4OELA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
367
structure length
281
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVLHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 281
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oelA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oelA02
2BDZA 4QRVA 1AU0A 3N3GA 2PREA 1KFXL 1PPDA 3MHHA 4I04A 1CQDA 4OELA 2E01A 3H8BA 4BSQA 2YJ9A 3F5VA 2H7JA 3C9EA 3CH3X 2YJBA 2JQGR 2AIMA 2AU1A 4QRXA 2OZ2A 3P5WA 3BCNA 1YK8A 2F1GA 3OVZA 2AYNA 3K24A 1F29A 4YV8A 3P5VA 4PP2E 3MORA 1MHWA 2AUXA 1EWLA 5F02A 2GFOA 2E03A 4N79A 4CDDB 5A24A 7PCKA 2HHNA 3H89A 3AI8A 3WXEA 2DZZA 4K7CA 2DJFA 1EWOA 1FH0A 2DCDA 3BOWA 4CDCA 3V6CA 4PI3A 2YJCA 3BWKA 4CDFA 1XKGA 1AYUA 2HXZA 2AUZA 2FT2A 1GLOA 3LFYA 1S4VA 2PNSA 3WXFA 3QSDA 2GHUA 3N3KA 4PADA 1MEMA 2DC7A 2AS8A 1AECA 2R6NA 4YYWA 2DC9A 2NQIA 3N4CA 3LXSA 3H8CA 1MDWA 3P5UA 1EF7A 4CZWA 4DMXA 3GCBA 9PAPA 2FYEA 4YYSA 1TLOA 3HHAA 3HWNA 2CB5A 2DC8A 1O0EA 2G8EA 3ERVA 2XU5A 2FO5A 2NQDB 1U9QX 2G7YA 2R9MA 2E02A 3E1ZB 4BPVA 2R9OA 2P86A 3IUTA 2DJGA 4FJCA 2ATOA 2JQFR 4CDEA 2VHSA 2NQGA 2PBHA 3H6SA 4AXMA 4BQVA 2YJ8A 4W4UA 1YK7A 1EWMA 1GMYA 4YYRA 3BC3A 1CSBB 1KHPA 1U9VA 1SNKA 4Q8GA 1F2CA 2DC6A 3QT4A 1MIRA 3KKUA 1QOLA 3USVA 1ME4A 1PADA 2WBFX 3IMAA 3P5XA 5CHVA 1CV8A 2DJFB 1IWDA 5FPWA 4CDCB 3RVVA 2R9FA 2FUDA 3I3TA 3KWBX 4CDFB 3D6SA 3QJ3A 4XUIA 3OVXA 3NHEA 1ITOA 1MEGA 2DZYA 3CBKA 3PW3A 2BDLA 4Q8HA 3KFQA 4HWYA 1K3BB 1QMYA 1CJLA 1PPPA 1TU6A 3WXGA 1GECE 4YVAA 4MZOA 3CH2X 4P6GA 1TL9A 4AXLA 4OEMA 2VHFA 2Y5BA 4I05A 2OP3A 1NL6A 1U9WA 3HHIA 5CVMA 2CIOA 1POPA 1EWPA 3IOQA 1PIPA 1ICFA 4QRGA 1KHQA 2Y6EA 3KX1A 1VJVA 4FK5A 2P7UA 5J94A 1CS8A 1CPJA 8PCHA 2FTDA 4W5BA 5EF4A 2DJGB 4ZUXU 1SP4B 4BS6A 1BGOA 2HH5A 1MS6A 