJ2A 2M4LA 2OVSA 3LHNA 4MIRA 3UEXA 3ZW0B 3VG5A 3NQ3A 1BJ7A 4ZHGA 3CBSA 1FELA 1SY0A 1ICNA 2OVEA 2W2FA 2LB6A 2AT6X 3C78X 3KQ0A 4CSBA 3B2HA 3BLGA 3ZUIA 4EFGA 2EU7X 1DZKA 4MVKA 4OMXA 1ML7A 4ZFXA 1PBOA 4KC8A 1MX7A 3OD9A 4ORSA 1IIUA 5AQ6A 5HZ8A 4IABA 3FA7A 3N91A 4BOEA 5HZ6A 2Q9SA 4INNA 1S7DA 2OFMX 2WWPA 4YCHA 5L8IA 2HNXA 2JMBA 3VG4A 2MWHA 1SXUA 1IKJA 4WHIA 5IO7A 2X8SA 1YIVA 4YBPA 3DTQA 3HTYA 3P6DA 4OMWA 2POAA 4U8UM 5D8JA 4ALOA 4NNSA 1BWYA 3FENA 3BY0A 1LIDA 1MUPA 3WJBA 1X8NA 1BM5A 2L5PA 1YWCA 1JBHA 1TOUA 1EPAA 1L6MA 5HWZA 1GT4A 2Q2MA 4QNIA 4ZH9A 2KD2A 2AT0X 2WEWA 2QMIA 1ADLA 2G7BA 3ZZVA 4GH7A 4ZHHA 3JS1A 5LJHA 5HBSA 1CBQA 3ELXA 5BVQA 3C77X 1A3YA 2X8FA 2NNEA 2X45A 3S60A 1D3SA 4RUNA 3FR4A 2CM4A 4ORXA 3PQUA 1KT5A 2ACPX 2CZTA 2BLGA 3P02A 2CBSA 1T68X 2G78A 3PPTA 2ALLX 3PH6A 4KIIA 1CRBA 1TOWA 2N93A 1A18A 2O62A 3D96A 4JGLA 1HN2A 1TW4A 1BBPA 4OS0A 2OFRX 5LJKA 2QOSC 4A1YA 3I17A 1KZXA 1LPJA 3NADA 5F6ZA 4XMEA 3WJEA 4QZUA 4FBRA 2WQAE 1JV4A 2HYSA 3HWEA 3PQSA 3RWXA 4AZQA 1FEMA 1T8VA 1QWDA 1QG5A 2Q2PA 1EIOA 1DF3A 4O4SA 3G7XA 1NP1A 2P8GA 3VE1A 4O3YA 2GC9A 3D95A 3ZW1A 1SXWA 3HWDA 4YMYA 3ZW0A 3EBKA 1FTPA 4GZVA 5C0NA 2LKKA 4D6AA 4GNWA 3D97A 4A1HA 5LJCA 3WVMA 3WXQA 1JIWI 2YMSA 3VU1A 3Q6LA 4ES7A 1A2DA 3STNA 1SY1A 2LFOA 5LJBA 5D4AA 1AELA 2KTDA 3PECA 3B2KA 3EM0A 3S26A 4MVLA 1EUOA 3MBTA 3IA8A 4GK9A 2AH7X 3WJFA 3FR5A 3RZYA 2RA6A 3U03A 4IMOA 4ON1A 2NNDA 1KT7A 3PH5A 4IB6A 4YBUA 3P6GA 3EMMA 1B56A 4YFRA 5HCEC 3O2YA 4KCAA 1HMRA 2JW1A 5BVSA 5KIDA 1RBPA 1XCAA 2RCQA 3HWFA 1DFVA 1T0VA 3F8AA 4LKTA 4ALBA 1HMTA 1E02A 1Y9LA 3FA8A 4AYHA 4N7CA 5KHPA 1KT6A 1BSOA 4EEJA 1X8PA 4UU2A 1IFCA 4LZUA 3K3LA 4TKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INN A; 
#chains in the Genus database with same CATH topology
 3ZW1 B;  3UEW A;  1E5P A;  3OE3 A;  1JJX A;  3AEH A;  4XMG A;  1OBP A;  2RTC B;  1UZ2 X;  1EII A;  1SRJ A;  5B10 O;  3EC5 A;  1KFF A;  2IZF B;  1OPA A;  1OBQ A;  2F01 A;  2L68 A;  4NYQ A;  3H3I A;  3NBX X;  1RXH A;  1GT3 A;  5F1E A;  1LKE A;  4BGF A;  5F7G A;  2CM9 A;  3WJD A;  3NX1 A;  2MO5 A;  4YGZ A;  5HA1 A;  1IJ8 A;  4LQZ A;  4QYN A;  4BX5 B;  4DNE A;  1JZU A;  1Y0G A;  1BLR A;  1G85 A;  1EAL A;  3RDM A;  4RUU A;  4YCE A;  1U17 A;  2FWV A;  4U3Q A;  2RD7 C;  5AJB A;  1X8Q A;  3RSW A;  3SZI A;  3FW4 A;  1LDO A;  2Y32 A;  4ID2 A;  1JJJ A;  4EXZ A;  1HQP A;  1K3B A;  1STR B;  3CQN A;  4O3W A;  2W2B A;  2A2U A;  2MHD A;  3EW1 A;  2FTB A;  4K19 A;  2FR2 A;  2GTL O;  4AZN A;  4BX6 B;  2HMB A;  1VYG A;  2AT8 X;  3APW A;  2X46 A;  1MK5 A;  2CZU A;  3TGA A;  3C76 X;  1SWP A;  4O3X B;  4O4X