1RAVA

Recombinant avidin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
124
structure length
124
Chain Sequence
RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Glycoprotein
molecule keywords AVIDIN
publication title Biochemical characterization and crystal structure of a recombinant hen avidin and its acidic mutant expressed in Escherichia coli.
pubmed doi rcsb
source organism Gallus gallus
total genus 24
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1ravA00
1KFFA 2RTNB 1N4JA 3RDUA 2OF8A 4JO6A 1DF8A 1SRJA 1VYOA 1SLDB 1N7YA 4Z2PA 4Y59A 2RTGB 4CPHB 2RTJA 1VWGB 1SWRA 1LELA 1RSTB 2UYWA 3EW2A 3VHIA 5F2BA 2Y3FA 2FHNX 4U46A 5CHKA 4GD9A 1MOYA 1NBXA 1NC9A 2A5BA 3SZIA 3T2WA 2RTDB 3VHMA 1VWLB 3RDXA 3WYQA 1SWQA 1VWEB 3WYPA 3WZPA 4BX5B 4BX7B 1SWKA 4Z2VA 1VWKB 1N9YA 3RY1A 1SWSA 4BX6B 1VWFB 2F01A 1MEPA 2OFAA 4I60A 1KL4A 1VWAB 1SWHA 2RTPB 4YVBA 1VWHB 2IZKA 4EKVA 1SWCA 1HQQA 3SZJA 1AVDA 5B5GA 4GJVA 3RE5A 1Y52X 2IZDB 2IZHB 2RTIB 1VWNB 1VWPB 2QCBA 2IZCB 1LUQA 1MM9A 4GGRA 3PK2A 1KL5A 1SWBA 5CSEA 3FDCA 1SLFB 4JNJA 3RY2A 4BBOA 1VWRB 3MM0A 3RDSA 1SWDA 1SWEA 2AVIA 2RTOB 2RTLA 1VWJB 1VWMB 1SWNA 1RXJA 1SWJA 4IRWA 5IRWA 1VWQB 3WZQA 3MG5A 4BJ8A 5IRAA 3T6FA 1NDJA 1Y55X 1SRFA 4Z2OA 3X00A 1VWIB 3RDOA 4CPEA 2RTMA 1STRB 1SWOA 1Y53X 1LCVA 1WBIA 1RXHA 1SRGA 2RTEB 3EW1A 1NQMA 2RTHB 3RE6A 2CAMA 4JHQA 1STPA 2RTRB 3WZOA 2GH7A 4OKAA 3RDMA 4CPIA 2A8GA 4BCSA 1SWFA 1VWCB 2C1QA 1LCZA 2IZGB 2Y32A 1SREA 5IRUA 1HXZA 2MF6A 4BX6A 1I9HA 5B5FA 1SWUA 4BX5A 2IZAA 1VWBB 2RTKA 3T2XA 1LDOA 3T6LA 1VWDB 1RSUB 1IJ8A 1AVEA 1STSB 2IZEB 3SZHA 1HY2A 2OF9A 4DNEA 1VWOB 3VHHA 4CPHA 1RXKA 2RTCB 2IZFB 2RTQB 2OFBA 4GGZA 3RDQA 2A5CA 3VGWA 4CPFA 2FHLA 4GGTA 2RTAA 4Z27A 2IZIA 1HXLA 2IZLB 4GJSA 1SWPA 4BX7A 2BC3A 4Y5DA 1N43A 2WPUA 4Z6JA 2JGSA 5JD2A 1LDQA 1SRHA 5K67A 5L3YA 1NQNA 1SWLA 1SWGA 2RTFB 2UZ2A 2IZJA 1SLGB 1SLEB 1RAVA 1SRIA 2C1SA 2Y3EA 1SWTA 4GDAA 5K68A 1SWAA 1KL3A 1MK5A 1N9MA 2ZSCA 1LCWA 2G5LA 1PTSA 2C4IA 2RTBB 3WZNA 4Z28A 2IZBA
chains in the Genus database with same CATH superfamily
4CDDA 3APVA 2OF8A 3B2IA 3BDRA 4HPAA 1OEKA 3NR3A 1PBOA 2F09A 5L8OA 1SY3A 1OPBA 4Z2PA 2OY7A 3VG7A 1FELA 2X8TA 1SXWA 3ZW1B 4CPHB 2RTJA 1YWDA 2QO4A 2ZAIA 3S60A 3Q6LA 1LELA 2UYWA 3O2YA 4CDCA 4TJZA 4XMDA 4N7DA 4QRLA 1ZNDA 2CM9A 3S5XA 4CDFA 1CJ5A 5HZ9A 2A5BA 3T2WA 2RTDB 3WYQA 1VWLB 2R73A 3F8AA 1WUBA 1SWKA 2WEWA 2PY1A 4UU2A 2FKJA 1VWKB 2CM4A 2HLVA 1VWFB 1MEPA 2OFAA 2BLGA 3ZUOA 1FENA 1KT7A 5D45A 1VWHB 2IZKA 4K19A 1UYNX 2FWVA 1XKIA 3NADA 2OZQA 4YGHA 2QM9A 1CBIA 2RTIB 3CQRA 5LJDA 4GK9A 4O3XB 1KXOA 4MIRA 1HN2A 1LIEA 5LJCA 2LB6A 4MVIA 4AZPA 1T0VA 3PK2A 1KOIA 4MVLA 2Q2PA 2GTLN 5DPQA 5F1EA 3RY2A 2F73A 3KFHA 1U0XA 5KICA 5F6ZA 5LJHA 4IABA 1EQDA 1ZNHA 2MJIA 3ELXA 1SWEA 1SXUA 2AVIA 1G74A 2RTLA 4I6SA 1GX9A 3L4RA 1EIOA 5D4AA 5L8IA 1FTPA 2LA7A 1VWQB 4A8ZA 3MG5A 2L68A 4B55A 2OY1O 5HCCC 1NDJA 1NP4A 1KT5A 4EEJA 1XCAA 4UU3A 4CSBA 1VWIB 4TNNA 2QO6A 5FQ7E 3RDOA 3UEVA 1Y53X 1ERBA 4O3ZA 1BSYA 1OEEA 3P02A 4U8UN 5BVQA 2RTEB 4FQBB 3EW1A 1NQMA 2MHDA 3CBSA 3FR2A 1S7DA 2KTSA 2GH7A 3RDMA 3WZOA 1X8PA 3TF6A 5LJBA 2A8GA 2NNEA 1SWFA 1VWCB 2HYSA 3VE2A 2IZGB 4OS0A 4BX6A 5IRUA 1HXZA 1OBPA 1X71A 4GU8A 4CK4A 2JMBA 2I5VO 3P6DA 4PJ2A 1AQBA 3LHNA 4ALOA 1LF7A 3VG6A 4KCAA 4O49A 2G7BA 2X55A 4YGZA 5DG4A 1YP6A 3VPJE 1IJ8A 4M7MA 2OF9A 3BU1A 2R74A 1E00A 