4INNA

Protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
TVELPGIYQTQEFLYMKSSFVEFFEHNGKFYAYGISDVDGSKAKKDKLNPNPKLRNRSDKGVVFLSDLIKVGKRSYKGGKAYNFYDGKTYYVRVAQNSNGDLEFTSSYDKWGYMGKTFTWKRLSDEEIKNLKLKRFNLDEVLKTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HP1028
publication title Protein HP1028 from the human pathogen Helicobacter pylori belongs to the lipocalin family.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transport protein
total genus 38
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09917 DUF2147 Uncharacterized protein conserved in bacteria (DUF2147)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.520 Mainly Beta Beta Barrel Lipocalin Lipocalin 4innA00
4INNA
chains in the Genus database with same CATH superfamily
1E2TA 1OBUA 1SXWA 3HOLA 5CE4A 3D9WA 2WWPA 4GGZA 1AQBA 2OYBO 2HYSA 2IZCB 2OL7A 2XKLA 2FHNX 5EDBA 4ZH6A 4BBOA 2OFBA 2AH7X 2MJIA 2L67A 5H9AA 4AZMA 4CDEA 4YGGA 4BOEA 3BX8A 5IO7A 4DQ4A 1ICNA 1ACDA 1SWTA 3BRNA 4PJ2A 3VHHA 2C1SA 4GGRA 1SWOA 2YG2A 3P6FA 3TGAA 3WBGA 2RTDB 4ON1A 4CSBA 3D95A 2AMMX 4O4UA 4K19A 1QG5A 3KQ0A 2OVAA 4OMWA 1B8EA 2FWVA 2QM9A 1W5RA 2JU8A 4IB8A 4INNA 1VWPB 4AZPA 1JV4A 1VWQB 2FLJA 4LZUA 5FQ8E 1DZMA 4U8UN 3WVMA 1TOUA 4NLIA 4COTA 4IRWA 3LTWA 4ZGUA 1KT7A 3CQNA 3QKGA 2WPUA 1FTPA 4U8UM 4L1NA 4O4XA 1SWPA 2Z4HA 3CWKA 1X89A 1ZNHA 2F09A 1SWQA 2EU7X 2HZQA 3P6CA 4MVEA 3UEXA 3CKGA 1SLEB 1DZPA 1VWFB 4ORWA 4WFUA 5HCEC 3UEUA 1GX9A 1LICA 1KXOA 4HPBA 3B2KA 1ICMA 4MVKA 1IJ8A 4Y59A 5HA1A 4NNTA 1KT3A 3BU9A 3FDCA 3JQOA 4U46A 4XMGA 2OFMX 4AZOA 4AZNA 3RWXA 2RTOB 1AVEA 1SRJA 1CBQA 1Y52X 1Z24A 3I0AA 3KFGA 3WYPA 4ARHA 4TNNA 1VYFA 1YWDA 4CPEA 4B55A 3APWA 4JNJA 4YCHA 3WJFA 1YWBA 3Q6LA 1G5WA 3BU1A 4FBRA 5FAZA 4GKCA 3SZHA 4GGTA 4YCEA 1KFFA 4U9CA 5D45A 2AT5X 2OL6O 3ZUOA 3T1DA 4GUZA 1MDCA 3P6GA 2AVIA 4CPFA 1EI5A 1KQWA 4HPCA 5H9LA 4CPHB 4YFRA 2IZDB 4JHQA 5H9NA 1JJUA 4CPHA 1KQXA 2QOMA 3SLJA 1E5PA 2HKDA 2R73A 3VHIA 3ZUIA 4CDDA 2FKJA 3JSQA 1I06A 1IKJA 1EQDA 2FGSA 3ELXA 2CBRA 3F9DA 3H3IA 1XKIA 2VDFA 1LKEA 2IZGB 3RKGA 1IW2A 4ORUA 4XMCA 1PMPA 1LUQA 1VYGA 2IZIA 2L9CA 3OJYC 4PSQA 1SWJA 4MVLA 4ODDA 1SY1A 1RXKA 2M4LA 2OF8A 3RZYA 1BEBA 1KL5A 1LPJA 2RTFB 2X8FA 4KT5A 3VPJE 1BSOA 1I78A 3G7XA 2ZAGA 2RD7C 4QQ1A 1GKAA 1EPAA 2LKKA 3AKNA 2A3FX 1QQSA 1SXXA 2WEWA 2Z4IA 5L8IA 3RDXA 4WHIA 1EXSA 3FA8A 2RTHB 4UU2A 4YKMA 3EMMA 3S5XA 4I3BA 3NQ3A 2G8CO 2BC3A 1MEPA 3EC5A 2UZ2A 2ASNX 1PBOA 2GTLO 3FR4A 4Y5DA 4IMNA 5HCCC 3TF6A 3NQ9A 2RN4A 3O19A 4NYQA 5LJEA 3RBYA 3SOTA 5D47A 5HTDA 1SREA 4KC7A 2QOSC 5K06A 3WZNA 4BQUA 4WFVA 3PH5A 1DF3A 1IFBA 4DQ3A 3EBWA 3N91A 5B2AO 4O3XB 2Q4NA 3DTQA 3KFHA 4OS0A 3B2IA 5EEDA 5B29A 2DM5A 4AZQA 1HXZA 4QYNA 1JYJA 4Z27A 2AT0X 2BS5A 4N7DA 3T2WA 5L3YA 1TXLA 5B11O 1JMXA 2AT3X 2JN3A 4YDBA 3T6FA 2FTBA 3IFBA 2IZHB 3APUA 4EKVA 2RTNB 3VG4A 4JO6A 1YWAA 4ZGFA 5HZ9A 5F1EA 2W2FA 1CBSA 1STPA 2Q9SA 1RSTB 1ERXA 5LJHA 4ORXA 5L8OA 3OD9A 3WZPA 5IXGA 5KICA 1KL3A 2AKQA 1B56A 2OF9A 1OEJA 1TOWA 3NQKA 2KW1A 2CM4A 1NDJA 4UU3A 5HBSA 3RSWA 1QABE 3RDMA 3FENA 4MVIA 4QGVA 1NQNA 3K3LA 4GNWA 1MOYA 4O3YA 5F6BA 5LKFA 1OPAA 2RTEB 4BX5B 4EXZA 1W6FA 5LJGA 4BX5A 3ZW0A 1D2UA 3EM0A 1LCZA 2QO4A 1N0SA 1BRQA 1NQMA 4WBKA 2W2BA 4C5PA 3FR5A 1MX7A 2WQAE 5DG4A 4Z2OA 4LKPA 3D97A 1CBIA 4I9SA 2OVDA 1VWIB 2KTDA 3HWEA 1SRGA 2AT6X 3NX1A 4I6SA 5AJBA 4ID2A 1VWRB 3VG5A 2FR3A 3NP1A 2RTLA 4BJ8A 4M6SA 2X56A 4OEMA 3ZW2A 1SRIA 2RCQA 4NNSA 3O2YA 1JYDA 3TZSA 4TLJA 3TGBA 2JU7A 1U18A 2QO6A 1LIEA 3SAOA 1N9YA 2X8SA 2I5ZO 3NPOA 3PEDA 1IFCA 3SLTA 1E00A 1OPBA 4QYPA 3AEHA 2C4IA 4Y0QA 3NX2A 4CDFA 2IZFB 1NBXA 4GJSA 1S44A 4TKBA 4TKJA 1D3SA 2F73A 3GAQA 5LJKA 4EEJA 5EZ2A 3WJBA 1SA8A 4DCBA 2I5VO 4YBPA 3NR3A 3HWDA 2OY5O 2A0AA 4BGFA 2KD2A 3O22A 2Q2MA 3CBCA 4O4SA 1VWKB 1S2PA 4GRJA 5C0NA 2G79A 2OVSA 3FA7A 3MBTA 4O9SA 4YDAA 1N9MA 1HQPA 1LIBA 1SWKA 2CBSA 2L68A 3F6ZB 4XMFA 1KT6A 3ZI8A 1OEKA 2CM9A 2RTBB 2JMBA 1I04A 1DF8A 2AT8X 2YMSA 2G5LA 1T8VA 1MUPA 4QNIA 3RE6A 3FR2A 1BRPA 4IMOA 3WYQA 3PDFA 2VFCA 3EBKA 2FS6A 5LJCA 1X8UA 3BX7A 3FELA 1AB0A 2RTRB 5EPQA 3CR6A 4MISA 1BM5A 4Z2PA 2BLGA 1ZNLA 5DPQA 1FDQA 4LKTA 