A;  1NBX A;  1R0U A;  4YDA A;  4YGG A;  2K23 A;  1I05 A;  1MEP A;  4BX7 A;  5H9L A;  5FQ8 E;  5EEE A;  2IZD B;  3U9P C;  1SWG A;  4Z28 A;  3E3C A;  2QO6 A;  1RLB E;  1RAV A;  3S5V A;  2IZA A;  2JOZ A;  3BX8 A;  2IZG B;  1EPB A;  4I9S A;  3VG6 A;  4PSQ A;  1SLD B;  1AVG I;  1UYO X;  2K62 A;  4WFU A;  1JYD A;  4MIS A;  4MEE A;  4OS3 A;  2R56 A;  3EYC A;  3NX2 A;  4CPF A;  1VWF B;  1LF7 A;  2GJ5 A;  1OEK A;  4CDC A;  5L3Y A;  4U46 A;  5CE4 A;  3UEU A;  1SWE A;  1ERX A;  2HLV A;  2MM3 A;  2G79 A;  3EBW A;  3RBY A;  1E00 A;  1EQD A;  2BS5 A;  1MOY A;  3NQK A;  2RTE B;  3IFB A;  4KH8 A;  4EDE A;  1QFV A;  2BS6 A;  4ODD A;  1IW2 A;  1SRH A;  3P6E A;  2F09 A;  3FEP A;  4GDZ A;  3P6H A;  2OVA A;  3P6C A;  1KXO A;  4YGH A;  1VYF A;  1SY3 A;  5L8N A;  3NP1 A;  2HZQ A;  1ALB A;  1SWF A;  2OY7 A;  4NYR A;  1O1U A;  1RXK A;  3FW5 A;  2GTL M;  4GDA A;  3AUM O;  3I0A A;  3BS2 A;  4R0B A;  2BT9 A;  2FS6 A;  2QCB A;  1O8V A;  1VWA B;  2G8C O;  3VPJ E;  3B2J A;  4L1N A;  1BSQ A;  1LIF A;  2ACO A;  1I04 A;  3VG7 A;  4WBK A;  4GUZ A;  4NP1 A;  3SAO A;  3F9D A;  2GH7 A;  4Z2O A;  1LIB A;  4KC7 A;  1KGL A;  1STS B;  2ANS A;  4OS8 A;  5F2B A;  1HBQ A;  5K68 A;  2OY5 O;  3KFG A;  3BX7 A;  4MVE A;  4ZH6 A;  3VHH A;  4BX7 B;  4ZGU A;  4WFV A;  5HAE A;  4GNY A;  5B29 A;  5B27 A;  2Q4N A;  1GX3 A;  1ZNE A;  2I5Z O;  4N7D A;  2JGS A;  3O19 A;  1X8U A;  1GX8 A;  4GGZ A;  4NV8 A;  1SWO A;  1NP4 A;  1SWH A;  3HOL A;  4ORW A;  1LCZ A;  1WBI A;  4OEM A;  1YP7 A;  4QGW A;  3FLL A;  1KT3 A;  1XKI A;  1TVQ A;  2RTN B;  3VHI A;  1DZM A;  3MX7 A;  1MM9 A;  4TKB A;  1X71 A;  1QQS A;  1SY2 A;  2FHL A;  1SMP I;  2NP1 A;  5CSE A;  5FQ7 E;  2IZE B;  1HQQ A;  4ZJ0 A;  4YFP A;  2IZL B;  2FHN X;  3CQR A;  4I95 A;  4CPH B;  1ICM A;  1I06 A;  4ORY A;  3T6L A;  4NLJ A;  4AW8 A;  4HPC A;  1LDQ A;  3CR6 A;  3GAQ A;  1QFT A;  2Q39 A;  2ZSC A;  1PBY A;  1U0X A;  4YDB A;  4A60 A;  4EQA C;  3FYF A;  5HZ9 A;  1SWA A;  1QY0 A;  4QGX A;  3TGB A;  1S44 A;  1SWD A;  2Z4I A;  4TNN A;  2RTR B;  2GTL N;  1MX8 A;  2KT4 B;  1FEN A;  2DJF A;  1N0S A;  4FBV A;  4IAW A;  3RKG A;  4M6S A;  4AZP A;  3L4R A;  2OVD A;  4ZHC A;  3AKN A;  4YKM A;  4I60 A;  5D45 A;  1YWD A;  4NLI A;  1QAB E;  1SXX A;  4LKP A;  5FQ6 E;  5H9N A;  3UAQ A;  1TXL A;  5B2A O;  3FA6 A;  4YVB A;  4CDE A;  1VWG B;  4Y5D A;  2Z4H A;  4QYP A;  2AL0 X;  1SA8 A;  4YFQ A;  4GJV A;  1LCV A;  4GU8 A;  4HPD A;  4QQ1 A;  4JHQ A;  3STK A;  3QKG A;  1JQP A;  4O4O A;  1SLG B;  4DQ3 A;  4IB8 A;  1NQM A;  3WOV A;  2L9C A;  1VWI B;  3HOE A;  1DZJ A;  2A2G A;  5F58 