2IZFB 2RTQB 4GGZA 1B0OA 5HCDC 2M4LA 5B11O 1DC9A 2NNQA 2FHLA 1TXLA 3C76X 3VGWA 3WVMA 4AZRA 4MEEA 3ZUIA 3FR5A 3OJYC 2IZLB 4GJSA 3SLOA 4BX7A 2BC3A 2L67A 1KGLA 1E5PA 1YUPA 5JD2A 3U03A 1LDQA 3C78X 2RCTA 2ALLX 4ZH9A 2FTBA 4PSQA 2JOZA 1OSPO 5KIDA 2OFRX 3KVNA 2RTFB 3P6CA 4ZR2A 4ORRA 3RSWA 3UAQA 2UZ2A 5HBSA 1SLGB 1SY0A 4I3DA 3SAOA 1SLEB 1EUOA 2Y3EA 2C1SA 1SWTA 1W4TA 2RN4A 4EXZA 1N9MA 2BSZA 2OL8O 1UZ2X 1YP7A 1ACDA 2RD7C 4Z28A 2IZBA 3WJEA 4MVEA 4ORXA 1K24A 2AF5A 5FQ8E 1KFFA 3ELZA 5EZ2A 3ZW2A 1SRJA 2JU7A 1EW3A 3WJGA 2EU7X 2AT8X 3CQNA 4QYPA 3BY0A 1MUPA 1HQPA 2XSTA 3PH5A 2G79A 4L3RA 5HTEA 3CWKA 1JJXA 4XMFA 2POAA 2Z4HA 4QGXA 5AJBA 3E3CA 4DCBA 1RSTB 2K23A 1RLBE 2X46A 2Y3FA 4YCEA 3NBXX 2X56A 2FHNX 4U46A 4I9RA 5CHKA 1MOYA 1MDCA 1NBXA 2HNXA 3O22A 4XMHA 3VHMA 3F9DA 1VWEB 4ML7B 3WYPA 4BX7B 3HOEA 2CZTA 3DSZA 5JR8A 2R56A 1QQSA 1PMPA 1QFTA 4INNA 4LZVA 3RY1A 1JV4A 5CE4A 2G78A 4HPCA 4I60A 1SMPI 1VWAB 2QMIA 3SLJA 1BJ7A 3NX2A 1G5WA 2AL0X 1ZNGA 4HWMA 1ICMA 4MISA 1SWCA 4EKVA 2GTLO 1AVDA 2KW1A 3HWEA 1B4MA 2W2BA 3RE5A 4OS3A 2IZDB 1BSOA 2IZHB 5H9LA 4ID2A 5LJGA 1JJJA 1CBRA 1AELA 1SY2A 1CBSA 1VWPB 1EPAA 1H91A 1LUQA 4COTA 4QGVA 1JQPA 3JQOA 4LQZA 1QY0A 4YCHA 3HWDA 5EDBA 4LKPA 2HZRA 4BBOA 1JJUA 3B2JA 2ASNX 3MVFA 4YMYA 2GJ5A 3LV4A 1AVGI 2RTOB 4WBKA 3ZWEA 1VWJB 2Q2MA 1SWNA 1RXJA 2CZUA 1TOUA 4KIIA 5IRWA 3AEHA 1KQWA 4U8UO 5EDCA 3FIDA 2W2AA 1KQXA 1SRFA 1JMXA 3VE1A 4ZGUA 3PQSA 3X00A 2A3FX 1IFBA 3EC5A 3GAQA 1STRB 2IFBA 3BX7A 3JSQA 3PEDA 2X8SA 1SRGA 3D97A 1ZRYA 3D9WA 1EXSA 2RTHB 4OMWA 2CAMA 3FA7A 1B56A 3EYCA 3B2LA 4JHQA 3U0DA 5AQ6A 2BS5A 4L1NA 1GX8A 4OMXA 4CPIA 4RUUA 1LICA 2C1QA 1LCZA 2X4MA 4CV7A 3OBLA 1IW2A 5HTDA 1SREA 5IO7A 2LBAA 3VU1A 1SA8A 2JU8A 3FA9A 2FLJA 4A1YA 3WBGA 1E06A 5CYBA 3PPTA 5HA1A 1LDOA 4FGIB 3CBCA 1HMSA 2CBRA 3T6LA 2Z4IA 3FEPA 4KT5A 2QOSC 1IKJA 3S5VA 3EM0A 1BRPA 2LKKA 4O4UA 3RZYA 4DNEA 3Q34A 3VHHA 1TOWA 1FE3A 4YGGA 2RTCB 3DTQA 4IAWA 4QAEA 3RKGA 4GUZA 1BEBA 4O9SA 2CBSA 3ZI8A 3JS1A 4Z27A 2XKLA 3HOLA 1OPAA 1HXLA 2GTLM 1JMZA 3KQ0A 1ML7A 2OVDA 4Y5DA 1N43A 2WPUA 3FA8A 4HFOA 4BOEA 5K06A 2VFCA 3KFFA 3AUMO 1SWLA 1SWGA 5F58A 5FAZA 1BLRA 3HPEA 1DFVA 2AKQA 1Y0GA 2OL6O 3D96A 1I4UA 3BRNA 1RAVA 4YDBA 1LPJA 4ORSA 2Q39A 5K68A 1U18A 2VDFA 1X8QA 2ZSCA 1E2TA 1LCWA 2RTBB 4KC8A 4OS8A 1KT3A 4U8UM 4ZHHA 1LNMA 1FDQA 5D8JA 3AKNA 4WFVA 1DV9A 3P6HA 2OFMX 1DF8A 4YBUA 1SLDB 3B2HA 1N7YA 2DJFA 4LKTA 4QZTA 3HWGA 1QY2A 4Y0PA 5HCEC 1UYOX 2NP1A 4O3YA 3VG5A 3HK1A 1D2UA 1U17A 2JW1A 4NLIA 5B3MO 4O3WA 1VWGB 3HWFA 3I0AA 3EW2A 3VHIA 4I9SA 4ZFXA 2QOMA 4IB7A 4I3BA 1I78A 1X89A 2L9CA 2L5PA 1NC9A 1MVGA 3SZIA 2MWHA 3SLTA 4Z2OA 4Z2VA 3D4RA 3SOTA 2AT0X 3ZW0A 1SWSA 2WQ9A 5HZ8A 4BX6B 4ZHFA 4NV7A 1A3YA 4ORWA 1HQQA 2WR6A 3NQKA 3LTWA 4LZUA 3O19A 3WJCA 1Y52X 4XMCA 1AB0A 1K3BA 4GDZA 1VWNB 2QCBA 2WUTA 4IBAA 4KH8A 4RUNA 1QFVA 2FT9A 1FJ1E 1QWDA 3KZAA 2FGSA 4GGRA 5CSEA 1SLFB 2KD2A 1YWBA 2W2FA 1KT6A 5KHPA 4C5PA 4AYHA 1GKAA 1JZUA 3UEWA 4NNTA 2AMMX 1CRBA 2ZAGA 1VWMB 1SWJA 2MM3A 2X45A 4IRWA 4TKJA 3RWXA 3WZQA 1EI5A 2WEXA 4OELA 1CBQA 1HMTA 2A2GA 3CKGA 1Y55X 1DZKA 2NNDA 1GT3A 4NV8A 2GC9A 2I5ZO 3ZW1A 4XMEA 2FRSA 1BWYA 4WFUA 4ZJ0A 3PECA 1D3SA 4CPEA 2RTMA 1GT5A 5EEEA 1SWOA 3FR4A 1VPRA 4YFPA 3U9PC 4I95A 1LKEA 4NYQA 5B27A 3NPOA 3MX7A 3RE6A 1Y9LA 3ZW0B 3TZSA 5D47A 2RA6A 4TKBA 4D6BA 3FENA 1STPA 3EMMA 3WXQA 4FBRA 4NYRA 4GNWA 2FS6A 