2KT4B 2ACOA 1GX3A 5LKEA 1FEMA 1O1VA 2Q2PA 3RDOA 2G7BA 2DJGA 1ADLA 1TVQA 4GK9A 4ZHFA 2RTJA 3FW5A 3KFFA 1MK5A 1SWBA 2IZAA 1ZNGA 3B2JA 3FLLA 4ZH9A 2AL0X 3U9PC 1P6PA 4NYRA 4IABA 4YGZA 3B2LA 3P6DA 3C76X 5F2BA 4A1HA 1U0XA 2FKGA 2FR2A 1OBPA 5H8TA 1EIIA 3ZZVA 1EW3A 1LELA 2X45A 3RE5A 2JU3A 1JQPA 2NNEA 3I17A 1UZ2X 1ALBA 2MM3A 4LQZA 4O4OA 1SY0A 3OE3A 3U0DA 1N4JA 3MVFA 1NC9A 2JGSA 2X55A 1SWFA 4AZRA 5BYPA 3WXQA 4EQAC 3EW1A 5IRUA 2OY7A 4FBOA 3FIQA 5F58A 1HXLA 4A8ZA 3P6EA 2A2UA 4OS3A 1DV9A 3DSZA 1VWAB 4YGHA 3SLOA 1BSYA 2NNDA 1FE3A 2IZEB 3NBXX 3S26A 3C77X 3CKFA 2RTAA 4D6AA 1GT4A 3VE1A 2NP1A 2NNQA 1BLRA 1SY3A 3HPEA 2IFBA 1ERBA 4NV7A 2WUTA 1UYOX 2QO5A 2X4MA 3QQ2A 4ES7A 1I9HA 1LF7A 3PECA 4HFOA 5EEEA 4CDCA 4ZJ0A 1KZWA 2MHDA 4EFGA 2GTLN 1SWCA 1HQQA 4ORYA 1ZRYA 5HZ5A 3PQUA 5AQ6A 5LJBA 1AVGI 1LDOA 1IIUA 1K3BA 2GTLM 2Y3EA 4YFQA 5FQ7E 3PH6A 4NV8A 2RTKA 1I4UA 1SWNA 1S7DA 1L6MA 2FRSA 1BBPA 1DZJA 2OL8O 3P02A 3SZIA 4YVBA 5HZ6A 4BX6B 1O8VA 3LV4A 2RTIB 1SWGA 2A2GA 1NP1A 1DC9A 1JIWI 1QFVA 2O62A 4IAXA 5F6ZA 4BX6A 1B0OA 2BSZA 2ZAIA 1VWMB 4I95A 1MX8A 2E4JA 3WJEA 4ZR2A 3ZW1B 1CBRA 2QMIA 2ACPX 4ZFXA 5HWZA 1GT5A 4GU8A 2A8GA 4QRLA 4RUNA 3STNA 2A5CA 2Y32A 3LHNA 2Q39A 1HBQA 1LNMA 3P24A 4KH8A 4GJVA 4NP1A 3APVA 4OMXA 3B2HA 5CSEA 3UEVA 2RTPB 3FIDA 3PPTA 2IZBA 1Y9TA 1PEEA 5B3MO 3BS2A 1JJJA 5HA0A 1QY0A 2DJFA 4FBVA 1GT3A 4KIIA 4U3QA 2HMBA 2BHVA 5K67A 5JR8A 1RSUB 2K62A 4CK4A 3PP6A 1N7YA 1PTSA 4NW4A 2RTMA 1SLGB 3BDRA 1DZKA 1U17A 1VWCB 1YWCA 1Y9LA 1W4TA 1QFTA 1UYNX 1I05A 1WBIA 4QGXA 1Y55X 2OVEA 5JD2A 1MVGA 2X8TA 2HZRA 1SWDA 4ALBA 1EALA 1LFOA 1VWBB 2ZSCA 2IZLB 1SWAA 1TW4A 3PK2A 1VWNB 2JOZA 3AKMA 3KZAA 4IB6A 1SY2A 5D8JA 5B5GA 3WZQA 4Z6JA 1LDQA 5HCDC 1QWDA 2OZQA 4R0BA 1GX8A 1R0UA 1X8OA 3AUMO 4BX7B 2FT9A 5D4AA 2P8GA 4N7CA 4LZVA 3VG2A 4O3ZA 3MG5A 4AW8A 1HMSA 1Y0GA 4YH0A 5FENA 1DFVA 1QY2A 2RA6A 1T0VA 4ORSA 1HBPA 3D96A 5K68A 2LBVA 1VWEB 1N43A 1E02A 1GXAA 3HOEA 2HLVA 2BT9A 5HZQA 1VPRA 1G85A 2CZUA 4I3DA 3JS1A 4BCSA 2RTGB 2MWHA 4TJZA 1VWHB 1AELA 3BY0A 1X71A 5H9KA 4DNEA 5KIDA 3ZQ3A 4AYHA 2X34A 1JZUA 4YFPA 1EUOA 1OSPO 3KVNA 4QZUA 1VWLB 4GDZA 3VG6A 4ORRA 5AEOA 3E3CA 4OKAA 1QY1A 3FW4A 3NADA 5B5FA 3S60A 4ZHCA 1LIFA 1HY2A 2L5PA 4U8UO 2OY8A 2LA7A 4XMHA 2OFAA 2IZKA 3IA8A 4ML7B 5CHKA 4ALOA 3UAQA 3RY1A 3VGWA 3T6LA 2ANSA 4ZHHA 3PQSA 2N93A 4EDEA 1SRFA 4MIRA 1Y53X 4HPDA 4TKHA 3WOVA 2QCBA 1UREA 3F8AA 2LFOA 4Y0PA 4GNYA 3TGCA 1RAVA 1LCWA 1VWJB 4QZTA 2RTQB 3VG3A 3VHMA 4FGIB 1IKEA 1H91A 2X32A 1KT5A 2MF6A 1VWDB 4MEEA 2FS7A 1OBQA 1RXHA 1SWEA 3VU1A 4YBUA 4XMEA 2FHLA 3APXA 1RBPA 4Y0SA 2GTFX 1ZNKA 3OBLA 2K23A 5BVQA 5L8NA 3KFIA 5AJCA 1GT1A 1KT4A 3C78X 5IO5A 1KGLA 4L3RA 4QGWA 2LB6A 1BSQA 1E06A 4OELA 3T2XA 1BWYA 3BSZE 4QAEA 4XMDA 4CPIA 2AF5A 3CMPA 1VYOA 1VWGB 2R74A 3WJGA 3HWFA 2CAMA 1RLBE 4Y0RA 3HK1A 1YIVA 2WSJA 4ZCBA 3FMZA 1A2DA 3L4RA 3MX7A 1A57A 2LBAA 1SWUA 1T68X 2ALLX 4M7MA 2WQ9A 3S5VA 1NGLA 1KZXA 1AVDA 1G74A 5HTEA 1GGLA 5LJDA 5BVSA 2G78A 2POAA 4JGLA 1X8NA 4YKOA 3VE2A 2CZTA 4IB7A 1NP4A 2GC9A 5IO6A 3STMX 1A3YA 1K24A 4I60A 4NLJA 1GKAB 1HMTA 3EYCA 4GETA 4ZHDA 1ZNDA 1O1UA 1PBYA 2Y3FA 1FENA 1B4MA 3MM0A 1BJ7A 3RDUA 3WJCA 3UEWA 1X8PA 2RTCB 1HMRA 2HNXA 2KTSA 2W2AA 4CV7A 3FYFA 3WJDA 5HAEA 4YMYA 2OFRX 5FQ6E 3ELZA 4KC8A 2OY1O 1XCAA 3ZW1A 2GJ5A 3ZWEA 1CJ5A 1PM1X 2WEXA 4GH7A 1OEEA 1RXJA 3X00A 2R56A 2GH7A 1SMPI 4BVMA 4O49A 5HZ8A 3EW2A 1GM6A 1JJXA 1MM9A 5F7GA 1SRHA 2MO5A 4GE1A 1SLDB 3BLGA 3FA6A 1STRB 3RDQA 1EIOA 5D48A 1SXYA 4OS8A 5FFHA 2X46A 4GDAA 2RCTA 2A13A 3RY2A 1FJ1E 1WUBA 2C1QA 1STSB 2PY1A 5IRAA 2WR6A 5EDCA 3RDSA 4ZHGA 1CRBA 1YP6A 2BS6A 2UYWA 1KOIA 1EPBA 4GD9A 1HN2A 2PI3O 3GE2A 1YP7A 4Z2VA 1YUPA 3D4RA 4Z28A 1JMZA 5B27A 1KL4A 1FELA 3SZJA 4FQBB 4I9RA 1SWSA 2A5BA 4IB9A 1SLFB 1A18A 4KCAA 3HWGA 1X8QA 1G7NA 4IBAA 4RUUA 2VFBA 4O3WA 1VWOB 2IZJA 3VG7A 2JW1A 3V8UA 5IRWA 5B10O 4D6BA 5CYBA 1SXUA 4GZVA 3CQRA 3FEPA 1SWHA 4HPAA 4IAWA 3HTYA 3P6HA 4BX7A 5BVTA 1JBHA 1SWRA 3FA9A 3ZW0B 4A1YA 2XSTA 3U03A 5KHPA 4TQ2A 3FEKA 3WZOA 4I3CA 1LIDA 3Q34A 2F01A 1ML7A 3STKA 3CBSA 4HWMA 1SWLA 4A60A 2RQ0A 1ZNEA 1LCVA
chains in the Genus database with same CATH topology