A;  1ZNK A;  2FR3 A;  3PK2 A;  5L8O A;  2OFB A;  1AQB A;  3HK1 A;  3KFH A;  4O4U A;  3ZUO A;  3D9W A;  5LJE A;  3D4R A;  1SXY A;  2IZC B;  4MVI A;  2CBR A;  1YUP A;  2RCT A;  4OEL A;  4ORR A;  2AT5 X;  1PM1 X;  5IO6 A;  3P24 A;  1YWB A;  1Z24 A;  4COT A;  1PTS A;  1NDJ A;  2ZAI A;  1OSP O;  2WUT A;  1KL3 A;  2WQ9 A;  1YP6 A;  1KQW A;  3FEK A;  5FAZ A;  5HTE A;  4QGV A;  2FT9 A;  2AF5 A;  2JU3 A;  1KQX A;  2C1S A;  3APU A;  4O49 A;  3TF6 A;  2AKQ A;  3JQO A;  3KVN A;  3LTW A;  3NPO A;  1ZRY A;  5LJD A;  5LKF A;  3F6Z B;  5AJC A;  3WJC A;  1CBR A;  3ZQ3 A;  4AZM A;  3OJY C;  4AZO A;  2LBV A;  2OL6 O;  1DF8 A;  4Z2V A;  1D2U A;  4YH0 A;  1Y55 X;  4I6S A;  3RY2 A;  4U8U O;  1MDC A;  1SWL A;  1W6F A;  3HWG A;  3NQ9 A;  5EPQ A;  4CPE A;  3NR3 A;  2C1Q A;  4GET A;  1P6P A;  1QY2 A;  1URE A;  2R73 A;  4ZHF A;  5HTD A;  1KT4 A;  4GGT A;  4TJZ A;  1O1V A;  4B55 A;  4HFO A;  1CBI A;  1I4U A;  2E4J A;  2WR6 A;  4GGR A;  5D48 A;  1LIC A;  5H9A A;  2A5C A;  3Q34 A;  5KIC A;  4QRL A;  1VYO A;  1ACD A;  2KTS A;  3KFF A;  4FBO A;  5BVT A;  2X8T A;  3BU1 A;  2AMM X;  4Y59 A;  4UU3 A;  4DCB A;  3RDQ A;  1QY1 A;  4Y0P A;  3VG2 A;  2QO4 A;  2KW1 A;  4TLJ A;  1HBP A;  5CHK A;  2RTH B;  4EKV A;  1H91 A;  1VPR A;  1BRP A;  1MVG A;  1VWB B;  2BHV A;  2L67 A;  2RTB B;  2RTF B;  1N7Y A;  3U0D A;  2OF9 A;  2PY1 A;  4BQU A;  4CPH A;  3MG5 A;  5EDB A;  1G5W A;  1BEB A;  2W2A A;  3B2I A;  4ML7 B;  5HA0 A;  1VWP B;  3AKM A;  4IB9 A;  3APV A;  1G74 A;  4ORU A;  3X00 A;  2UZ2 A;  2IZB A;  1DZP A;  4M7M A;  4ZGF A;  2QOM A;  4Z2P A;  1EXS A;  1I9H A;  2WSJ A;  1AB0 A;  1LFO A;  1DC9 A;  1ERB A;  2F73 A;  5HZQ A;  5K06 A;  1ZNL A;  3BSZ E;  5EZ2 A;  4BVM A;  4XMD A;  3BU9 A;  3T1D A;  1LNM A;  1AVE A;  1GKA A;  5DPQ A;  3LV4 A;  3TZS A;  2RTA A;  2RTJ A;  4FGI B;  4JNJ A;  4BBO A;  4HPA A;  1OEJ A;  2IFB A;  4XMH A;  3FEL A;  1N43 A;  3BRN A;  1X89 A;  1SWK A;  3JSQ A;  5BYP A;  4GKC A;  3CMP A;  4U9C A;  2LBA A;  3WBG A;  1SWT A;  1LIE A;  1FJ1 E;  4TKH A;  4LZV A;  4CV7 A;  3SZJ A;  2RTM A;  4Z6J A;  5FFH A;  3FR2 A;  3SOT A;  1VWR B;  3APX A;  1B8E A;  5H9K A;  4L3R A;  5AEO A;  4HWM A;  4GE1 A;  4IAX A;  4NNT A;  4DQ4 A;  5JR8 A;  2WPU A;  2XKL A;  5LJG A;  4A8Z A;  5B3M O;  5IRW A;  4ZR2 A;  1S2P A;  3PDF A;  3WJG A;  5LKE A;  1LUQ A;  2ZAG A;  1SLE B;  1HY2 A;  2ASN X;  1NGL A;  1GT1 A;  3OBL A;  1B0O A;  4O3Z A;  3T2W A;  3CBC A;  4ARH A;  1Y52 X;  2G5L A;  3ELZ A;  1U18 A;  2DM5 A;  1GT5 A;  1OPB A;  4AZR A;  1OBU A;  3VG3 A;  1GM6 A;  4D6B A;  2X55 A;  1SRG A;  3FIQ A;  2UYW