2VFBA 2WSJA 2ANSA 4BCSA 3FELA 4R0BA 1ALBA 3FYFA 4NP1A 2ACPX 3WJBA 3NP1A 4Y0RA 5LJKA 1I05A 5LKEA 4GE1A 4BVMA 1T68X 3BSZE 5FQ6E 1EALA 1W5RA 1S2PA 5B5FA 1QG5A 2IZAA 1JIWI 4IB8A 4IMOA 1VWBB 5BVSA 1EIIA 5H9NA 1ZNKA 1R0UA 4U3QA 5F6BA 3FW4A 5H9AA 3STNA 4MVKA 4Y0QA 2JU3A 1GKAB 3BLGA 2AT3X 2KT4B 4BQUA 4EDEA 3APXA 4CDEA 1ZNEA 1PM1X 1KZWA 3RDQA 1G7NA 1GT1A 4A1HA 4CPFA 1JYJA 3NQ3A 4NNSA 4ZHDA 4YFRA 4YKOA 5IXGA 2OVAA 2OYBO 1RBPA 1SWPA 3F6ZB 3CR6A 1O1UA 5FFHA 1ICNA 1GGLA 4O4XA 3TGCA 1X8UA 4A60A 3N91A 4JGLA 1L6MA 1TVQA 1I06A 2BS6A 1NQNA 3G7XA 4U9CA 4Y0SA 3UEXA 1PEEA 5IO5A 3I17A 2IZJA 1DF3A 5H9KA 3OE3A 1KZXA 2P8GA 3OD9A 1B8EA 4IB6A 3VG4A 5C0NA 1SWAA 4ZGFA 1KL3A 1MK5A 1MX7A 5EEDA 3VG2A 3PDFA 1PTSA 1LIDA 3FEKA 4AZNA 4QGWA 1VYFA 1SY1A 2RTNB 1N4JA 4AZOA 3RDUA 1ERXA 4IAXA 1VYOA 4JO6A 2FR2A 4TQ2A 4YBPA 2YMSA 5BVTA 2HMBA 5B10O 4Y59A 3IFBA 1Z24A 2RTGB 2YG2A 4ZHCA 2BT9A 4I3CA 3KFIA 4IMNA 4QYNA 1HBPA 3P6GA 2LFOA 1SWRA 1X8NA 2FS7A 4AW8A 2X32A 4QQ1A 5F2BA 3PH6A 2Q9SA 1E02A 2JN3A 4GD9A 4WHIA 5B29A 1P6PA 1UREA 2HKDA 3WOVA 2OY8A 3RDXA 3WZPA 1IIUA 1SWQA 1JYDA 1YIVA 5D48A 4EFGA 4ORYA 5FENA 3FLLA 1N9YA 3NQ9A 2FR3A 4O4SA 2F01A 4GETA 1Y9TA 1KL4A 2G8CO 1SWHA 1ZNLA 2RTPB 3PQUA 4M6SA 2PI3O 4YVBA 5B2AO 3FMZA 3SZJA 3TGAA 4NW4A 5B5GA 2RQ0A 1ADLA 4D6AA 2AT5X 4GJVA 4GZVA 1BM5A 2A13A 2AH7X 4EQAC 5HWZA 2IZCB 1LIFA 1MM9A 2Q4NA 2OY5O 3AKMA 3BS2A 1I04A 2E4JA 4XMGA 1KL5A 1OBUA 1SWBA 2MO5A 2OVEA 2RCQA 3C77X 4TLJA 3FDCA 2OVSA 2FKGA 4JNJA 4ES7A 2AT6X 4ALBA 1OBQA 4ZCBA 4AZQA 1VWRB 3MM0A 3RDSA 4FBOA 1SWDA 1DZPA 2K62A 1MX8A 3MBTA 1KT4A 1N0SA 3H3IA 1X8OA 2ACOA 4BGFA 4OEMA 4HPDA 3WJFA 3S26A 1SXYA 4TKHA 4HPBA 3B2KA 4BJ8A 5IRAA 3T6FA 1W6FA 3FIQA 3EBWA 2N93A 5F7GA 2HZQA 3GE2A 3CMPA 1JBHA 2OL7A 1O1VA 1LCVA 5BYPA 1WBIA 2WWPA 4ON1A 1NGLA 1YWCA 1RXHA 4YFQA 4ARHA 3P24A 5AJCA 3VG3A 1SXXA 3BX8A 2RTRB 4NLJA 1DZMA 1YWAA 2WQAE 4OKAA 5H8TA 3UEUA 1O8VA 5IO6A 4N7CA 2QO5A 3FW5A 4DQ4A 2Y32A 3T1DA 3IA8A 2MF6A 3TGBA 4QNIA 5L8NA 1IFCA 1A2DA 1I9HA 2LBVA 2GTFX 3APWA 1SWUA 4BX5A 2X34A 4O4OA 5HZQA 2RTKA 4QZUA 2BHVA 3P6FA 4YDAA 4YH0A 3T2XA 3WJDA 1S44A 3CKFA 4AZMA 1VWDB 1VYGA 1RSUB 1PBYA 2KTDA 4GNYA 1AVEA 1STSB 2IZEB 4ODDA 4ORUA 3STMX 1HY2A 1LFOA 4KC7A 3SZHA 3ZQ3A 5HZ6A 1VWOB 5LKFA 1QY1A 4CPHA 1RXKA 3STKA 2OFBA 4YKMA 1IKEA 4GRJA 1GXAA 1A18A 2A5CA 3KFGA 1TW4A 3HTYA 1A57A 4GGTA 2RTAA 5EPQA 3APUA 2IZIA 3RBYA 3P6EA 5HAEA 1QABE 2O62A 1HMRA 3BU9A 4GH7A 1OEJA 4Z6JA 4ZH6A 2JGSA 1SRHA 5K67A 5L3YA 3NX1A 2DJGA 1GX3A 3FA6A 5LJEA 1BSQA 1HBQA 3QKGA 1NP1A 4FBVA 4GKCA 4IB9A 1BBPA 1GM6A 1GT4A 1LIBA 5AEOA 3K3LA 1EPBA 4DQ3A 3QQ2A 1SRIA 4ZHGA 2X8FA 4GDAA 1BRQA 1FEMA 3PP6A 3V8UA 5HA0A 3WZNA 2G5LA 1DZJA 1T8VA 2A0AA 2C4IA 2DM5A 3D95A 1G85A 3EBKA 4BX5B 3ZZVA 5HZ5A 2A2UA
chains in the Genus database with same CATH topology
1KFFA 2RTNB 1N4JA 3RDUA 2OF8A 4JO6A 1DF8A 1SRJA 1VYOA 1SLDB 1N7YA 4Z2PA 4Y59A 2RTGB 4CPHB 2RTJA 1VWGB 1SWRA 1LELA 1RSTB 2UYWA 3EW2A 3VHIA 5F2BA 2Y3FA 2FHNX 4U46A 5CHKA 4GD9A 1MOYA 1NBXA 1NC9A 2A5BA 3SZIA 3T2WA 2RTDB 3VHMA 1VWLB 3RDXA 3WYQA 1SWQA 1VWEB 3WYPA 3WZPA 4BX5B 4BX7B 1SWKA 4Z2VA 1VWKB 1N9YA 3RY1A 1SWSA 4BX6B 1VWFB 2F01A 1MEPA 2OFAA 4I60A 1KL4A 1VWAB 1SWHA 2RTPB 4YVBA 1VWHB 2IZKA 4EKVA 1SWCA 1HQQA 3SZJA 1AVDA 5B5GA 4GJVA 3RE5A 1Y52X 2IZDB 2IZHB 2RTIB 1VWNB 1VWPB 2QCBA 2IZCB 1LUQA 1MM9A 4GGRA 3PK2A 1KL5A 1SWBA 