1OBUA 1SXWA 3HOLA 5CE4A 2WWPA 1AQBA 2HYSA 2XKLA 5EDBA 4ZH6A 2AH7X 2MJIA 2L67A 5H9AA 4AZMA 4YGGA 4BOEA 3BX8A 5IO7A 4DQ4A 1ICNA 1ACDA 4AZNA 3BRNA 4PJ2A 3P6FA 2YG2A 3TGAA 3WBGA 4ON1A 4CSBA 3D95A 2AMMX 4O4UA 4K19A 1QG5A 3KQ0A 2OVAA 4OMWA 1B8EA 2FWVA 2QM9A 2JU8A 4IB8A 4INNA 4AZPA 1JV4A 2FLJA 5FQ8E 4LZUA 1DZMA 4U8UN 3WVMA 1TOUA 4NLIA 4COTA 4ZGUA 1KT7A 3CQNA 3QKGA 1FTPA 4U8UM 4L1NA 4O4XA 2Z4HA 3CWKA 1X89A 1ZNHA 2F09A 2HZQA 2EU7X 3P6CA 4MVEA 3UEXA 1DZPA 4ORWA 4WFUA 5HCEC 3UEUA 1GX9A 1LICA 1KXOA 4HPBA 3B2KA 1ICMA 4MVKA 5HA1A 4NNTA 1KT3A 3BU9A 4XMGA 3JQOA 4AZOA 2OFMX 3RWXA 1Z24A 1CBQA 3KFGA 3I0AA 4ARHA 4TNNA 1VYFA 1YWDA 3APWA 4YCHA 3WJFA 1YWBA 3Q6LA 1G5WA 3BU1A 4FBRA 5FAZA 4GKCA 4YCEA 4U9CA 5D45A 2AT5X 3ZUOA 3T1DA 1MDCA 3P6GA 1EI5A 1KQWA 4HPCA 5H9LA 4YFRA 5H9NA 1KQXA 1E5PA 2R73A 3ZUIA 3JSQA 1I06A 1IKJA 1EQDA 3KFIA 3ELXA 2CBRA 3F9DA 3H3IA 1XKIA 1LKEA 3RKGA 1IW2A 4ORUA 4XMCA 1PMPA 1VYGA 3OJYC 4PSQA 2L9CA 4ODDA 4MVLA 1SY1A 2M4LA 3RZYA 1JZUA 1BEBA 1LPJA 2X8FA 4KT5A 3VPJE 1BSOA 4QQ1A 3G7XA 2ZAGA 2RD7C 1GKAA 1EPAA 2LKKA 3AKNA 2A3FX 1QQSA 1SXXA 2WEWA 2Z4IA 5L8IA 4WHIA 1EXSA 3FA8A 4UU2A 4YKMA 3EMMA 3S5XA 4I3BA 3NQ3A 2ASNX 1PBOA 2GTLO 3FR4A 5HCCC 4IMNA 3TF6A 3NQ9A 2RN4A 3O19A 4NYQA 5LJEA 3RBYA 3SOTA 5D47A 5HTDA 4KC7A 2QOSC 5K06A 4BQUA 4WFVA 3PH5A 1DF3A 1IFBA 3EBWA 3N91A 4O3XB 2Q4NA 3DTQA 3KFHA 4OS0A 3B2IA 5EEDA 5B29A 2DM5A 4AZQA 4QYNA 1JYJA 2BS5A 2AT0X 4N7DA 1TXLA 2AT3X 2JN3A 4YDBA 2FTBA 3IFBA 3APUA 3VG4A 1YWAA 4ZGFA 5HZ9A 5F1EA 2W2FA 1CBSA 2Q9SA 1ERXA 5LJHA 4ORXA 5L8OA 3OD9A 5KICA 4RUNA 2AKQA 1B56A 4UU3A 1OEJA 1TOWA 3NQKA 2KW1A 2CM4A 5HBSA 3RSWA 1QABE 3FENA 4MVIA 4QGVA 3K3LA 4GNWA 4O3YA 5F6BA 5LKFA 1OPAA 4EXZA 5LJGA 3ZW0A 1D2UA 3EM0A 2QO4A 1N0SA 1BRQA 4WBKA 2W2BA 3FR5A 1MX7A 2WQAE 5DG4A 4LKPA 3D97A 1CBIA 4I9SA 2OVDA 2KTDA 3HWEA 2AT6X 3NX1A 4I6SA 5AJBA 4ID2A 3VG5A 2FR3A 3NP1A 4M6SA 3ZW2A 2RCQA 4NNSA 3O2YA 1JYDA 3TZSA 4TLJA 3TGBA 2JU7A 1U18A 2QO6A 1LIEA 3SAOA 2X8SA 3NPOA 3PEDA 1IFCA 1E00A 1OPBA 4QYPA 4Y0QA 3NX2A 4TKBA 1S44A 4TKJA 1D3SA 2F73A 3GAQA 5LJKA 4EEJA 5EZ2A 3WJBA 1SA8A 4YBPA 3NR3A 3HWDA 2A0AA 2KD2A 3O22A 2Q2MA 3CBCA 4O4SA 4GRJA 1S2PA 5C0NA 2G79A 2OVSA 3FA7A 3MBTA 4O9SA 4YDAA 2L68A 1HQPA 1LIBA 2CBSA 3F6ZB 4XMFA 1KT6A 3ZI8A 1OEKA 2CM9A 2JMBA 1I04A 2YMSA 2AT8X 1T8VA 1MUPA 4QNIA 3FR2A 1BRPA 4IMOA 3EBKA 2FS6A 5LJCA 1X8UA 3BX7A 3FELA 1AB0A 5EPQA 3CR6A 4MISA 1BM5A 2BLGA 1ZNLA 5DPQA 1FDQA 4LKTA 2KT4B 2ACOA 5LKEA 1FEMA 1O1VA 2Q2PA 2G7BA 1ADLA 1TVQA 4GK9A 4ZHFA 3FW5A 3KFFA 3FLLA 1ZNGA 3B2JA 4ZH9A 2AL0X 3U9PC 1P6PA 4NYRA 4IABA 4YGZA 3B2LA 3P6DA 3C76X 4A1HA 1U0XA 5H8TA 2FR2A 1OBPA 1EIIA 3ZZVA 1EW3A 2X45A 2JU3A 2NNEA 3I17A 4QZUA 1UZ2X 1ALBA 2MM3A 4LQZA 4O4OA 1SY0A 3OE3A 3U0DA 3MVFA 4AZRA 5BYPA 3WXQA 4EQAC 4DQ3A 4FBOA 3FIQA 5F58A 4A8ZA 3P6EA 2A2UA 4OS3A 1DV9A 3DSZA 4YGHA 1BSYA 2NNDA 1FE3A 3NBXX 3S26A 3C77X 4D6AA 1GT4A 3VE1A 2NP1A 2NNQA 1BLRA 1SY3A 2IFBA 1ERBA 2WUTA 2QO5A 4ES7A 1LF7A 3PECA 4HFOA 5EEEA 4ZJ0A 1KZWA 2MHDA 4EFGA 2GTLN 4ORYA 5HZ5A 1ZRYA 3PQUA 5AQ6A 5LJBA 1AVGI 1IIUA 2GTLM 4YFQA 5FQ7E 3PH6A 1I4UA 2FRSA 1S7DA 1L6MA 1BBPA 1DZJA 3P02A 5HZ6A 1O8VA 3LV4A 2A2GA 5F6ZA 1NP1A 1DC9A 1JIWI 1QFVA 2O62A 4IAXA 1B0OA 2ZAIA 4I95A 1MX8A 2E4JA 3WJEA 4ZR2A 3ZW1B 1CBRA 2QMIA 2ACPX 4ZFXA 5HWZA 1GT5A 4GU8A 4QRLA 3STNA 3P24A 3LHNA 2Q39A 1HBQA 1LNMA 4KH8A 4OMXA 4NP1A 3UEVA 3APVA 3B2HA 3PPTA 1Y9TA 1PEEA 3BS2A 1JJJA 5HA0A 1QY0A 4FBVA 1GT3A 4KIIA 4U3QA 2HMBA 2BHVA 5JR8A 2K62A 4CK4A 3PP6A 4NW4A 3BDRA 1DZKA 1U17A 1YWCA 1Y9LA 4QGXA 1QFTA 1I05A 2OVEA 1MVGA 2X8TA 2HZRA 4ALBA 1EALA 1LFOA 1TW4A 2JOZA 3AKMA 3KZAA 4IB6A 1SY2A 5D8JA 5HCDC 1QWDA 2OZQA 4R0BA 1GX8A 1R0UA 1X8OA 2FT9A 5D4AA 2P8GA 4N7CA 4LZVA 3VG2A 4O3ZA 4AW8A 1HMSA 4YH0A 5FENA 1DFVA 1QY2A 2RA6A 1T0VA 4ORSA 1HBPA 3D96A 2LBVA 1E02A 1GXAA 3HOEA 2HLVA 2BT9A 5HZQA 1VPRA 1G85A 2CZUA 4I3DA 3JS1A 2MWHA 4TJZA 1AELA 3BY0A 1X71A 5H9KA 5KIDA 3ZQ3A 4AYHA 4YFPA 1EUOA 4GDZA 3VG6A 4ORRA 5AEOA 3E3CA 1QY1A 3FW4A 3NADA 3S60A 4ZHCA 1LIFA 2L5PA 4U8UO 2LA7A 4XMHA 3IA8A 4ML7B 4ALOA 3UAQA 2ANSA 4ZHHA 3PQSA 2N93A 4EDEA 4MIRA 4HPDA 4TKHA 3WOVA 