5CVNB 4YYUA 2IPPB 3KW9A 4CDEB 2IBIA 1U5IA 2R9NA 4X6JA 1M6DA 1JQPA 3PBHA 2XU4A 4W5CA 2XU1A 1VSNA 5EGWA 4KLBA 5CHTA 3ZUAA 1AU3A 2YJ2A 1YALA 1YVBA 2DCCA 4QH6A 2C0YA 2NQAA 3K8UA 3H7DA 4X6HA 6PADA 3DF0A 1ZCMA 1AU2A 1ME3A 1PBHA 2FRQA 4MZSA 4I07A 2G6DA 4G54A 4PP1A 2P0RA 3IV2A 1NPZA 5K16A 5JH3A 3HD3A 1PCIA 4N8WA 2DCBA 2O6XA 4XR7A 1THEA 3V6EA 1DF0A 3KSEA 2B1MA 1QDQA 1NLJA 3IHPA 2ACTA 4FIPA 3BPMA 3MHSA 1Q6KA 3K9MA 4BS5A 3O0UA 1NQCA 1QXPA 3OISA 3S3RA 4DMYA 1PXVA 1BQIA 1AIMA 3M99A 4RY2A 1HUCB 1Y4HA 1X9YA 2DCAA 1AYWA 3OF8A 2E00A 1CTEA 2XU3A 1AYVA 3CBJA 4MSXA 4QBBA 2B1NA 1BP4A 1KFUL 1Y08A 5JA7A 4N4ZA 3BPFA 4CDDA 2ARYA 1PE6A 2G8JA 3MTNA 1CB5A 1F2AA 2OULA 2R9CA 2AVWA 3RVWA 2F7DA 1CVZA 1PPNA 1PPOA 1A6RA 3RVXA 3IEJA 2FQ9A 1K3BA 3O1GA 2PADA 3PDFA 3KWZA 1DEUA 4X6IA 1ZIVA 1U9XA 2FRAA 4YYVA 5PADA 4P6EA 1STFE 1KXRA 3I06A 1NB5A 3PNRA 3F75A 3OF9A 1AU4A 1GCBA 1F2BA 3B79A 3TNXA 2AYOA 3U8EA 1BY8A 5CVOB 3S3QA 4WA6A 1ATKA 4YYQA 1YT7A 1NB3A 2HD5A
chains in the Genus database with same CATH superfamily
2RTJA 4QRVA 5LJBA 3C77X 1NQNA 4GJVA 1LCVA 2XKLA 3T2XA 4IB8A 1HQPA 4XMEA 4EQAC 3TRKA 4GUZA 1VWLB 3MHHA 1NQMA 1EQDA 1E2TA 1CQDA 2HWKA 1QY2A 4AZMA 5AEOA 1SWFA 2YJ9A 2OFBA 4A1YA 5KHPA 2N93A 5H9KA 2MF6A 2MWHA 2Y3EA 1IKJA 1EW3A 1VYOA 1YK8A 2F1GA 3OVZA 1DKIA 1SRIA 3IA8A 1ZNDA 3OQCA 2OYBO 3MORA 1MHWA 2AUXA 4ZTBA 1GXAA 2E03A 5A24A 7PCKA 2CM9A 3H89A 2M4LA 2PI3O 2DZZA 4D8EA 3D9WA 2MJIA 4IP3A 4U8UN 3B2JA 4ID2A 3BOWA 4CDCA 3V6CA 1X8OA 4GDAA 1EI5A 1SY1A 4CDFA 1AYUA 2HXZA 3FMZA 1PTSA 3LV4A 3ZI8A 4ZHGA 1MUPA 3RNVA 1S4VA 1SWNA 2G78A 4IB6A 3WXFA 3EW1A 4Y0SA 2A5BA 3N3KA 2ALLX 2GTFX 1MM9A 4ZHHA 3APXA 3RDOA 5IO6A 2JRIA 2BC3A 5KO3A 2RTBB 1VWDB 3LXSA 4PJ2A 2K23A 4WFVA 3P5UA 1DC9A 4QYPA 3UAQA 3T6FA 4ZR2A 5LKEA 4I9RA 