5CSEA 3FDCA 1SLFB 4JNJA 3RY2A 4BBOA 1VWRB 3MM0A 3RDSA 1SWDA 1SWEA 2AVIA 2RTOB 2RTLA 1VWJB 1VWMB 1SWNA 1RXJA 1SWJA 4IRWA 5IRWA 1VWQB 3WZQA 3MG5A 4BJ8A 5IRAA 3T6FA 1NDJA 1Y55X 1SRFA 4Z2OA 3X00A 1VWIB 3RDOA 4CPEA 2RTMA 1STRB 1SWOA 1Y53X 1LCVA 1WBIA 1RXHA 1SRGA 2RTEB 3EW1A 1NQMA 2RTHB 3RE6A 2CAMA 4JHQA 1STPA 2RTRB 3WZOA 2GH7A 4OKAA 3RDMA 4CPIA 2A8GA 4BCSA 1SWFA 1VWCB 2C1QA 1LCZA 2IZGB 2Y32A 1SREA 5IRUA 1HXZA 2MF6A 4BX6A 1I9HA 5B5FA 1SWUA 4BX5A 2IZAA 1VWBB 2RTKA 3T2XA 1LDOA 3T6LA 1VWDB 1RSUB 1IJ8A 1AVEA 1STSB 2IZEB 3SZHA 1HY2A 2OF9A 4DNEA 1VWOB 3VHHA 4CPHA 1RXKA 2RTCB 2IZFB 2RTQB 2OFBA 4GGZA 3RDQA 2A5CA 3VGWA 4CPFA 2FHLA 4GGTA 2RTAA 4Z27A 2IZIA 1HXLA 2IZLB 4GJSA 1SWPA 4BX7A 2BC3A 4Y5DA 1N43A 2WPUA 4Z6JA 2JGSA 5JD2A 1LDQA 1SRHA 5K67A 5L3YA 1NQNA 1SWLA 1SWGA 2RTFB 2UZ2A 2IZJA 1SLGB 1SLEB 1RAVA 1SRIA 2C1SA 2Y3EA 1SWTA 4GDAA 5K68A 1SWAA 1KL3A 1MK5A 1N9MA 2ZSCA 1LCWA 2G5LA 1PTSA 2C4IA 2RTBB 3WZNA 4Z28A 2IZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFF A;  2RTN B;  1N4J A;  3RDU A;  2OF8 A;  4JO6 A;  1DF8 A;  1SRJ A;  1VYO A;  1SLD B;  1N7Y A;  4Z2P A;  4Y59 A;  2RTG B;  4CPH B;  2RTJ A;  1VWG B;  1SWR A;  1LEL A;  1RST B;  2UYW A;  3EW2 A;  3VHI A;  5F2B A;  2Y3F A;  2FHN X;  4U46 A;  5CHK A;  4GD9 A;  1MOY A;  1NBX A;  1NC9 A;  2A5B A;  3SZI A;  3T2W A;  2RTD B;  3VHM A;  1VWL B;  3RDX A;  3WYQ A;  1SWQ A;  1VWE B;  3WYP A;  3WZP A;  4BX5 B;  4BX7 B;  1SWK A;  4Z2V A;  1VWK B;  1N9Y A;  3RY1 A;  1SWS A;  4BX6 B;  1VWF B;  2F01 A;  1MEP A;  2OFA A;  4I60 A;  1KL4 A;  1VWA B;  1SWH A;  2RTP B;  4YVB A;  1VWH B;  2IZK A;  4EKV A;  1SWC A;  1HQQ A;  3SZJ A;  1AVD A;  5B5G A;  4GJV A;  3RE5 A;  1Y52 X;  2IZD B;  2IZH B;  2RTI B;  1VWN B;  1VWP B;  2QCB A;  2IZC B;  1LUQ A;  1MM9 A;  4GGR A;  3PK2 A;  1KL5 A;  1SWB A;  5CSE A;  3FDC A;  1SLF B;  4JNJ A;  3RY2 A;  4BBO A;  1VWR B;  3MM0 A;  3RDS A;  1SWD A;  1SWE A;  2AVI A;  2RTO B;  2RTL A;  1VWJ B;  1VWM B;  1SWN A;  1RXJ A;  1SWJ A;  4IRW A;  5IRW A;  1VWQ B;  3WZQ A;  3MG5 A;  4BJ8 A;  5IRA A;  3T6F A;  1NDJ A;  1Y55 X;  1SRF A;  4Z2O A;  3X00 A;  1VWI B;  3RDO A;  4CPE A;  2RTM A;  1STR B;  1SWO A;  1Y53 X;  1LCV A;  1WBI A;  1RXH A;  1SRG A;  2RTE B;  3EW1 A;  1NQM A;  2RTH B;  3RE6 A;  2CAM A;  4JHQ A;  1STP A;  2RTR B;  3WZO A;  2GH7 A;  4OKA A;  3RDM A;  4CPI A;  2A8G A;  4BCS A;  1SWF A;  1VWC B;  2C1Q A;  1LCZ A;  2IZG B;  2Y32 A;  1SRE A;  5IRU A;  1HXZ A;  2MF6 A;  4BX6 A;  1I9H A;  5B5F A;  1SWU A;  4BX5 A;  2IZA A;  1VWB B;  2RTK A;  3T2X A;  1LDO A;  3T6L A;  1VWD B;  1RSU B;  1IJ8 A;  1AVE A;  1STS B;  2IZE B;  3SZH A;  1HY2 A;  2OF9 A;  4DNE A;  1VWO B;  3VHH A;  4CPH A;  1RXK A;  2RTC B;  2IZF B;  2RTQ B;  2OFB A;  4GGZ A;  3RDQ A;  2A5C A;  3VGW A;  4CPF A;  2FHL A;  4GGT A;  2RTA A;  4Z27 A;  2IZI A;  1HXL A;  2IZL B;  4GJS A;  1SWP A;  4BX7 A;  2BC3 A;  4Y5D A;  1N43 A;  2WPU A;  4Z6J A;  2JGS A;  5JD2 A;  1LDQ A;  1SRH A;  5K67 A;  5L3Y A;  1NQN A;  1SWL A;  1SWG A;  2RTF B;  2UZ2 A;  2IZJ A;  1SLG B;  1SLE B;  1RAV A;  1SRI A;  2C1S A;  2Y3E A;  1SWT A;  4GDA A;  5K68 A;  1SWA A;  1KL3 A;  1MK5 A;  1N9M A;  2ZSC A;  1LCW A;  2G5L A;  1PTS A;  2C4I A;  2RTB B;  3WZN A;  4Z28 A;  2IZB A; 
#chains in the Genus database with same CATH topology