A;  1JMZ A;  4NW4 A;  1A57 A;  1E06 A;  1FDQ A;  1KOI A;  1VWQ B;  3KZA A;  1DV9 A;  5DG4 A;  1RXJ A;  3WYP A;  3ZWE A;  1FE3 A;  1HMS A;  4FQB B;  4I3B A;  2JN3 A;  2RTG B;  3DSZ A;  4KT5 A;  4U8U N;  1B4M A;  2XST A;  1N9Y A;  2YG2 A;  1JYJ A;  2OY1 O;  3PP6 A;  4XMF A;  5H8T A;  1ZNG A;  1OEE A;  3QQ2 A;  3GE2 A;  2A8G A;  2OYB O;  5FEN A;  1GKA B;  2A13 A;  1PEE A;  1Y53 X;  1SLF B;  1YWA A;  2A0A A;  4O9S A;  2QO5 A;  4QAE A;  1EW3 A;  3V8U A;  4CDD A;  5HZ5 A;  2FS7 A;  4I9R A;  3FA9 A;  4Z27 A;  4Y0R A;  4CK4 A;  5HCC C;  1CBS A;  2WEX A;  1IFB A;  1ZND A;  3CKG A;  1SWS A;  1BRQ A;  3CKF A;  4FBR A;  3VE2 A;  3CWK A;  4I3C A;  1VWN B;  1RSU B;  1CJ5 A;  1HXL A;  1I78 A;  3PED A;  2RN4 A;  1BSY A;  3P6F A;  3S5X A;  2FLJ A;  1X8O A;  4XMC A;  5CYB A;  5HCD C;  5IO5 A;  3ZW2 A;  2LA7 A;  4IMN A;  4C5P A;  2FRS A;  3RE6 A;  4BJ8 A;  1G7N A;  3B2L A;  1VWK B;  2RQ0 A;  5D47 A;  4CDF A;  4TQ2 A;  1KL4 A;  2IZI A;  2R74 A;  2OZQ A;  4IB7 A;  1ZNH A;  3BDR A;  2A5B A;  2X34 A;  2JU7 A;  1EI5 A;  3WZP A;  1LEL A;  1VWE B;  2JU8 A;  1SRE A;  4Y0S A;  2OY8 A;  2NNQ A;  2X56 A;  4YKO A;  3RDS A;  1VWO B;  2I5V O;  4IBA A;  1E2T A;  3FMZ A;  4GRJ A;  4OKA A;  5EED A;  4Y0Q A;  3MVF A;  2QM9 A;  3O22 A;  1GX9 A;  4HPB A;  1GGL A;  1Y9T A;  2IZK A;  3KFI A;  4I3D A;  4QZT A;  5EDC A;  5F6B A;  2GTF X;  3UEV A;  3ZI8 A;  5K67 A;  2A3F X;  2HZR A;  2Y3E A;  2AT3 X;  4ZCB A;  1PMP A;  3WZN A;  3TGC A;  1KZW A;  1SWC A;  1IKE A;  1SWB A;  3RDU A;  3WYQ A;  1GXA A;  2MJI A;  3STM X;  4PJ2 A;  2M4L A;  2OVS A;  3LHN A;  4MIR A;  3UEX A;  3ZW0 B;  3VG5 A;  2VFC A;  3NQ3 A;  1BJ7 A;  4ZHG A;  2VDF A;  3HPE A;  3CBS A;  1STP A;  1FEL A;  1SY0 A;  1K24 A;  1ICN A;  2OVE A;  2W2F A;  2LB6 A;  2AT6 X;  3C78 X;  3KQ0 A;  4CSB A;  2X32 A;  3B2H A;  1N4J A;  3BLG A;  3ZUI A;  4EFG A;  2EU7 X;  1VWH B;  1DZK A;  3SLJ A;  4MVK A;  5IRA A;  4OMX A;  1ML7 A;  4CPI A;  1PBO A;  4KC8 A;  1MX7 A;  3OD9 A;  4ORS A;  1IIU A;  1WUB A;  4ZFX A;  5AQ6 A;  1RST B;  2MF6 A;  3SZH A;  5HZ8 A;  4IAB A;  3FA7 A;  3N91 A;  4BOE A;  2FKG A;  5HZ6 A;  2Q9S A;  4INN A;  1S7D A;  2OFM X;  2WWP A;  1VWC B;  1W5R A;  4YCH A;  2HNX A;  5L8I A;  2JMB A;  3VG4 A;  5B5F A;  2MWH A;  2HKD A;  1SXU A;  1IKJ A;  4WHI A;  5IO7 A;  2X8S A;  1YIV A;  2AVI A;  3DTQ A;  4YBP A;  3SLT A;  2IZJ A;  3HTY A;  3P6D A;  4OMW A;  2POA A;  4U8U M;  5D8J A;  4ALO A;  4NNS A;  3RY1 A;  2OF8 A;  3FEN A;  3BY0 A;  1BWY A;  2OL8 O;  1LID A;  1MUP A;  2PI3 O;  1SWR A;  3WJB A;  1X8N A;  2RTQ B;  1BM5 A;  1VWM B;  2FKJ A;  2L5P A;  1YWC A;  1JBH A;  1TOU A;  1EPA A;  1L6M A;  2RTK A;  5HWZ A;  1HXZ A;  3VHM A;  1GT4 A;  2Q2M A;  1JJU A;  4QNI A;  2KD2 A;  2AT0 X;  2WEW A;  2QMI A;  4ZH9 A;  2IZH B;  5B5G A;  1ADL A;  2G7B A;  3ZZV A;  4GH7 A;  4ZHH A;  4NV7 A;  3JS1 A;  2FGS A;  2C4I A;  5HBS A;  5LJH A;  1CBQ A;  2OL7 A;  2RTD B;  3C77 X;  1A3Y A;  2X8F A;  3ELX A;  5BVQ A;  2NNE A;  2X45 A;  3S60 A;  1D3S A;  4GJS A;  4RUN A;  3FR4 A;  2CM4 A;  4ORX A;  3PQU A;  1KT5 A;  1SRF A;  2ACP X;  2BLG A;  2CZT A;  3P02 A;  5IRU A;  4ZHD A;  1SWN A;  2CBS A;  1VWJ B;  1T68 X;  2G78 A;  2VFB A;  2ALL X;  3PPT A;  3PH6 A;  2X4M A;  4KII A;  1CRB A;  1TOW A;  2N93 A;  1A18 A;  2O62 A;  3D96 A;  4JGL A;  1HN2 A;  1SWQ A;  1TW4 A;  5IXG A;  1BBP A;  4OS0 A;  2Y3F A;  2OFR X;  5LJK A;  1NQN A;  2QOS C;  1LCW A;  4A1Y A;  3I17 A;  1KZX A;  3VGW A;  1LPJ A;  3NAD A;  5F6Z A;  1N9M A;  4XME A;  2DJG A;  4QZU A;  3WJE A;  2WQA E;  1JV4 A;  2HYS A;  3HWE A;  3PQS A;  3RWX A;  2CAM A;  1FEM A;  4AZQ A;  1T8V A;  1QWD A;  1QG5 A;  2Q2P A;  4BCS A;  1EIO A;  1DF3 A;  2RTP B;  4O4S A;  3G7X A;  3RE5 A;  4GD9 A;  1NP1 A;  2P8G A;  2BSZ A;  4O3Y A;  2GC9 A;  3D95 A;  3VE1 A;  3ZW1 A;  1SXW A;  3HWD A;  4YMY A;  3RDO A;  3ZW0 A;  1VWL B;  3EBK A;  1FTP A;  4GZV A;  5C0N A;  2LKK A;  1SWJ A;  4D6A A;  1JMX A;  4GNW A;  3D97 A;  4A1H A;  1SWU A;  2RTI B;  5LJC A;  3WVM A;  5B11 O;  3WXQ A;  1JIW I;  2YMS A;  3VU1 A;  4BX5 A;  3Q6L A;  3RDX A;  4ES7 A;  1A2D A;  3STN A;  3EW2 A;  1KL5 A;  1SY1 A;  2LFO A;  5JD2 A;  5D4A A;  5LJB A;  1AEL A;  2KTD A;  1UYN X;  3PEC A;  3B2K A;  3EM0 A;  3S26 A;  4MVL A;  1EUO A;  3MBT A;  3IA8 A;  1AVD A;  4GK9 A;  2AH7 X;  3WJF A;  3FR5 A;  3RZY A;  2RA6 A;  3U03 A;  4BX6 A;  2OFA A;  4JO6 A;  2BC3 A;  4IMO A;  4ON1 A;  2NND A;  1KT7 A;  3WZO A;  3PH5 A;  4IB6 A;  3SLO A;  4YBU A;  3P6G A;  3EMM A;  1B56 A;  4YFR A;  5HCE C;  3O2Y A;  4KCA A;  1HMR A;  2JW1 A;  5BVS A;  3T2X A;  3T6F A;  4IRW A;  5KID A;  1RBP A;  1XCA A;  2RCQ A;  3HWF A;  1DFV A;  1T0V A;  3F8A A;  4LKT A;  1VWD B;  1NC9 A;  4ALB A;  1HMT A;  1E02 A;  1Y9L A;  3FA8 A;  1SRI A;  4AYH A;  3FDC A;  4N7C A;  5KHP A;  1KT6 A;  1BSO A;  1W4T A;  4EEJ A;  2RTL A;  3MM0 A;  3WZQ A;  1X8P A;  4UU2 A;  3FID A;  1IFC A;  2RTO B;  4LZU A;  3K3L A;  4TKJ A; 
#chains in the Genus database with same CATH homology