9PAPA 2FYEA 4YYSA 2JGSA 5F6ZA 2X45A 1I4UA 4MVLA 4A5UA 4FBOA 2DJGA 4MVKA 1E5PA 1DZJA 3VE2A 1GKAB 2ATOA 1SWKA 3T1DA 1VWBB 2VHSA 1SWUA 3N91A 4QZTA 4AXMA 4BQVA 4W4UA 2QO6A 3BC3A 3B21A 1JJUA 1MIRA 3RZYA 2IZGB 3USVA 5EDBA 2FS6A 5IXGA 3FENA 2P8GA 1T0VA 4IB9A 1G85A 1GX9A 2L5PA 4QQ1A 1XCAA 3P5XA 2GTLN 3RVVA 4D6AA 1STRB 3I3TA 3NQKA 2BSZA 5D48A 3QJ3A 4A8ZA 5H9LA 4IBAA 3APWA 5FAZA 4Z6JA 4LKPA 1ITOA 4BOQA 1I04A 3CBKA 2MO5A 4Y5DA 3KFQA 3PRPA 4HWYA 1K3BB 1QMYA 3VG3A 5CSEA 4NLJA 3TF6A 3CH2X 4P6GA 4AXLA 1UYNX 3LHNA 1A57A 4TKJA 2IZFB 4RUUA 2UZJA 3O22A 3HWEA 4AYHA 3HHIA 3APVA 1SWPA 1OSPO 1NC9A 4ZCBA 3IOQA 2HKDA 4BOPA 3WJBA 1VJVA 4ZFXA 2QO4A 3VHHA 4KH8A 2WEXA 1CS8A 5LJDA 2Z4IA 4DQ4A 1CPJA 5EDCA 2FTDA 1D3SA 2C1SA 3ZW1A 1CBIA 3NBXX 4ML7B 1BGOA 2HH5A 1MS6A 1NGLA 4TKHA 3ZW2A 1TOUA 3KW9A 5AJCA 2J7QA 1U5IA 1M6DA 4YBUA 2RTFB 2AMMX 3NQ3A 2EU7X 2ZSCA 1VWAB 2XU1A 1VSNA 1E06A 4KLBA 3FR5A 1IFBA 4QYNA 5CHKA 4PSQA 5D47A 2OFAA 5HZ5A 3MJ5A 5F1EA 1KT3A 3GAQA 5FQ8E 3H7DA 3JSQA 1VWRB 1SWBA 2FGSA 5BVQA 1IIUA 1R0UA 2FR3A 1OPAA 3RKGA 1YWCA 4ZHDA 4G54A 4PP1A 5L8NA 1EIOA 3NX1A 1Y55X 1MX8A 1B8EA 3NADA 4IAWA 1TOWA 4WBKA 1FDQA 2X32A 4CPHA 4RNAA 3O2YA 2XSTA 1G74A 4KIIA 2IZIA 3PH6A 1THEA 3PHXA 3KSEA 3IHPA 2BU3A 4FIPA 1JJXA 4XMHA 4BVMA 1ZNKA 1HY2A 1SWAA 5HZ6A 1NP4A 1S2PA 2FHLA 3O0UA 3VGWA 1QXPA 4Y0RA 2RTMA 4ZJ0A 5JR8A 2AT3X 2GC9A 3KFHA 2IFBA 1ACDA 4U3QA 1AIMA 4RY2A 1HUCB 4BX5B 4BJ8A 1X9YA 3CQRA 4L3RA 1AYWA 2E00A 4Z2PA 3CBJA 3WZNA 4MSXA 4MVIA 4Z28A 3JQOA 5IRUA 4ORUA 4MEEA 5JA7A 4N4ZA 4CDDA 1RBPA 2HZRA 1OBUA 2VFCA 4ODDA 2OULA 4BOEA 1YUPA 3EYCA 2ACOA 2F7DA 1CVZA 5LJCA 4YKMA 3PQSA 3W30A 2RTNB 1AELA 2PADA 2FS7A 4AZNA 1DEUA 1UREA 2Q9SA 4YBPA 1UKFA 4QAEA 1SWRA 3BU1A 4M0WA 4O49A 1AVGI 1LUQA 5HTEA 4WURA 4OKAA 1KXRA 