 4CDD A;  3APV A;  2OF8 A;  3B2I A;  3BDR A;  4HPA A;  1OEK A;  3NR3 A;  1PBO A;  2F09 A;  5L8O A;  1SY3 A;  1OPB A;  4Z2P A;  2OY7 A;  3VG7 A;  1FEL A;  2X8T A;  1SXW A;  3ZW1 B;  4CPH B;  2RTJ A;  1YWD A;  2QO4 A;  2ZAI A;  3S60 A;  3Q6L A;  1LEL A;  2UYW A;  3O2Y A;  4CDC A;  4TJZ A;  4XMD A;  4N7D A;  4QRL A;  1ZND A;  2CM9 A;  3S5X A;  4CDF A;  1CJ5 A;  5HZ9 A;  2A5B A;  3T2W A;  2RTD B;  3WYQ A;  1VWL B;  2R73 A;  3F8A A;  1WUB A;  1SWK A;  2WEW A;  2PY1 A;  4UU2 A;  2FKJ A;  1VWK B;  2CM4 A;  2HLV A;  1VWF B;  1MEP A;  2OFA A;  2BLG A;  3ZUO A;  1FEN A;  1KT7 A;  5D45 A;  1VWH B;  2IZK A;  4K19 A;  1UYN X;  2FWV A;  1XKI A;  3NAD A;  2OZQ A;  4YGH A;  2QM9 A;  1CBI A;  2RTI B;  3CQR A;  5LJD A;  4GK9 A;  4O3X B;  1KXO A;  4MIR A;  1HN2 A;  1LIE A;  5LJC A;  2LB6 A;  4MVI A;  4AZP A;  1T0V A;  3PK2 A;  1KOI A;  4MVL A;  2Q2P A;  2GTL N;  5DPQ A;  5F1E A;  3RY2 A;  2F73 A;  3KFH A;  1U0X A;  5KIC A;  5F6Z A;  5LJH A;  4IAB A;  1EQD A;  1ZNH A;  2MJI A;  3ELX A;  1SWE A;  1SXU A;  2AVI A;  1G74 A;  2RTL A;  4I6S A;  1GX9 A;  3L4R A;  1EIO A;  5D4A A;  5L8I A;  1FTP A;  2LA7 A;  1VWQ B;  4A8Z A;  3MG5 A;  2L68 A;  4B55 A;  2OY1 O;  5HCC C;  1NDJ A;  1NP4 A;  1KT5 A;  4EEJ A;  1XCA A;  4UU3 A;  4CSB A;  1VWI B;  4TNN A;  2QO6 A;  5FQ7 E;  3RDO A;  3UEV A;  1Y53 X;  1ERB A;  4O3Z A;  1BSY A;  1OEE A;  3P02 A;  4U8U N;  5BVQ A;  2RTE B;  4FQB B;  3EW1 A;  1NQM A;  2MHD A;  3CBS A;  3FR2 A;  1S7D A;  2KTS A;  2GH7 A;  3RDM A;  3WZO A;  1X8P A;  3TF6 A;  5LJB A;  2A8G A;  2NNE A;  1SWF A;  1VWC B;  2HYS A;  3VE2 A;  2IZG B;  4OS0 A;  4BX6 A;  5IRU A;  1HXZ A;  1OBP A;  1X71 A;  4GU8 A;  4CK4 A;  2JMB A;  2I5V O;  3P6D A;  4PJ2 A;  1AQB A;  3LHN A;  4ALO A;  1LF7 A;  3VG6 A;  4KCA A;  4O49 A;  2G7B A;  2X55 A;  4YGZ A;  5DG4 A;  1YP6 A;  3VPJ E;  1IJ8 A;  4M7M A;  2OF9 A;  3BU1 A;  2R74 A;  1E00 A;  2IZF B;  2RTQ B;  4GGZ A;  1B0O A;  5HCD C;  2M4L A;  5B11 O;  1DC9 A;  2NNQ A;  2FHL A;  1TXL A;  3C76 X;  3VGW A;  3WVM A;  4AZR A;  4MEE A;  3ZUI A;  3FR5 A;  3OJY C;  2IZL B;  4GJS A;  3SLO A;  4BX7 A;  2BC3 A;  2L67 A;  1KGL A;  1E5P A;  1YUP A;  5JD2 A;  3U03 A;  1LDQ A;  3C78 X;  2RCT A;  2ALL X;  4ZH9 A;  2FTB A;  4PSQ A;  2JOZ A;  1OSP O;  5KID A;  2OFR X;  3KVN A;  2RTF B;  3P6C A;  4ZR2 A;  4ORR A;  3RSW A;  3UAQ A;  2UZ2 A;  5HBS A;  1SLG B;  1SY0 A;  4I3D A;  3SAO A;  1SLE B;  1EUO A;  2Y3E A;  2C1S A;  1SWT A;  1W4T A;  2RN4 A;  4EXZ A;  1N9M A;  2BSZ A;  2OL8 O;  1UZ2 X;  1YP7 A;  1ACD A;  2RD7 C;  4Z28 A;  2IZB A;  3WJE A;  4MVE A;  4ORX A;  1K24 A;  2AF5 A;  5FQ8 E;  1KFF A;  3ELZ A;  5EZ2 A;  3ZW2 A;  1SRJ A;  2JU7 A;  1EW3 A;  3WJG A;  2EU7 X;  2AT8 X;  3CQN A;  4QYP A;  3BY0 A;  1MUP A;  1HQP A;  2XST A;  3PH5 A;  2G79 A;  4L3R A;  5HTE A;  3CWK A;  1JJX A;  4XMF A;  2POA A;  2Z4H A;  4QGX A;  5AJB A;  3E3C A;  4DCB A;  1RST B;  2K23 A;  1RLB E;  2X46 A;  2Y3F A;  4YCE A;  3NBX X;  2X56 A;  2FHN X;  4U46 A;  4I9R A;  5CHK A;  1MOY A;  1MDC A;  1NBX A;  2HNX A;  3O22 A;  4XMH A;  3VHM A;  3F9D A;  1VWE B;  4ML7 B;  3WYP A;  4BX7 B;  3HOE A;  2CZT A;  3DSZ A;  5JR8 A;  2R56 A;  1QQS A;  1PMP A;  1QFT A;  4INN A;  4LZV A;  3RY1 A;  1JV4 A;  5CE4 A;  2G78 A;  4HPC A;  4I60 A;  1SMP I;  1VWA B;  2QMI A;  3SLJ A;  1BJ7 A;  3NX2 A;  1G5W A;  2AL0 X;  