3F8AA 1UREA 4Y0PA 2LFOA 4GNYA 3TGCA 4QZTA 3VG3A 4FGIB 1IKEA 1H91A 1KT5A 2FS7A 1OBQA 3VU1A 4YBUA 4XMEA 3APXA 1RBPA 4Y0SA 2GTFX 1ZNKA 3OBLA 2K23A 5BVQA 5L8NA 5AJCA 1GT1A 1KT4A 3C78X 5IO5A 1KGLA 4L3RA 4QGWA 2LB6A 1BSQA 1E06A 1BWYA 3BSZE 4QAEA 4XMDA 3CMPA 2R74A 3WJGA 3HWFA 1RLBE 4Y0RA 3HK1A 1YIVA 2WSJA 4ZCBA 3FMZA 1A2DA 3L4RA 3MX7A 1A57A 2LBAA 4M7MA 1T68X 2ALLX 3S5VA 2WQ9A 1KZXA 1NGLA 1G74A 5HTEA 1GGLA 5LJDA 5BVSA 2G78A 2POAA 4JGLA 1X8NA 4YKOA 3VE2A 2CZTA 4IB7A 1NP4A 2GC9A 5IO6A 3STMX 1A3YA 4NLJA 1GKAB 1HMTA 3EYCA 4GETA 4ZHDA 1ZNDA 1O1UA 1FENA 1B4MA 1BJ7A 3WJCA 3UEWA 1X8PA 1HMRA 2HNXA 2KTSA 2W2AA 4CV7A 3FYFA 3WJDA 5HAEA 4YMYA 2OFRX 5FQ6E 3ELZA 4KC8A 1XCAA 3ZW1A 2GJ5A 3ZWEA 1CJ5A 1PM1X 2WEXA 4GH7A 1OEEA 2R56A 4BVMA 1SMPI 4O49A 5HZ8A 1GM6A 1JJXA 5F7GA 2MO5A 4GE1A 3BLGA 3FA6A 1EIOA 5D48A 1SXYA 4OS8A 5FFHA 2X46A 2RCTA 2A13A 2PY1A 2WR6A 5EDCA 4ZHGA 2BS6A 1CRBA 1YP6A 1KOIA 1EPBA 1HN2A 3GE2A 1YP7A 1YUPA 3D4RA 5B27A 1FELA 4FQBB 4I9RA 4IB9A 1A18A 4KCAA 3HWGA 1X8QA 1G7NA 4IBAA 4RUUA 4O3WA 3VG7A 2JW1A 3V8UA 4D6BA 5CYBA 1SXUA 4GZVA 3CQRA 3FEPA 4HPAA 4IAWA 3HTYA 3P6HA 5BVTA 1JBHA 3FA9A 3ZW0B 4A1YA 2XSTA 3U03A 5KHPA 4TQ2A 3FEKA 4I3CA 1LIDA 1ML7A 3STKA 3CBSA 4HWMA 4A60A 2RQ0A 1ZNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INN A; 
#chains in the Genus database with same CATH topology
 1E2T A;  1OBU A;  1SXW A;  3HOL A;  5CE4 A;  3D9W A;  2WWP A;  4GGZ A;  1AQB A;  2OYB O;  2HYS A;  2IZC B;  2OL7 A;  2XKL A;  2FHN X;  5EDB A;  4ZH6 A;  4BBO A;  2OFB A;  2AH7 X;  2MJI A;  2L67 A;  5H9A A;  4AZM A;  4CDE A;  4YGG A;  4BOE A;  3BX8 A;  5IO7 A;  4DQ4 A;  1ICN A;  1ACD A;  1SWT A;  3BRN A;  4PJ2 A;  3VHH A;  2C1S A;  4GGR A;  1SWO A;  2YG2 A;  3P6F A;  3TGA A;  3WBG A;  2RTD B;  4ON1 A;  4CSB A;  3D95 A;  2AMM X;  4O4U A;  4K19 A;  1QG5 A;  3KQ0 A;  2OVA A;  4OMW A;  1B8E A;  2FWV A;  2QM9 A;  1W5R A;  2JU8 A;  4IB8 A;  4INN A;  1VWP B;  4AZP A;  1JV4 A;  1VWQ B;  2FLJ A;  4LZU A;  5FQ8 E;  1DZM A;  4U8U N;  3WVM A;  1TOU A;  4NLI A;  4COT A;  4IRW A;  3LTW A;  4ZGU A;  1KT7 A;  3CQN A;  3QKG A;  2WPU A;  1FTP A;  4U8U M;  4L1N A;  4O4X A;  1SWP A;  2Z4H A;  3CWK A;  1X89 A;  1ZNH A;  2F09 A;  1SWQ A;  2EU7 X;  2HZQ A;  3P6C A;  4MVE A;  3UEX A;  3CKG A;  1SLE B;  1DZP A;  1VWF B;  4ORW A;  4WFU A;  5HCE C;  3UEU A;  1GX9 A;  1LIC A;  1KXO A;  4HPB A;  3B2K A;  1ICM A;  4MVK A;  1IJ8 A;  4Y59 A;  5HA1 A;  4NNT A;  1KT3 A;  3BU9 A;  3FDC A;  3JQO A;  4U46 A;  4XMG A;  2OFM X;  4AZO A;  4AZN A;  3RWX A;  2RTO B;  1AVE A;  1SRJ A;  1CBQ A;  1Y52 X;  1Z24 A;  3I0A A;  3KFG A;  3WYP A;  4ARH A;  4TNN A;  1VYF A;  1YWD A;  4CPE A;  4B55 A;  3APW A;  4JNJ A;  4YCH A;  3WJF A;  1YWB A;  3Q6L A;  1G5W A;  3BU1 A;  4FBR A;  5FAZ A;  4GKC A;  3SZH A;  4GGT A;  4YCE A;  1KFF A;  4U9C A;  5D45 A;  2AT5 X;  2OL6 O;  3ZUO A;  3T1D A;  4GUZ A;  1MDC A;  3P6G A;  2AVI A;  4CPF A;  1EI5 A;  1KQW A;  4HPC A;  5H9L A;  4CPH B;  4YFR A;  2IZD B;  4JHQ A;  5H9N A;  1JJU A;  4CPH A;  1KQX A;  2QOM A;  3SLJ A;  1E5P A;  2HKD A;  2R73 A;  3VHI A;  3ZUI A;  4CDD A;  2FKJ A;  3JSQ A;  1I06 A;  1IKJ A;  1EQD A;  2FGS A;  3ELX A;  2CBR A;  3F9D A;  3H3I A;  1XKI A;  2VDF A;  1LKE A;  2IZG B;  3RKG A;  1IW2 A;  4ORU A;  4XMC A;  1PMP A;  1LUQ A;  1VYG A;  2IZI A;  2L9C A;  3OJY C;  4PSQ A;  1SWJ A;  4MVL A;  4ODD A;  1SY1 A;  1RXK A;  2M4L A;  2OF8 A;  3RZY A;  1BEB A;  1KL5 A;  1LPJ A;  2RTF B;  2X8F A;  4KT5 A;  3VPJ E;  1BSO A;  1I78 A;  3G7X A;  2ZAG A;  2RD7 C;  4QQ1 A;  1GKA A;  1EPA A;  2LKK A;  3AKN A;  2A3F X;  1QQS A;  1SXX A;  2WEW A;  2Z4I A;  5L8I A;  3RDX A;  4WHI A;  1EXS A;  3FA8 A;  2RTH B;  4UU2 A;  4YKM A;  3EMM A;  3S5X A;  4I3B A;  3NQ3 A;  2G8C O;  2BC3 A;  1MEP A;  3EC5 A;  2UZ2 A;  2ASN X;  1PBO A;  2GTL O;  3FR4 A;  4Y5D A;  4IMN A;  5HCC C;  3TF6 A;  3NQ9 A;  2RN4 A;  3O19 A;  4NYQ A;  5LJE A;  3RBY A;  3SOT A;  5D47 A;  5HTD A;  1SRE A;  4KC7 A;  2QOS C;  5K06 A;  3WZN A;  4BQU A;  4WFV A;  3PH5 A;  1DF3 A;  1IFB A;  4DQ3 A;  3EBW A;  3N91 A;  5B2A O;  4O3X B;  2Q4N A;  3DTQ A;  3KFH A;  4OS0 A;  3B2I A;  5EED A;  5B29 A;  2DM5 A;  4AZQ A;  1HXZ A;  4QYN A;  1JYJ A;  4Z27 A;  2AT0 X;  2BS5 A;  4N7D A;  3T2W A;  5L3Y A;  1TXL A;  5B11 O;  1JMX A;  2AT3 X;  2JN3 A;  4YDB A;  3T6F A;  2FTB A;  3IFB A;  2IZH B;  3APU A;  4EKV A;  2RTN B;  3VG4 A;  4JO6 A;  1YWA A;  4ZGF A;  5HZ9 A;  5F1E A;  2W2F A;  1CBS A;  1STP A;  2Q9S A;  1RST B;  1ERX A;  5LJH A;  4ORX A;  5L8O A;  3OD9 A;  3WZP A;  5IXG A;  5KIC A;  1KL3 A;  2AKQ A;  1B56 A;  2OF9 A;  1OEJ A;  1TOW A;  3NQK A;  2KW1 A;  2CM4 A;  1NDJ A;  4UU3 A;  5HBS A;  3RSW A;  1QAB E;  3RDM A;  3FEN A;  4MVI A;  4QGV A;  1NQN A;  3K3L A;  4GNW A;  1MOY A;  4O3Y A;  5F6B A;  5LKF A;  1OPA A;  2RTE B;  4BX5 B;  4EXZ A;  1W6F A;  5LJG A;  4BX5 A;  3ZW0 A;  1D2U A;  3EM0 A;  1LCZ A;  2QO4 A;  1N0S A;  1BRQ A;  1NQM A;  4WBK A;  2W2B A;  4C5P A;  3FR5 A;  1MX7 A;  2WQA E;  5DG4 A;  4Z2O A;  4LKP A;  3D97 A;  1CBI A;  4I9S A;  2OVD A;  1VWI B;  2KTD A;  3HWE A;  1SRG A;  2AT6 X;  3NX1 A;  4I6S A;  5AJB A;  4ID2 A;  1VWR B;  3VG5 A;  2FR3 A;  3NP1 A;  2RTL A;  4BJ8 A;  4M6S A;  2X56 A;  4OEM A;  3ZW2 A;  1SRI A;  2RCQ A;  4NNS A;  3O2Y A;  1JYD A;  3TZS A;  4TLJ A;  3TGB A;  2JU7 A;  1U18 A;  2QO6 A;  1LIE A;  3SAO A;  1N9Y A;  2X8S A;  2I5Z O;  3NPO A;  3PED A;  1IFC A;  3SLT A;  1E00 A;  1OPB A;  4QYP A;  3AEH A;  2C4I A;  4Y0Q A;  3NX2 A;  4CDF A;  2IZF B;  1NBX A;  4GJS A;  1S44 A;  4TKB A;  4TKJ A;  1D3S A;  2F73 A;  3GAQ A;  5LJK A;  4EEJ A;  5EZ2 A;  3WJB A;  1SA8 A;  4DCB A;  2I5V O;  4YBP A;  3NR3 A;  3HWD A;  2OY5 O;  2A0A A;  4BGF A;  2KD2 A;  3O22 A;  2Q2M A;  3CBC A;  4O4S A;  1VWK B;  1S2P A;  4GRJ A;  5C0N A;  2G79 A;  2OVS A;  3FA7 A;  3MBT A;  4O9S A;  4YDA A;  1N9M A;  1HQP A;  1LIB A;  1SWK A;  2CBS A;  2L68 A;  3F6Z B;  4XMF A;  1KT6 A;  3ZI8 A;  1OEK A;  2CM9 A;  2RTB B;  2JMB A;  1I04 A;  1DF8 A;  2AT8 X;  2YMS A;  2G5L A;  1T8V A;  1MUP A;  4QNI A;  3RE6 A;  3FR2 A;  1BRP A;  4IMO A;  3WYQ A;  3PDF A;  2VFC A;  3EBK A;  2FS6 A;  5LJC A;  1X8U A;  3BX7 A;  3FEL A;  1AB0 A;  2RTR B;  5EPQ A;  3CR6 A;  4MIS A;  1BM5 A;  4Z2P A;  2BLG A;  1ZNL A;  5DPQ A;  1FDQ A;  4LKT A;  2KT4 B;  2ACO A;  1GX3 A;  5LKE A;  1FEM A;  1O1V A;  2Q2P A;  3RDO A;  2G7B A;  2DJG A;  1ADL A;  1TVQ A;  4GK9 A;  4ZHF A;  2RTJ A;  3FW5 A;  3KFF A;  1MK5 A;  1SWB A;  2IZA A;  1ZNG A;  3B2J A;  3FLL A;  4ZH9 A;  2AL0 X;  3U9P C;  1P6P A;  4NYR A;  4IAB A;  4YGZ A;  3B2L A;  3P6D A;  3C76 X;  5F2B A;  4A1H A;  1U0X A;  2FKG A;  2FR2 A;  1OBP A;  5H8T A;  1EII A;  3ZZV A;  1EW3 A;  1LEL A;  2X45 A;  3RE5 A;  2JU3 A;  1JQP A;  2NNE A;  3I17 A;  1UZ2 X;  1ALB A;  2MM3 A;  4LQZ A;  4O4O A;  1SY0 A;  3OE3 A;  3U0D A;  1N4J A;  3MVF A;  1NC9 A;  2JGS A;  2X55 A;  1SWF A;  4AZR A;  5BYP A;  3WXQ A;  4EQA C;  3EW1 A;  5IRU A;  2OY7 A;  4FBO A;  3FIQ A;  5F58 A;  1HXL A;  4A8Z A;  3P6E A;  2A2U A;  4OS3 A;  1DV9 A;  3DSZ A;  1VWA B;  4YGH A;  3SLO A;  1BSY A;  2NND A;  1FE3 A;  2IZE B;  3NBX X;  3S26 A;  3C77 X;  3CKF A;  2RTA A;  4D6A A;  1GT4 A;  3VE1 A;  2NP1 A;  2NNQ A;  1BLR A;  1SY3 A;  3HPE A;  2IFB A;  1ERB A;  4NV7 A;  2WUT A;  1UYO X;  2QO5 A;  2X4M A;  3QQ2 A;  4ES7 A;  1I9H A;  1LF7 A;  3PEC A;  4HFO A;  5EEE A;  4CDC A;  4ZJ0 A;  1KZW A;  2MHD A;  4EFG A;  2GTL N;  1SWC A;  1HQQ A;  4ORY A;  1ZRY A;  5HZ5 A;  3PQU A;  5AQ6 A;  5LJB A;  1AVG I;  1LDO A;  1IIU A;  1K3B A;  2GTL M;  2Y3E A;  4YFQ A;  5FQ7 E;  3PH6 A;  4NV8 A;  2RTK A;  1I4U A;  1SWN A;  1S7D A;  1L6M A;  2FRS A;  1BBP A;  1DZJ A;  2OL8 O;  3P02 A;  3SZI A;  4YVB A;  5HZ6 A;  4BX6 B;  1O8V A;  3LV4 A;  2RTI B;  1SWG A;  2A2G A;  1NP1 A;  1DC9 A;  1JIW I;  1QFV A;  2O62 A;  4IAX A;  5F6Z A;  4BX6 A;  1B0O A;  2BSZ A;  2ZAI A;  1VWM B;  4I95 A;  1MX8 A;  2E4J A;  3WJE A;  4ZR2 A;  3ZW1 B;  1CBR A;  2QMI A;  2ACP X;  4ZFX A;  5HWZ A;  1GT5 A;  4GU8 A;  2A8G A;  4QRL A;  4RUN A;  3STN A;  2A5C A;  2Y32 A;  3LHN A;  2Q39 A;  1HBQ A;  1LNM A;  3P24 A;  4KH8 A;  4GJV A;  4NP1 A;  3APV A;  4OMX A;  3B2H A;  