3I06A 1F2BA 1QABE 1MOYA 2WWPA 3PRMA 3HWDA 1AQBA 1BY8A 1YP6A 2UZ2A 1Y53X 1O8VA 1LKEA 2OL7A 1VYFA 2JTCA 2BDZA 4YCHA 5E6JA 1KFXL 4BX6B 4MI7A 3D96A 3PEDA 5HTDA 1EUOA 2G79A 4I04A 1HQQA 4OELA 1BSYA 2QMIA 2OY8A 3F6ZB 3H8BA 1E02A 4BSQA 4NV8A 5HCDC 2MHDA 4DQ3A 4RKXA 3C9EA 3CH3X 2YJBA 4ZH9A 2AU1A 5HA0A 3FYFA 3CWKA 3BCNA 1MEPA 1LF7A 3BX8A 4O3YA 1X8PA 1BWYA 1KT5A 5EZSA 5FQ6E 3JS1A 4RF1A 3K24A 4YV8A 3P5VA 4PP2E 4O4SA 5BVSA 1FE3A 2GFOA 4YFRA 2RTDB 4N79A 1W4TA 1GM6A 1VWOB 2DJFA 1N43A 1FH0A 3P24A 3KFIA 2QO5A 4NNTA 1OBQA 2YJCA 3C0RA 1BJ7A 1XKGA 2FKJA 3VG2A 1KT6A 1SRFA 1STSB 1DF8A 3LFYA 2RTRB 3QSDA 1VWIB 1MEMA 2LBAA 1LFOA 3U9PC 3BS2A 1DZKA 4YMYA 1SMPI 3AKNA 1X71A 2RCQA 1AECA 3CKFA 2KTDA 4YGZA 2R6NA 2Y32A 4YFQA 1OPBA 2NQIA 2WQ9A 1CBQA 1SWCA 2NNDA 3NP1A 1RSTB 1LCWA 3N4CA 4U9CA 1EF7A 2E4JA 4Z2OA 3GCBA 4Y0QA 1OEJA 2FKGA 2CB5A 4U46A 2JOZA 1LNMA 4XMFA 4I95A 3ERVA 4HPCA 1TVQA 2XU5A 2FO5A 1U9QX 1A3YA 5HAEA 4LZUA 2RTIB 2P86A 2RTCB 2X8FA 4CDEA 3ZNHA 2PBHA 1OEEA 2A13A 4CPEA 1SWGA 2AT6X 5B5FA 4OMWA 1F2CA 1QOLA 1ME4A 5FQ7E 2JW1A 2PY1A 1SXXA 4I3CA 2LB6A 2W2AA 2WBFX 1GT4A 1CV8A 4ZHFA 1EXSA 1N9YA 4CDCB 3FA7A 5K67A 4CDFB 3WJDA 3MM0A 1JMZA 4NP1A 3OVXA 3D97A 2DZYA 2Y3FA 3P02A 1VWHB 3PW3A 1DF3A 1TXLA 4OS8A 1AVDA 5HWZA 2GH7A 3PH5A 3FDCA 1PPPA 4ZHCA 3WXGA 1GECE 4MZOA 5IRWA 3DSZA 1TL9A 3D95A 3VHMA 2Y5BA 4I05A 3SZJA 2FTBA 5H9NA 1NL6A 3ELXA 1VWFB 1LICA 3ZQ3A 1EPBA 5CVMA 2CIOA 4EKVA 3PHUA 1SLGB 3WJCA 1EALA 1YZBA 1EPAA 4QRGA 3ZW0A 1GGLA 4I60A 1SRHA 2POAA 1VWJB 1IKEA 1LDQA 4JGLA 1UZ2X 2AKQA 5KIDA 8PCHA 3WJEA 2RD7C 2DJGB 2L67A 4BS6A 4M7MA 3PHWA 3RDQA 2R9NA 3EMMA 3KFGA 2OY7A 3PBHA 2AL0X 2XU4A 2AT0X 3ZUAA 1JYJA 4N7CA 3TGAA 4GNYA 4YGGA 2DCCA 3HWFA 4BX7A 3SZHA 1BSOA 4EFGA 6PADA 4Y0PA 4QZUA 2CM4A 2FRQA 4I07A 