1ZNG A;  4HWM A;  1ICM A;  4MIS A;  1SWC A;  4EKV A;  2GTL O;  1AVD A;  2KW1 A;  3HWE A;  1B4M A;  2W2B A;  3RE5 A;  4OS3 A;  2IZD B;  1BSO A;  2IZH B;  5H9L A;  4ID2 A;  5LJG A;  1JJJ A;  1CBR A;  1AEL A;  1SY2 A;  1CBS A;  1VWP B;  1EPA A;  1H91 A;  1LUQ A;  4COT A;  4QGV A;  1JQP A;  3JQO A;  4LQZ A;  1QY0 A;  4YCH A;  3HWD A;  5EDB A;  4LKP A;  2HZR A;  4BBO A;  1JJU A;  3B2J A;  2ASN X;  3MVF A;  4YMY A;  2GJ5 A;  3LV4 A;  1AVG I;  2RTO B;  4WBK A;  3ZWE A;  1VWJ B;  2Q2M A;  1SWN A;  1RXJ A;  2CZU A;  1TOU A;  4KII A;  5IRW A;  3AEH A;  1KQW A;  4U8U O;  5EDC A;  3FID A;  2W2A A;  1KQX A;  1SRF A;  1JMX A;  3VE1 A;  4ZGU A;  3PQS A;  3X00 A;  2A3F X;  1IFB A;  3EC5 A;  3GAQ A;  1STR B;  2IFB A;  3BX7 A;  3JSQ A;  3PED A;  2X8S A;  1SRG A;  3D97 A;  1ZRY A;  3D9W A;  1EXS A;  2RTH B;  4OMW A;  2CAM A;  3FA7 A;  1B56 A;  3EYC A;  3B2L A;  4JHQ A;  3U0D A;  5AQ6 A;  2BS5 A;  4L1N A;  1GX8 A;  4OMX A;  4CPI A;  4RUU A;  1LIC A;  2C1Q A;  1LCZ A;  2X4M A;  4CV7 A;  3OBL A;  1IW2 A;  5HTD A;  1SRE A;  5IO7 A;  2LBA A;  3VU1 A;  1SA8 A;  2JU8 A;  3FA9 A;  2FLJ A;  4A1Y A;  3WBG A;  1E06 A;  5CYB A;  3PPT A;  5HA1 A;  1LDO A;  4FGI B;  3CBC A;  1HMS A;  2CBR A;  3T6L A;  2Z4I A;  3FEP A;  4KT5 A;  2QOS C;  1IKJ A;  3S5V A;  3EM0 A;  1BRP A;  2LKK A;  4O4U A;  3RZY A;  4DNE A;  3Q34 A;  3VHH A;  1TOW A;  1FE3 A;  4YGG A;  2RTC B;  3DTQ A;  4IAW A;  4QAE A;  3RKG A;  4GUZ A;  1BEB A;  4O9S A;  2CBS A;  3ZI8 A;  3JS1 A;  4Z27 A;  2XKL A;  3HOL A;  1OPA A;  1HXL A;  2GTL M;  1JMZ A;  3KQ0 A;  1ML7 A;  2OVD A;  4Y5D A;  1N43 A;  2WPU A;  3FA8 A;  4HFO A;  4BOE A;  5K06 A;  2VFC A;  3KFF A;  3AUM O;  1SWL A;  1SWG A;  5F58 A;  5FAZ A;  1BLR A;  3HPE A;  1DFV A;  2AKQ A;  1Y0G A;  2OL6 O;  3D96 A;  1I4U A;  3BRN A;  1RAV A;  4YDB A;  1LPJ A;  4ORS A;  2Q39 A;  5K68 A;  1U18 A;  2VDF A;  1X8Q A;  2ZSC A;  1E2T A;  1LCW A;  2RTB B;  4KC8 A;  4OS8 A;  1KT3 A;  4U8U M;  4ZHH A;  1LNM A;  1FDQ A;  5D8J A;  3AKN A;  4WFV A;  1DV9 A;  3P6H A;  2OFM X;  1DF8 A;  4YBU A;  1SLD B;  3B2H A;  1N7Y A;  2DJF A;  4LKT A;  4QZT A;  3HWG A;  1QY2 A;  4Y0P A;  5HCE C;  1UYO X;  2NP1 A;  4O3Y A;  3VG5 A;  3HK1 A;  1D2U A;  1U17 A;  2JW1 A;  4NLI A;  5B3M O;  4O3W A;  1VWG B;  3HWF A;  3I0A A;  3EW2 A;  3VHI A;  4I9S A;  4ZFX A;  2QOM A;  4IB7 A;  4I3B A;  1I78 A;  1X89 A;  2L9C A;  2L5P A;  1NC9 A;  1MVG A;  3SZI A;  2MWH A;  3SLT A;  4Z2O A;  4Z2V A;  3D4R A;  3SOT A;  2AT0 X;  3ZW0 A;  1SWS A;  2WQ9 A;  5HZ8 A;  4BX6 B;  4ZHF A;  4NV7 A;  1A3Y A;  4ORW A;  1HQQ A;  2WR6 A;  3NQK A;  3LTW A;  4LZU A;  3O19 A;  3WJC A;  1Y52 X;  4XMC A;  1AB0 A;  1K3B A;  4GDZ A;  1VWN B;  2QCB A;  2WUT A;  4IBA A;  4KH8 A;  4RUN A;  1QFV A;  2FT9 A;  1FJ1 E;  1QWD A;  3KZA A;  2FGS A;  4GGR A;  5CSE A;  1SLF B;  2KD2 A;  1YWB A;  2W2F A;  1KT6 A;  5KHP A;  4C5P A;  4AYH A;  1GKA A;  1JZU A;  3UEW A;  4NNT A;  2AMM X;  1CRB A;  2ZAG A;  1VWM B;  1SWJ A;  2MM3 A;  2X45 A;  4IRW A;  4TKJ A;  3RWX A;  3WZQ A;  1EI5 A;  2WEX A;  4OEL A;  1CBQ A;  1HMT A;  2A2G A;  3CKG A;  1Y55 X;  1DZK A;  2NND A;  1GT3 A;  4NV8 A;  2GC9 A;  2I5Z O;  3ZW1 A;  4XME A;  2FRS A;  1BWY A;  4WFU A;  4ZJ0 A;  3PEC A;  1D3S A;  4CPE A;  2RTM A;  1GT5 A;  5EEE A;  1SWO A;  3FR4 A;  1VPR A;  4YFP A;  