5CSE A;  3UEV A;  2RTP B;  3FID A;  3PPT A;  2IZB A;  1Y9T A;  1PEE A;  5B3M O;  3BS2 A;  1JJJ A;  5HA0 A;  1QY0 A;  2DJF A;  4FBV A;  1GT3 A;  4KII A;  4U3Q A;  2HMB A;  2BHV A;  5K67 A;  5JR8 A;  1RSU B;  2K62 A;  4CK4 A;  3PP6 A;  1N7Y A;  1PTS A;  4NW4 A;  2RTM A;  1SLG B;  3BDR A;  1DZK A;  1U17 A;  1VWC B;  1YWC A;  1Y9L A;  1W4T A;  1QFT A;  1UYN X;  1I05 A;  1WBI A;  4QGX A;  1Y55 X;  2OVE A;  5JD2 A;  1MVG A;  2X8T A;  2HZR A;  1SWD A;  4ALB A;  1EAL A;  1LFO A;  1VWB B;  2ZSC A;  2IZL B;  1SWA A;  1TW4 A;  3PK2 A;  1VWN B;  2JOZ A;  3AKM A;  3KZA A;  4IB6 A;  1SY2 A;  5D8J A;  5B5G A;  3WZQ A;  4Z6J A;  1LDQ A;  5HCD C;  1QWD A;  2OZQ A;  4R0B A;  1GX8 A;  1R0U A;  1X8O A;  3AUM O;  4BX7 B;  2FT9 A;  5D4A A;  2P8G A;  4N7C A;  4LZV A;  3VG2 A;  4O3Z A;  3MG5 A;  4AW8 A;  1HMS A;  1Y0G A;  4YH0 A;  5FEN A;  1DFV A;  1QY2 A;  2RA6 A;  1T0V A;  4ORS A;  1HBP A;  3D96 A;  5K68 A;  2LBV A;  1VWE B;  1N43 A;  1E02 A;  1GXA A;  3HOE A;  2HLV A;  2BT9 A;  5HZQ A;  1VPR A;  1G85 A;  2CZU A;  4I3D A;  3JS1 A;  4BCS A;  2RTG B;  2MWH A;  4TJZ A;  1VWH B;  1AEL A;  3BY0 A;  1X71 A;  5H9K A;  4DNE A;  5KID A;  3ZQ3 A;  4AYH A;  2X34 A;  1JZU A;  4YFP A;  1EUO A;  1OSP O;  3KVN A;  4QZU A;  1VWL B;  4GDZ A;  3VG6 A;  4ORR A;  5AEO A;  3E3C A;  4OKA A;  1QY1 A;  3FW4 A;  3NAD A;  5B5F A;  3S60 A;  4ZHC A;  1LIF A;  1HY2 A;  2L5P A;  4U8U O;  2OY8 A;  2LA7 A;  4XMH A;  2OFA A;  2IZK A;  3IA8 A;  4ML7 B;  5CHK A;  4ALO A;  3UAQ A;  3RY1 A;  3VGW A;  3T6L A;  2ANS A;  4ZHH A;  3PQS A;  2N93 A;  4EDE A;  1SRF A;  4MIR A;  1Y53 X;  4HPD A;  4TKH A;  3WOV A;  2QCB A;  1URE A;  3F8A A;  2LFO A;  4Y0P A;  4GNY A;  3TGC A;  1RAV A;  1LCW A;  1VWJ B;  4QZT A;  2RTQ B;  3VG3 A;  3VHM A;  4FGI B;  1IKE A;  1H91 A;  2X32 A;  1KT5 A;  2MF6 A;  1VWD B;  4MEE A;  2FS7 A;  1OBQ A;  1RXH A;  1SWE A;  3VU1 A;  4YBU A;  4XME A;  2FHL A;  3APX A;  1RBP A;  4Y0S A;  2GTF X;  1ZNK A;  3OBL A;  2K23 A;  5BVQ A;  5L8N A;  3KFI A;  5AJC A;  1GT1 A;  1KT4 A;  3C78 X;  5IO5 A;  1KGL A;  4L3R A;  4QGW A;  2LB6 A;  1BSQ A;  1E06 A;  4OEL A;  3T2X A;  1BWY A;  3BSZ E;  4QAE A;  4XMD A;  4CPI A;  2AF5 A;  3CMP A;  1VYO A;  1VWG B;  2R74 A;  3WJG A;  3HWF A;  2CAM A;  1RLB E;  4Y0R A;  3HK1 A;  1YIV A;  2WSJ A;  4ZCB A;  3FMZ A;  1A2D A;  3L4R A;  3MX7 A;  1A57 A;  2LBA A;  1SWU A;  1T68 X;  2ALL X;  4M7M A;  2WQ9 A;  3S5V A;  1NGL A;  1KZX A;  1AVD A;  1G74 A;  5HTE A;  1GGL A;  5LJD A;  5BVS A;  2G78 A;  2POA A;  4JGL A;  1X8N A;  4YKO A;  3VE2 A;  2CZT A;  4IB7 A;  1NP4 A;  2GC9 A;  5IO6 A;  3STM X;  1A3Y A;  1K24 A;  4I60 A;  4NLJ A;  1GKA B;  1HMT A;  3EYC A;  4GET A;  4ZHD A;  1ZND A;  1O1U A;  1PBY A;  2Y3F A;  1FEN A;  1B4M A;  3MM0 A;  1BJ7 A;  3RDU A;  3WJC A;  3UEW A;  1X8P A;  2RTC B;  1HMR A;  2HNX A;  2KTS A;  2W2A A;  4CV7 A;  3FYF A;  3WJD A;  5HAE A;  4YMY A;  2OFR X;  5FQ6 E;  3ELZ A;  4KC8 A;  2OY1 O;  1XCA A;  3ZW1 A;  2GJ5 A;  3ZWE A;  1CJ5 A;  1PM1 X;  2WEX A;  4GH7 A;  1OEE A;  1RXJ A;  3X00 A;  2R56 A;  2GH7 A;  1SMP I;  4BVM A;  4O49 A;  5HZ8 A;  3EW2 A;  1GM6 A;  1JJX A;  1MM9 A;  5F7G A;  1SRH A;  2MO5 A;  4GE1 A;  1SLD B;  3BLG A;  3FA6 A;  1STR B;  3RDQ A;  1EIO A;  5D48 A;  1SXY A;  4OS8 A;  5FFH A;  2X46 A;  4GDA A;  2RCT A;  2A13 A;  3RY2 A;  1FJ1 E;  1WUB A;  2C1Q A;  1STS B;  2PY1 A;  5IRA A;  2WR6 A;  5EDC A;  3RDS A;  4ZHG A;  1CRB A;  1YP6 A;  2BS6 A;  2UYW A;  1KOI A;  1EPB A;  4GD9 A;  1HN2 A;  2PI3 O;  3GE2 A;  1YP7 A;  4Z2V A;  1YUP A;  3D4R A;  4Z28 A;  1JMZ A;  5B27 A;  1KL4 A;  1FEL A;  3SZJ A;  4FQB B;  4I9R A;  1SWS A;  2A5B A;  4IB9 A;  1SLF B;  1A18 A;  4KCA A;  3HWG A;  1X8Q A;  1G7N A;  4IBA A;  4RUU A;  2VFB A;  4O3W A;  1VWO B;  2IZJ A;  3VG7 A;  2JW1 A;  3V8U A;  5IRW A;  5B10 O;  4D6B A;  5CYB A;  1SXU A;  4GZV A;  3CQR A;  3FEP A;  1SWH A;  4HPA A;  4IAW A;  3HTY A;  3P6H A;  4BX7 A;  5BVT A;  1JBH A;  1SWR A;  3FA9 A;  3ZW0 B;  4A1Y A;  2XST A;  3U03 A;  5KHP A;  4TQ2 A;  3FEK A;  3WZO A;  4I3C A;  1LID A;  3Q34 A;  2F01 A;  1ML7 A;  3STK A;  3CBS A;  4HWM A;  1SWL A;  4A60 A;  2RQ0 A;  1ZNE A;  1LCV A; 