 3ZW1 B;  3UEW A;  1E5P A;  3OE3 A;  1JJX A;  4XMG A;  1OBP A;  1UZ2 X;  1EII A;  1OPA A;  1OBQ A;  2L68 A;  4NYQ A;  3H3I A;  3NBX X;  1GT3 A;  5F1E A;  1LKE A;  5F7G A;  2CM9 A;  3WJD A;  3NX1 A;  2MO5 A;  4YGZ A;  5HA1 A;  4QYN A;  4LQZ A;  1JZU A;  1BLR A;  1G85 A;  1EAL A;  4RUU A;  4YCE A;  1U17 A;  2FWV A;  4U3Q A;  2RD7 C;  5AJB A;  1X8Q A;  3RSW A;  3ZQ3 A;  3FW4 A;  4ID2 A;  1JJJ A;  4EXZ A;  1HQP A;  4O3W A;  3CQN A;  2W2B A;  2A2U A;  2MHD A;  2FTB A;  4K19 A;  2FR2 A;  2GTL O;  4AZN A;  2HMB A;  1VYG A;  2AT8 X;  3APW A;  2X46 A;  2CZU A;  3TGA A;  3C76 X;  4O3X B;  4O4X A;  1R0U A;  4YDA A;  4YGG A;  2K23 A;  1I05 A;  5H9L A;  5FQ8 E;  5EEE A;  3U9P C;  3E3C A;  2QO6 A;  1RLB E;  3S5V A;  2JOZ A;  3BX8 A;  1EPB A;  4I9S A;  3VG6 A;  4PSQ A;  1AVG I;  2K62 A;  4WFU A;  1JYD A;  4MIS A;  4OS3 A;  2R56 A;  3EYC A;  3NX2 A;  1LF7 A;  2GJ5 A;  1OEK A;  5CE4 A;  3UEU A;  3RBY A;  1ERX A;  2HLV A;  2MM3 A;  2G79 A;  3EBW A;  4EDE A;  1E00 A;  1EQD A;  2BS5 A;  3NQK A;  4KH8 A;  4ZHD A;  3IFB A;  1QFV A;  2BS6 A;  4ODD A;  1IW2 A;  3P6E A;  2F09 A;  3FEP A;  4GDZ A;  3P6H A;  2OVA A;  3P6C A;  1KXO A;  4YGH A;  1VYF A;  1SY3 A;  5L8N A;  3NP1 A;  2HZQ A;  1ALB A;  4NYR A;  1O1U A;  3FW5 A;  2GTL M;  3I0A A;  3BS2 A;  4R0B A;  2BT9 A;  2FS6 A;  1O8V A;  3VPJ E;  3B2J A;  4L1N A;  1BSQ A;  1LIF A;  2ACO A;  1I04 A;  3VG7 A;  4WBK A;  4NP1 A;  3SAO A;  3F9D A;  1LIB A;  4KC7 A;  1KGL A;  2ANS A;  4OS8 A;  1HBQ A;  4ZGU A;  3KFG A;  3BX7 A;  4MVE A;  4ZH6 A;  5HAE A;  4WFV A;  4GNY A;  5B29 A;  5B27 A;  2Q4N A;  1ZNE A;  4N7D A;  3O19 A;  1X8U A;  1GX8 A;  4ORW A;  1NP4 A;  3HOL A;  1YP7 A;  4QGW A;  3FLL A;  1KT3 A;  1XKI A;  1TVQ A;  1DZM A;  3MX7 A;  4TKB A;  1X71 A;  1QQS A;  1SY2 A;  1SMP I;  2NP1 A;  5FQ7 E;  4ZJ0 A;  4YFP A;  3CQR A;  4I95 A;  1ICM A;  1I06 A;  4ORY A;  4AW8 A;  4NLJ A;  4HPC A;  3GAQ A;  3CR6 A;  1QFT A;  2Q39 A;  4YDB A;  1U0X A;  4A60 A;  4EQA C;  3FYF A;  5HZ9 A;  4QGX A;  1QY0 A;  3TGB A;  1S44 A;  2Z4I A;  4TNN A;  2GTL N;  1MX8 A;  2KT4 B;  1FEN A;  4AZP A;  1N0S A;  4FBV A;  4IAW A;  3RKG A;  4M6S A;  4ZHC A;  3L4R A;  2OVD A;  3AKN A;  4YKM A;  5D45 A;  1YWD A;  4NLI A;  1QAB E;  1SXX A;  4LKP A;  5FQ6 E;  5H9N A;  3UAQ A;  1TXL A;  3FA6 A;  2Z4H A;  4QYP A;  2AL0 X;  1SA8 A;  4YFQ A;  4GU8 A;  4HPD A;  4QQ1 A;  3STK A;  3QKG A;  4O4O A;  4DQ3 A;  4IB8 A;  3WOV A;  2L9C A;  3HOE A;  1DZJ A;  2A2G A;  5F58 A;  1ZNK A;  2FR3 A;  5L8O A;  3HK1 A;  1AQB A;  3KFH A;  3ZUO A;  4O4U A;  5LJE A;  3D4R A;  1SXY A;  4MVI A;  2CBR A;  1YUP A;  2RCT A;  4ORR A;  2AT5 X;  1PM1 X;  5IO6 A;  3P24 A;  1YWB A;  1Z24 A;  4COT A;  2ZAI A;  2WUT A;  2WQ9 A;  3FEK A;  1YP6 A;  1KQW A;  5FAZ A;  4QGV A;  5HTE A;  2FT9 A;  2JU3 