3U9P C;  4I95 A;  1LKE A;  4NYQ A;  5B27 A;  3NPO A;  3MX7 A;  3RE6 A;  1Y9L A;  3ZW0 B;  3TZS A;  5D47 A;  2RA6 A;  4TKB A;  4D6B A;  3FEN A;  1STP A;  3EMM A;  3WXQ A;  4FBR A;  4NYR A;  4GNW A;  2FS6 A;  2VFB A;  2WSJ A;  2ANS A;  4BCS A;  3FEL A;  4R0B A;  1ALB A;  3FYF A;  4NP1 A;  2ACP X;  3WJB A;  3NP1 A;  4Y0R A;  5LJK A;  1I05 A;  5LKE A;  4GE1 A;  4BVM A;  1T68 X;  3BSZ E;  5FQ6 E;  1EAL A;  1W5R A;  1S2P A;  5B5F A;  1QG5 A;  2IZA A;  1JIW I;  4IB8 A;  4IMO A;  1VWB B;  5BVS A;  1EII A;  5H9N A;  1ZNK A;  1R0U A;  4U3Q A;  5F6B A;  3FW4 A;  5H9A A;  3STN A;  4MVK A;  4Y0Q A;  2JU3 A;  1GKA B;  3BLG A;  2AT3 X;  2KT4 B;  4BQU A;  4EDE A;  3APX A;  4CDE A;  1ZNE A;  1PM1 X;  1KZW A;  3RDQ A;  1G7N A;  1GT1 A;  4A1H A;  4CPF A;  1JYJ A;  3NQ3 A;  4NNS A;  4ZHD A;  4YFR A;  4YKO A;  5IXG A;  2OVA A;  2OYB O;  1RBP A;  1SWP A;  3F6Z B;  3CR6 A;  1O1U A;  5FFH A;  1ICN A;  1GGL A;  4O4X A;  3TGC A;  1X8U A;  4A60 A;  3N91 A;  4JGL A;  1L6M A;  1TVQ A;  1I06 A;  2BS6 A;  1NQN A;  3G7X A;  4U9C A;  4Y0S A;  3UEX A;  1PEE A;  5IO5 A;  3I17 A;  2IZJ A;  1DF3 A;  5H9K A;  3OE3 A;  1KZX A;  2P8G A;  3OD9 A;  1B8E A;  4IB6 A;  3VG4 A;  5C0N A;  1SWA A;  4ZGF A;  1KL3 A;  1MK5 A;  1MX7 A;  5EED A;  3VG2 A;  3PDF A;  1PTS A;  1LID A;  3FEK A;  4AZN A;  4QGW A;  1VYF A;  1SY1 A;  2RTN B;  1N4J A;  4AZO A;  3RDU A;  1ERX A;  4IAX A;  1VYO A;  4JO6 A;  2FR2 A;  4TQ2 A;  4YBP A;  2YMS A;  5BVT A;  2HMB A;  5B10 O;  4Y59 A;  3IFB A;  1Z24 A;  2RTG B;  2YG2 A;  4ZHC A;  2BT9 A;  4I3C A;  3KFI A;  4IMN A;  4QYN A;  1HBP A;  3P6G A;  2LFO A;  1SWR A;  1X8N A;  2FS7 A;  4AW8 A;  2X32 A;  4QQ1 A;  5F2B A;  3PH6 A;  2Q9S A;  1E02 A;  2JN3 A;  4GD9 A;  4WHI A;  5B29 A;  1P6P A;  1URE A;  2HKD A;  3WOV A;  2OY8 A;  3RDX A;  3WZP A;  1IIU A;  1SWQ A;  1JYD A;  1YIV A;  5D48 A;  4EFG A;  4ORY A;  5FEN A;  3FLL A;  1N9Y A;  3NQ9 A;  2FR3 A;  4O4S A;  2F01 A;  4GET A;  1Y9T A;  1KL4 A;  2G8C O;  1SWH A;  1ZNL A;  2RTP B;  3PQU A;  4M6S A;  2PI3 O;  4YVB A;  5B2A O;  3FMZ A;  3SZJ A;  3TGA A;  4NW4 A;  5B5G A;  2RQ0 A;  1ADL A;  4D6A A;  2AT5 X;  4GJV A;  4GZV A;  1BM5 A;  2A13 A;  2AH7 X;  4EQA C;  5HWZ A;  2IZC B;  1LIF A;  1MM9 A;  2Q4N A;  2OY5 O;  3AKM A;  3BS2 A;  1I04 A;  2E4J A;  4XMG A;  1KL5 A;  1OBU A;  1SWB A;  2MO5 A;  2OVE A;  2RCQ A;  3C77 X;  4TLJ A;  3FDC A;  2OVS A;  2FKG A;  4JNJ A;  4ES7 A;  2AT6 X;  4ALB A;  1OBQ A;  4ZCB A;  4AZQ A;  1VWR B;  3MM0 A;  3RDS A;  4FBO A;  1SWD A;  1DZP A;  2K62 A;  1MX8 A;  3MBT A;  1KT4 A;  1N0S A;  3H3I A;  1X8O A;  2ACO A;  4BGF A;  4OEM A;  4HPD A;  3WJF A;  3S26 A;  1SXY A;  4TKH A;  4HPB A;  3B2K A;  4BJ8 A;  5IRA A;  3T6F A;  1W6F A;  3FIQ A;  3EBW A;  2N93 A;  5F7G A;  2HZQ A;  3GE2 A;  3CMP A;  1JBH A;  2OL7 A;  1O1V A;  1LCV A;  5BYP A;  1WBI A;  2WWP A;  4ON1 A;  1NGL A;  1YWC A;  1RXH A;  4YFQ A;  4ARH A;  3P24 A;  5AJC A;  3VG3 A;  1SXX A;  3BX8 A;  2RTR B;  4NLJ A;  1DZM A;  1YWA A;  2WQA E;  4OKA A;  5H8T A;  3UEU A;  1O8V A;  5IO6 A;  4N7C A;  2QO5 A;  3FW5 A;  4DQ4 A;  2Y32 A;  3T1D A;  3IA8 A;  2MF6 A;  3TGB A;  4QNI A;  5L8N A;  1IFC A;  1A2D A;  1I9H A;  2LBV A;  2GTF X;  3APW A;  1SWU A;  4BX5 A;  2X34 A;  4O4O A;  5HZQ A;  2RTK A;  4QZU A;  2BHV A;  3P6F A;  4YDA A;  4YH0 A;  3T2X