2G6DA 1PEEA 2RTGB 1LDOA 1Y52X 4XMCA 4CPIA 3V8UA 3HWGA 2BTWA 1GT3A 4QGXA 4O4OA 5K16A 1VWQB 3HD3A 1JMXA 2DCBA 5HBSA 4XR7A 1JJJA 2W2BA 2X8SA 3AKMA 1LIDA 2RTAA 3U03A 3PQUA 1NLJA 4OS3A 1SWHA 2ACTA 4BOSA 4ALBA 1PBOA 3EBKA 2F01A 1NQCA 5B5GA 3FIQA 4IB7A 2FWVA 1JV4A 3S26A 4Z2VA 1BEBA 1SWLA 2DCAA 1CTEA 1AYVA 2BS5A 2FLJA 3WYPA 4GGRA 3ZW1B 1Y08A 2A0AA 5HA1A 2AH7X 1PE6A 1SXYA 2G8JA 1CB5A 3B2HA 3WJGA 1KL3A 4YH0A 4HPAA 1BM5A 2G7BA 2HYSA 1SLFB 3BDRA 1SXWA 2QCBA 1GX8A 1K3BA 4GGTA 5B29A 3O1GA 4BOUA 2AGAA 2AF5A 3FA9A 2AT5X 1VPRA 1ZIVA 5BYPA 1LIFA 3RWXA 4ALOA 3ZUOA 1VWEB 4AZRA 1TW4A 1X8UA 1NB5A 3RY1A 1PMPA 2WQAE 4GK9A 3F8AA 2HZQA 3B79A 3TNXA 1DZMA 1Z24A 4MVEA 2DOSA 1I05A 2OVSA 4LZVA 2QOSC 4M6SA 4QGWA 2OF9A 2X34A 3S3QA 3L4RA 3BX7A 4CPHB 1YT7A 1NB3A 2CBRA 4NV7A 5AJBA 1AU0A 3KQ0A 3N3GA 2OY5O 4HFOA 3AEHA 3HOEA 3APUA 1PPDA 4GH7A 1KFFA 1HBQA 1EIIA 2CBSA 2E01A 3AUMO 3OJYC 4LQZA 4YFPA 2H7JA 2ASNX 2JQGR 2AIMA 3P6HA 4NLIA 3BSZE 4QNIA 1T8VA 3P5WA 4O3WA 4IUMA 2VDFA 1WBIA 5EEEA 2WSJA 1BRQA 1QWDA 4RUNA 3CMPA 3CBSA 4R0BA 1KT4A 2AYNA 1NP1A 2IZJA 2RTEB 3RDMA 3EM0A 1U18A 4QRLA 1ERBA 5D8JA 4CDDB 4GNWA 3B2IA 4OS0A 1EWOA 2DCDA 1HMSA 1GX3A 2MM3A 3BWKA 3VG7A 2AUZA 4I3DA 2OL6O 4GKCA 3H3IA 2LKKA 3FR2A 3NR3A 1GLOA 1RXHA 4IRWA 1PVJA 4PT5A 2PNSA 2GHUA 4NYQA 4PADA 1HMTA 1SREA 2AS8A 4I3BA 1O1UA 1MX7A 4YDAA 1B4MA 1Y9TA 1YWDA 1RAVA 2R73A 4YYWA 1JYDA 4IMOA 2DC9A 2FHNX 2Z84A 3BB7A 3I17A 3H8CA 3IFUA 3STNA 4DMXA 1X8NA 3Q6LA 1X8QA 2RN4A 1GT5A 4TNNA 1O0EA 4YDBA 4ORRA 2NQDB 1ZNLA 2G7YA 2R9MA 2R9OA 4TJZA 5LJHA 3IUTA 1AB0A 2ZAGA 3MX7A 3EBWA 5F58A 2OY1O 3RBYA 2NNEA 3SLJA 2NQGA 3H6SA 1QY1A 1JIWI 4HXDB 3P6FA 2YJ8A 3T6LA 3VU1A 1YK7A 3P6DA 1GMYA 5HZ8A 2IZKA 1KHPA 1U9VA 3IFBA 5D45A 5EZ2A 2L9CA 3KKUA 2BLGA 3FEPA 1QQSA 3WYQA 