A;  1KQX A;  3APU A;  3TF6 A;  4O49 A;  2AKQ A;  3JQO A;  3NPO A;  1ZRY A;  5LJD A;  5LKF A;  3F6Z B;  5AJC A;  3WJC A;  1CBR A;  4AZO A;  4AZM A;  3OJY C;  2LBV A;  1D2U A;  4YH0 A;  4I6S A;  4U8U O;  1MDC A;  3HWG A;  3NQ9 A;  5EPQ A;  3NR3 A;  4GET A;  1P6P A;  1QY2 A;  1URE A;  2R73 A;  4ZHF A;  5HTD A;  1KT4 A;  4TJZ A;  1O1V A;  4HFO A;  1CBI A;  1I4U A;  2E4J A;  2WR6 A;  5D48 A;  1LIC A;  5H9A A;  5KIC A;  4QRL A;  2KTS A;  1ACD A;  3KFF A;  4FBO A;  5BVT A;  2X8T A;  3BU1 A;  2AMM X;  4UU3 A;  1QY1 A;  4Y0P A;  3VG2 A;  2QO4 A;  2KW1 A;  4TLJ A;  1HBP A;  1H91 A;  1VPR A;  1BRP A;  1MVG A;  2BHV A;  2L67 A;  3U0D A;  2PY1 A;  4BQU A;  1G5W A;  5EDB A;  1BEB A;  2W2A A;  3B2I A;  4ML7 B;  5HA0 A;  3AKM A;  4IB9 A;  3APV A;  1G74 A;  4ORU A;  4M7M A;  1DZP A;  4ZGF A;  1EXS A;  2WSJ A;  1AB0 A;  1LFO A;  1DC9 A;  1ERB A;  2F73 A;  5HZQ A;  5K06 A;  1ZNL A;  3BSZ E;  5EZ2 A;  4BVM A;  4XMD A;  3BU9 A;  3T1D A;  1LNM A;  1GKA A;  5DPQ A;  3LV4 A;  3TZS A;  4FGI B;  4HPA A;  1OEJ A;  2IFB A;  4XMH A;  3FEL A;  3BRN A;  1X89 A;  3JSQ A;  5BYP A;  4GKC A;  3CMP A;  4U9C A;  2LBA A;  3WBG A;  4TKH A;  1LIE A;  4CV7 A;  4LZV A;  5FFH A;  3FR2 A;  3SOT A;  3APX A;  1B8E A;  5H9K A;  4L3R A;  5AEO A;  4HWM A;  4GE1 A;  4IAX A;  4NNT A;  4DQ4 A;  5JR8 A;  2XKL A;  5LJG A;  4A8Z A;  4ZR2 A;  1S2P A;  3WJG A;  5LKE A;  2ZAG A;  2ASN X;  1NGL A;  1GT1 A;  3OBL A;  1B0O A;  4O3Z A;  4ARH A;  3CBC A;  3ELZ A;  1U18 A;  2DM5 A;  1GT5 A;  1OPB A;  4AZR A;  1OBU A;  3VG3 A;  1GM6 A;  4D6B A;  3FIQ A;  1A57 A;  4NW4 A;  1DV9 A;  1E06 A;  1FDQ A;  1KOI A;  3KZA A;  5DG4 A;  3ZWE A;  1FE3 A;  1HMS A;  4FQB B;  4I3B A;  2JN3 A;  1B4M A;  3DSZ A;  4KT5 A;  4U8U N;  2XST A;  2YG2 A;  1JYJ A;  3PP6 A;  4XMF A;  5H8T A;  1ZNG A;  1OEE A;  3GE2 A;  5FEN A;  1GKA B;  2A13 A;  1PEE A;  2A0A A;  1YWA A;  4O9S A;  3V8U A;  2QO5 A;  4QAE A;  1EW3 A;  5HZ5 A;  2FS7 A;  4I9R A;  3FA9 A;  4Y0R A;  4CK4 A;  5HCC C;  1CBS A;  2WEX A;  1IFB A;  1ZND A;  1BRQ A;  3VE2 A;  3CWK A;  4I3C A;  1CJ5 A;  3PED A;  2RN4 A;  1BSY A;  3P6F A;  3S5X A;  2FLJ A;  1X8O A;  4XMC A;  5CYB A;  5HCD C;  5IO5 A;  3ZW2 A;  2LA7 A;  4IMN A;  2FRS A;  4TQ2 A;  1G7N A;  3B2L A;  2RQ0 A;  5D47 A;  2R74 A;  2OZQ A;  4IB7 A;  1ZNH A;  3BDR A;  2JU7 A;  1EI5 A;  2JU8 A;  4Y0S A;  2NNQ A;  4YKO A;  4IBA A;  3FMZ A;  4GRJ A;  5EED A;  4Y0Q A;  3MVF A;  2QM9 A;  3O22 A;  1GX9 A;  4HPB A;  1GGL A;  1Y9T A;  3KFI A;  4I3D A;  4QZT A;  5EDC A;  5F6B A;  3UEV A;  2GTF X;  3ZI8 A;  3TGC A;  2A3F X;  2HZR A;  2AT3 