A;  3WJD A;  1S44 A;  3CKF A;  4AZM A;  1VWD B;  1VYG A;  1RSU B;  1PBY A;  2KTD A;  4GNY A;  1AVE A;  1STS B;  2IZE B;  4ODD A;  4ORU A;  3STM X;  1HY2 A;  1LFO A;  4KC7 A;  3SZH A;  3ZQ3 A;  5HZ6 A;  1VWO B;  5LKF A;  1QY1 A;  4CPH A;  1RXK A;  3STK A;  2OFB A;  4YKM A;  1IKE A;  4GRJ A;  1GXA A;  1A18 A;  2A5C A;  3KFG A;  1TW4 A;  3HTY A;  1A57 A;  4GGT A;  2RTA A;  5EPQ A;  3APU A;  2IZI A;  3RBY A;  3P6E A;  5HAE A;  1QAB E;  2O62 A;  1HMR A;  3BU9 A;  4GH7 A;  1OEJ A;  4Z6J A;  4ZH6 A;  2JGS A;  1SRH A;  5K67 A;  5L3Y A;  3NX1 A;  2DJG A;  1GX3 A;  3FA6 A;  5LJE A;  1BSQ A;  1HBQ A;  3QKG A;  1NP1 A;  4FBV A;  4GKC A;  4IB9 A;  1BBP A;  1GM6 A;  1GT4 A;  1LIB A;  5AEO A;  3K3L A;  1EPB A;  4DQ3 A;  3QQ2 A;  1SRI A;  4ZHG A;  2X8F A;  4GDA A;  1BRQ A;  1FEM A;  3PP6 A;  3V8U A;  5HA0 A;  3WZN A;  2G5L A;  1DZJ A;  1T8V A;  2A0A A;  2C4I A;  2DM5 A;  3D95 A;  1G85 A;  3EBK A;  4BX5 B;  3ZZV A;  5HZ5 A;  2A2U A; 
#chains in the Genus database with same CATH homology
 1KFF A;  2RTN B;  1N4J A;  3RDU A;  2OF8 A;  4JO6 A;  1DF8 A;  1SRJ A;  1VYO A;  1SLD B;  1N7Y A;  4Z2P A;  4Y59 A;  2RTG B;  4CPH B;  2RTJ A;  1VWG B;  1SWR A;  1LEL A;  1RST B;  2UYW A;  3EW2 A;  3VHI A;  5F2B A;  2Y3F A;  2FHN X;  4U46 A;  5CHK A;  4GD9 A;  1MOY A;  1NBX A;  1NC9 A;  2A5B A;  3SZI A;  3T2W A;  2RTD B;  3VHM A;  1VWL B;  3RDX A;  3WYQ A;  1SWQ A;  1VWE B;  3WYP A;  3WZP A;  4BX5 B;  4BX7 B;  1SWK A;  4Z2V A;  1VWK B;  1N9Y A;  3RY1 A;  1SWS A;  4BX6 B;  1VWF B;  2F01 A;  1MEP A;  2OFA A;  4I60 A;  1KL4 A;  1VWA B;  1SWH A;  2RTP B;  4YVB A;  1VWH B;  2IZK A;  4EKV A;  1SWC A;  1HQQ A;  3SZJ A;  1AVD A;  5B5G A;  4GJV A;  3RE5 A;  1Y52 X;  2IZD B;  2IZH B;  2RTI B;  1VWN B;  1VWP B;  2QCB A;  2IZC B;  1LUQ A;  1MM9 A;  4GGR A;  3PK2 A;  1KL5 A;  1SWB A;  5CSE A;  3FDC A;  1SLF B;  4JNJ A;  3RY2 A;  4BBO A;  1VWR B;  3MM0 A;  3RDS A;  1SWD A;  1SWE A;  2AVI A;  2RTO B;  2RTL A;  1VWJ B;  1VWM B;  1SWN A;  1RXJ A;  1SWJ A;  4IRW A;  5IRW A;  1VWQ B;  3WZQ A;  3MG5 A;  4BJ8 A;  5IRA A;  3T6F A;  1NDJ A;  1Y55 X;  1SRF A;  4Z2O A;  3X00 A;  1VWI B;  3RDO A;  4CPE A;  2RTM A;  1STR B;  1SWO A;  1Y53 X;  1LCV A;  1WBI A;  1RXH A;  1SRG A;  2RTE B;  3EW1 A;  1NQM A;  2RTH B;  3RE6 A;  2CAM A;  4JHQ A;  1STP A;  2RTR B;  3WZO A;  2GH7 A;  4OKA A;  3RDM A;  4CPI A;  2A8G A;  4BCS A;  1SWF A;  1VWC B;  2C1Q A;  1LCZ A;  2IZG B;  2Y32 A;  1SRE A;  5IRU A;  1HXZ A;  2MF6 A;  4BX6 A;  1I9H A;  5B5F A;  1SWU A;  4BX5 A;  2IZA A;  1VWB B;  2RTK A;  3T2X A;  1LDO A;  3T6L A;  1VWD B;  1RSU B;  1IJ8 A;  1AVE A;  1STS B;  2IZE B;  3SZH A;  1HY2 A;  2OF9 A;  4DNE A;  1VWO B;  3VHH A;  4CPH A;  1RXK A;  2RTC B;  2IZF B;  2RTQ B;  2OFB A;  4GGZ A;  3RDQ A;  2A5C A;  3VGW A;  4CPF A;  2FHL A;  4GGT A;  2RTA A;  4Z27 A;  2IZI A;  1HXL A;  2IZL B;  4GJS A;  1SWP A;  4BX7 A;  2BC3 A;  4Y5D A;  1N43 A;  2WPU A;  4Z6J A;  2JGS A;  5JD2 A;  1LDQ A;  1SRH A;  5K67 A;  5L3Y A;  1NQN A;  1SWL A;  1SWG A;  2RTF B;  2UZ2 A;  2IZJ A;  1SLG B;  1SLE B;  1RAV A;  1SRI A;  2C1S A;  2Y3E A;  1SWT A;  4GDA A;  5K68 A;  1SWA A;  1KL3 A;  1MK5 A;  1N9M A;  2ZSC A;  1LCW A;  2G5L A;  1PTS A;  2C4I A;  2RTB B;  3WZN A;  4Z28 A;  2IZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...