#chains in the Genus database with same CATH homology
 1OBU A;  1SXW A;  3HOL A;  5CE4 A;  2WWP A;  1AQB A;  2HYS A;  2XKL A;  5EDB A;  4ZH6 A;  2AH7 X;  2MJI A;  2L67 A;  5H9A A;  4AZM A;  4YGG A;  4BOE A;  3BX8 A;  5IO7 A;  4DQ4 A;  1ICN A;  1ACD A;  4AZN A;  3BRN A;  4PJ2 A;  3P6F A;  2YG2 A;  3TGA A;  3WBG A;  4ON1 A;  4CSB A;  3D95 A;  2AMM X;  4O4U A;  4K19 A;  1QG5 A;  3KQ0 A;  2OVA A;  4OMW A;  1B8E A;  2FWV A;  2QM9 A;  2JU8 A;  4IB8 A;  4INN A;  4AZP A;  1JV4 A;  2FLJ A;  5FQ8 E;  4LZU A;  1DZM A;  4U8U N;  3WVM A;  1TOU A;  4NLI A;  4COT A;  4ZGU A;  1KT7 A;  3CQN A;  3QKG A;  1FTP A;  4U8U M;  4L1N A;  4O4X A;  2Z4H A;  3CWK A;  1X89 A;  1ZNH A;  2F09 A;  2HZQ A;  2EU7 X;  3P6C A;  4MVE A;  3UEX A;  1DZP A;  4ORW A;  4WFU A;  5HCE C;  3UEU A;  1GX9 A;  1LIC A;  1KXO A;  4HPB A;  3B2K A;  1ICM A;  4MVK A;  5HA1 A;  4NNT A;  1KT3 A;  3BU9 A;  4XMG A;  3JQO A;  4AZO A;  2OFM X;  3RWX A;  1Z24 A;  1CBQ A;  3KFG A;  3I0A A;  4ARH A;  4TNN A;  1VYF A;  1YWD A;  3APW A;  4YCH A;  3WJF A;  1YWB A;  3Q6L A;  1G5W A;  3BU1 A;  4FBR A;  5FAZ A;  4GKC A;  4YCE A;  4U9C A;  5D45 A;  2AT5 X;  3ZUO A;  3T1D A;  1MDC A;  3P6G A;  1EI5 A;  1KQW A;  4HPC A;  5H9L A;  4YFR A;  5H9N A;  1KQX A;  1E5P A;  2R73 A;  3ZUI A;  3JSQ A;  1I06 A;  1IKJ A;  1EQD A;  3KFI A;  3ELX A;  2CBR A;  3F9D A;  3H3I A;  1XKI A;  1LKE A;  3RKG A;  1IW2 A;  4ORU A;  4XMC A;  1PMP A;  1VYG A;  3OJY C;  4PSQ A;  2L9C A;  4ODD A;  4MVL A;  1SY1 A;  2M4L A;  3RZY A;  1JZU A;  1BEB A;  1LPJ A;  2X8F A;  4KT5 A;  3VPJ E;  1BSO A;  4QQ1 A;  3G7X A;  2ZAG A;  2RD7 C;  1GKA A;  1EPA A;  2LKK A;  3AKN A;  2A3F X;  1QQS A;  1SXX A;  2WEW A;  2Z4I A;  5L8I A;  4WHI A;  1EXS A;  3FA8 A;  4UU2 A;  4YKM A;  3EMM A;  3S5X A;  4I3B A;  3NQ3 A;  2ASN X;  1PBO A;  2GTL O;  3FR4 A;  5HCC C;  4IMN A;  3TF6 A;  3NQ9 A;  2RN4 A;  3O19 A;  4NYQ A;  5LJE A;  3RBY A;  3SOT A;  5D47 A;  5HTD A;  4KC7 A;  2QOS C;  5K06 A;  4BQU A;  4WFV A;  3PH5 A;  1DF3 A;  1IFB A;  3EBW A;  3N91 A;  4O3X B;  2Q4N A;  3DTQ A;  3KFH A;  4OS0 A;  3B2I A;  5EED A;  5B29 A;  2DM5 A;  4AZQ A;  4QYN A;  1JYJ A;  2BS5 A;  2AT0 X;  4N7D A;  1TXL A;  2AT3 X;  2JN3 A;  4YDB A;  2FTB A;  3IFB A;  3APU A;  3VG4 A;  1YWA A;  4ZGF A;  5HZ9 A;  5F1E A;  2W2F A;  1CBS A;  2Q9S A;  1ERX A;  5LJH A;  4ORX A;  5L8O A;  3OD9 A;  5KIC A;  4RUN A;  2AKQ A;  1B56 A;  4UU3 A;  1OEJ A;  1TOW A;  3NQK A;  2KW1 A;  2CM4 A;  5HBS A;  3RSW A;  1QAB E;  3FEN A;  4MVI A;  4QGV A;  3K3L A;  4GNW A;  4O3Y A;  5F6B A;  5LKF A;  1OPA A;  4EXZ A;  5LJG A;  3ZW0 A;  1D2U A;  3EM0 A;  2QO4 A;  1N0S A;  1BRQ A;  4WBK A;  2W2B A;  3FR5 A;  1MX7 A;  2WQA E;  5DG4 A;  4LKP A;  3D97 A;  1CBI A;  4I9S A;  2OVD A;  2KTD A;  3HWE A;  2AT6 X;  3NX1 A;  4I6S A;  5AJB A;  4ID2 A;  3VG5 A;  2FR3 A;  3NP1 A;  4M6S A;  3ZW2 A;  2RCQ A;  4NNS A;  3O2Y A;  1JYD A;  3TZS A;  4TLJ A;  3TGB A;  2JU7 A;  1U18 A;  2QO6 A;  1LIE A;  3SAO A;  2X8S A;  3NPO A;  3PED A;  1IFC A;  1E00 A;  1OPB A;  4QYP A;  4Y0Q A;  3NX2 A;  4TKB A;  1S44 A;  4TKJ A;  1D3S A;  2F73 A;  3GAQ A;  5LJK A;  4EEJ A;  5EZ2 A;  3WJB A;  1SA8 A;  4YBP A;  3NR3 A;  3HWD A;  2A0A A;  2KD2 A;  3O22 A;  2Q2M A;  3CBC A;  4O4S A;  4GRJ A;  1S2P A;  5C0N A;  2G79 A;  2OVS A;  3FA7 A;  3MBT A;  4O9S A;  4YDA A;  2L68 A;  1HQP A;  1LIB A;  2CBS A;  3F6Z B;  4XMF A;  1KT6 A;  3ZI8 A;  1OEK A;  2CM9 A;  2JMB A;  1I04 A;  2YMS A;  2AT8 X;  1T8V A;  1MUP A;  4QNI A;  3FR2 A;  1BRP A;  4IMO A;  3EBK A;  2FS6 A;  5LJC A;  1X8U A;  3BX7 A;  3FEL A;  1AB0 A;  5EPQ A;  3CR6 A;  4MIS A;  1BM5 A;  2BLG A;  1ZNL A;  5DPQ A;  1FDQ A;  4LKT A;  2KT4 B;  2ACO A;  5LKE A;  1FEM A;  1O1V A;  2Q2P A;  2G7B A;  1ADL A;  1TVQ A;  4GK9 A;  4ZHF A;  3FW5 A;  3KFF A;  3FLL A;  1ZNG A;  3B2J A;  4ZH9 A;  2AL0 X;  3U9P C;  1P6P A;  4NYR A;  4IAB A;  4YGZ A;  3B2L A;  3P6D A;  3C76 X;  4A1H A;  1U0X A;  5H8T A;  2FR2 A;  1OBP A;  1EII A;  