X;  4ZCB A;  1PMP A;  1KZW A;  1IKE A;  1GXA A;  2MJI A;  3STM X;  4PJ2 A;  2M4L A;  2OVS A;  3LHN A;  4MIR A;  3UEX A;  3ZW0 B;  3VG5 A;  3NQ3 A;  1BJ7 A;  4ZHG A;  3CBS A;  1FEL A;  1SY0 A;  1ICN A;  2OVE A;  2W2F A;  2LB6 A;  2AT6 X;  3C78 X;  3KQ0 A;  4CSB A;  3B2H A;  3BLG A;  3ZUI A;  4EFG A;  2EU7 X;  1DZK A;  4MVK A;  4OMX A;  1ML7 A;  4ZFX A;  1PBO A;  4KC8 A;  1MX7 A;  3OD9 A;  4ORS A;  1IIU A;  5AQ6 A;  5HZ8 A;  4IAB A;  3FA7 A;  3N91 A;  4BOE A;  5HZ6 A;  2Q9S A;  4INN A;  1S7D A;  2OFM X;  2WWP A;  4YCH A;  5L8I A;  2HNX A;  2JMB A;  3VG4 A;  2MWH A;  1SXU A;  1IKJ A;  4WHI A;  5IO7 A;  2X8S A;  1YIV A;  4YBP A;  3DTQ A;  3HTY A;  3P6D A;  4OMW A;  2POA A;  4U8U M;  5D8J A;  4ALO A;  4NNS A;  1BWY A;  3FEN A;  3BY0 A;  1LID A;  1MUP A;  3WJB A;  1X8N A;  1BM5 A;  2L5P A;  1YWC A;  1JBH A;  1TOU A;  1EPA A;  1L6M A;  5HWZ A;  1GT4 A;  2Q2M A;  4QNI A;  4ZH9 A;  2KD2 A;  2AT0 X;  2WEW A;  2QMI A;  1ADL A;  2G7B A;  3ZZV A;  4GH7 A;  4ZHH A;  3JS1 A;  5LJH A;  5HBS A;  1CBQ A;  3ELX A;  5BVQ A;  3C77 X;  1A3Y A;  2X8F A;  2NNE A;  2X45 A;  3S60 A;  1D3S A;  4RUN A;  3FR4 A;  2CM4 A;  4ORX A;  3PQU A;  1KT5 A;  2ACP X;  2CZT A;  2BLG A;  3P02 A;  2CBS A;  1T68 X;  2G78 A;  3PPT A;  2ALL X;  3PH6 A;  4KII A;  1CRB A;  1TOW A;  2N93 A;  1A18 A;  2O62 A;  3D96 A;  4JGL A;  1HN2 A;  1TW4 A;  1BBP A;  4OS0 A;  2OFR X;  5LJK A;  2QOS C;  4A1Y A;  3I17 A;  1KZX A;  1LPJ A;  3NAD A;  5F6Z A;  4XME A;  3WJE A;  4QZU A;  4FBR A;  2WQA E;  1JV4 A;  2HYS A;  3HWE A;  3PQS A;  3RWX A;  4AZQ A;  1FEM A;  1T8V A;  1QWD A;  1QG5 A;  2Q2P A;  1EIO A;  1DF3 A;  4O4S A;  3G7X A;  1NP1 A;  2P8G A;  3VE1 A;  4O3Y A;  2GC9 A;  3D95 A;  3ZW1 A;  1SXW A;  3HWD A;  4YMY A;  3ZW0 A;  3EBK A;  1FTP A;  4GZV A;  5C0N A;  2LKK A;  4D6A A;  4GNW A;  3D97 A;  4A1H A;  5LJC A;  3WVM A;  3WXQ A;  1JIW I;  2YMS A;  3VU1 A;  3Q6L A;  4ES7 A;  1A2D A;  3STN A;  1SY1 A;  2LFO A;  5LJB A;  5D4A A;  1AEL A;  2KTD A;  3PEC A;  3B2K A;  3EM0 A;  3S26 A;  4MVL A;  1EUO A;  3MBT A;  3IA8 A;  4GK9 A;  2AH7 X;  3WJF A;  3FR5 A;  3RZY A;  2RA6 A;  3U03 A;  4IMO A;  4ON1 A;  2NND A;  1KT7 A;  3PH5 A;  4IB6 A;  4YBU A;  3P6G A;  3EMM A;  1B56 A;  4YFR A;  5HCE C;  3O2Y A;  4KCA A;  1HMR A;  2JW1 A;  5BVS A;  5KID A;  1RBP A;  1XCA A;  2RCQ A;  3HWF A;  1DFV A;  1T0V A;  3F8A A;  4LKT A;  4ALB A;  1HMT A;  1E02 A;  1Y9L A;  3FA8 A;  4AYH A;  4N7C A;  5KHP A;  1KT6 A;  1BSO A;  4EEJ A;  1X8P A;  4UU2 A;  1IFC A;  4LZU A;  3K3L A;  4TKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...