3ZZV A;  1EW3 A;  2X45 A;  2JU3 A;  2NNE A;  3I17 A;  4QZU A;  1UZ2 X;  1ALB A;  2MM3 A;  4LQZ A;  4O4O A;  1SY0 A;  3OE3 A;  3U0D A;  3MVF A;  4AZR A;  5BYP A;  3WXQ A;  4EQA C;  4DQ3 A;  4FBO A;  3FIQ A;  5F58 A;  4A8Z A;  3P6E A;  2A2U A;  4OS3 A;  1DV9 A;  3DSZ A;  4YGH A;  1BSY A;  2NND A;  1FE3 A;  3NBX X;  3S26 A;  3C77 X;  4D6A A;  1GT4 A;  3VE1 A;  2NP1 A;  2NNQ A;  1BLR A;  1SY3 A;  2IFB A;  1ERB A;  2WUT A;  2QO5 A;  4ES7 A;  1LF7 A;  3PEC A;  4HFO A;  5EEE A;  4ZJ0 A;  1KZW A;  2MHD A;  4EFG A;  2GTL N;  4ORY A;  5HZ5 A;  1ZRY A;  3PQU A;  5AQ6 A;  5LJB A;  1AVG I;  1IIU A;  2GTL M;  4YFQ A;  5FQ7 E;  3PH6 A;  1I4U A;  2FRS A;  1S7D A;  1L6M A;  1BBP A;  1DZJ A;  3P02 A;  5HZ6 A;  1O8V A;  3LV4 A;  2A2G A;  5F6Z A;  1NP1 A;  1DC9 A;  1JIW I;  1QFV A;  2O62 A;  4IAX A;  1B0O A;  2ZAI A;  4I95 A;  1MX8 A;  2E4J A;  3WJE A;  4ZR2 A;  3ZW1 B;  1CBR A;  2QMI A;  2ACP X;  4ZFX A;  5HWZ A;  1GT5 A;  4GU8 A;  4QRL A;  3STN A;  3P24 A;  3LHN A;  2Q39 A;  1HBQ A;  1LNM A;  4KH8 A;  4OMX A;  4NP1 A;  3UEV A;  3APV A;  3B2H A;  3PPT A;  1Y9T A;  1PEE A;  3BS2 A;  1JJJ A;  5HA0 A;  1QY0 A;  4FBV A;  1GT3 A;  4KII A;  4U3Q A;  2HMB A;  2BHV A;  5JR8 A;  2K62 A;  4CK4 A;  3PP6 A;  4NW4 A;  3BDR A;  1DZK A;  1U17 A;  1YWC A;  1Y9L A;  4QGX A;  1QFT A;  1I05 A;  2OVE A;  1MVG A;  2X8T A;  2HZR A;  4ALB A;  1EAL A;  1LFO A;  1TW4 A;  2JOZ A;  3AKM A;  3KZA A;  4IB6 A;  1SY2 A;  5D8J A;  5HCD C;  1QWD A;  2OZQ A;  4R0B A;  1GX8 A;  1R0U A;  1X8O A;  2FT9 A;  5D4A A;  2P8G A;  4N7C A;  4LZV A;  3VG2 A;  4O3Z A;  4AW8 A;  1HMS A;  4YH0 A;  5FEN A;  1DFV A;  1QY2 A;  2RA6 A;  1T0V A;  4ORS A;  1HBP A;  3D96 A;  2LBV A;  1E02 A;  1GXA A;  3HOE A;  2HLV A;  2BT9 A;  5HZQ A;  1VPR A;  1G85 A;  2CZU A;  4I3D A;  3JS1 A;  2MWH A;  4TJZ A;  1AEL A;  3BY0 A;  1X71 A;  5H9K A;  5KID A;  3ZQ3 A;  4AYH A;  4YFP A;  1EUO A;  4GDZ A;  3VG6 A;  4ORR A;  5AEO A;  3E3C A;  1QY1 A;  3FW4 A;  3NAD A;  3S60 A;  4ZHC A;  1LIF A;  2L5P A;  4U8U O;  2LA7 A;  4XMH A;  3IA8 A;  4ML7 B;  4ALO A;  3UAQ A;  2ANS A;  4ZHH A;  3PQS A;  2N93 A;  4EDE A;  4MIR A;  4HPD A;  4TKH A;  3WOV A;  3F8A A;  1URE A;  4Y0P A;  2LFO A;  4GNY A;  3TGC A;  4QZT A;  3VG3 A;  4FGI B;  1IKE A;  1H91 A;  1KT5 A;  2FS7 A;  1OBQ A;  3VU1 A;  4YBU A;  4XME A;  3APX A;  1RBP A;  4Y0S A;  2GTF X;  1ZNK A;  3OBL A;  2K23 A;  5BVQ A;  5L8N A;  5AJC A;  1GT1 A;  1KT4 A;  3C78 X;  5IO5 A;  1KGL A;  4L3R A;  4QGW A;  2LB6 A;  1BSQ A;  1E06 A;  1BWY A;  3BSZ E;  4QAE A;  4XMD A;  3CMP A;  2R74 A;  3WJG A;  3HWF A;  1RLB E;  4Y0R A;  3HK1 A;  1YIV A;  2WSJ A;  4ZCB A;  3FMZ A;  1A2D A;  3L4R A;  3MX7 A;  1A57 A;  2LBA A;  4M7M A;  1T68 X;  2ALL X;  3S5V A;  2WQ9 A;  1KZX A;  1NGL A;  1G74 A;  5HTE A;  1GGL A;  5LJD A;  5BVS A;  2G78 A;  2POA A;  4JGL A;  1X8N A;  4YKO A;  3VE2 A;  2CZT A;  4IB7 A;  1NP4 A;  2GC9 A;  5IO6 A;  3STM X;  1A3Y A;  4NLJ A;  1GKA B;  1HMT A;  3EYC A;  4GET A;  4ZHD A;  1ZND A;  1O1U A;  1FEN A;  1B4M A;  1BJ7 A;  3WJC A;  3UEW A;  1X8P A;  1HMR A;  2HNX A;  2KTS A;  2W2A A;  4CV7 A;  3FYF A;  3WJD A;  5HAE A;  4YMY A;  2OFR X;  5FQ6 E;  3ELZ A;  4KC8 A;  1XCA A;  3ZW1 A;  2GJ5 A;  3ZWE A;  1CJ5 A;  1PM1 X;  2WEX A;  4GH7 A;  1OEE A;  2R56 A;  4BVM A;  1SMP I;  4O49 A;  5HZ8 A;  1GM6 A;  1JJX A;  5F7G A;  2MO5 A;  4GE1 A;  3BLG A;  3FA6 A;  1EIO A;  5D48 A;  1SXY A;  4OS8 A;  5FFH A;  2X46 A;  2RCT A;  2A13 A;  2PY1 A;  2WR6 A;  5EDC A;  4ZHG A;  2BS6 A;  1CRB A;  1YP6 A;  1KOI A;  1EPB A;  1HN2 A;  3GE2 A;  1YP7 A;  1YUP A;  3D4R A;  5B27 A;  1FEL A;  4FQB B;  4I9R A;  4IB9 A;  1A18 A;  4KCA A;  3HWG A;  1X8Q A;  1G7N A;  4IBA A;  4RUU A;  4O3W A;  3VG7 A;  2JW1 A;  3V8U A;  4D6B A;  5CYB A;  1SXU A;  4GZV A;  3CQR A;  3FEP A;  4HPA A;  4IAW A;  3HTY A;  3P6H A;  5BVT A;  1JBH A;  3FA9 A;  3ZW0 B;  4A1Y A;  2XST A;  3U03 A;  5KHP A;  4TQ2 A;  3FEK A;  4I3C A;  1LID A;  1ML7 A;  3STK A;  3CBS A;  4HWM A;  4A60 A;  2RQ0 A;  1ZNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...