2L68A 1SWTA 1KZXA 4HWMA 3TZSA 1SWOA 3K3LA 1WUBA 3FELA 3UEXA 4YKOA 4TQ2A 2DJFB 1IWDA 1SLDB 3O65A 5LJKA 5FPWA 1DFVA 4OVZA 1SY2A 2R9FA 3SLTA 2FUDA 2BHVA 3D6SA 1AVEA 4I9SA 4MIRA 4XUIA 4AZOA 5B11O 3KZAA 1LIEA 4U8UM 3WBGA 3NHEA 1U17A 3FA6A 3WXQA 1KT7A 2QM9A 4EXZA 1LCZA 3CKGA 3RE5A 3PT2A 4Q8HA 5L8IA 1TU6A 4ES7A 4YVAA 1KGLA 2Q2MA 2CZTA 4JO6A 5B2AO 4YVBA 3PPTA 3E9SA 1IFCA 2RA6A 4OEMA 2OP3A 5JD2A 1U9WA 3S5XA 3VPJE 2ANSA 4Z27A 1POPA 2A5CA 5F2BA 4GJSA 1PIPA 2FR2A 1K24A 2RTHB 3KX1A 2KW1A 3UEWA 3W31A 1RXJA 3NX2A 5J94A 2A2GA 3TMPA 2IZEB 4ZGFA 2ACPX 1YP7A 3BY4A 1N0SA 1SWSA 1SP4B 3TGCA 4YYUA 2LA7A 4O3ZA 4CDEB 3UEVA 2IBIA 4P16A 5AQ6A 4X6JA 4D8IA 5LKFA 1HN2A 1IJ8A 1SY3A 3S5VA 4W5CA 3X00A 1FJ1E 2JU3A 1AU3A 2IZBA 1CRBA 1CBSA 4N7DA 1YVBA 4QH6A 4REZA 1Y0GA 3K8UA 4TLJA 2OL8O 3VG4A 4OW0A 2W2FA 3OE3A 1U0XA 3CR6A 4AW8A 4WHIA 1AU2A 1PBHA 4MZSA 4HPBA 3B2LA 1W6FA 1BLRA 2GTLM 4OMXA 1T68X 1PCIA 4ZGUA 3HOLA 1KL5A 5HZ9A 3B2KA 2O6XA 3WZOA 3V6EA 1I06A 2OFRX 2X46A 2G8CO 3C76X 3RSWA 5EZQA 4D6BA 2B1MA 1BBPA 2GJ5A 4GUAA 1FEMA 3O19A 2ZAIA 3BBAA 1RSUB 4D8BA 4BS5A 3PSEA 4EDEA 1O1VA 1PXVA 4O3XB 2BT9A 2FRSA 4CPFA 1BQIA 3U0DA 2OVAA 5B27A 3ZW0B 1L6MA 3M99A 3SLOA 1Y4HA 3MTVA 2F73A 3ZZVA 1STPA 3MG5A 5CE4A 2XU3A 1NDJA 3RDSA 4QBBA 3HPEA 3MP2A 1BP4A 4ORSA 1KFUL 1QFTA 4YCEA 1VWGB 3FEKA 4AZQA 2ARYA 1G7NA 1HMRA 1F2AA 2AT8X 5FENA 3RVWA 2RCTA 4KCAA 4GD9A 1PPOA 3P6EA 1SWDA 2RTLA 4TKBA 3WZQA 1PBYA 3SZIA 1KL4A 4Y59A 1D2UA 5C0NA 1YIVA 3QKGA 4X6IA 4CSBA 3I0AA 4NYRA 1N7YA 1SRJA 1ICNA 4BX7B 1U9XA 2R74A 2JMBA 1MK5A 2JU8A 5PADA 4YYVA 1NBXA 4GRJA 5EEDA 3FLLA 4P6EA 2A3FX 1JZUA 1STFE 3PNRA 3F75A 3OF9A 1GCBA 1HXZA 2YG2A 4GZVA 3QQ2A 5F6BA 4JHQA 1S44A 2AYOA 1SA8A 2BTWB 2IZDB 2Q39A 4BQUA 4YYQA 2HD5A 1HXLA 4ORXA 2PREA 1KQXA 2A2UA 2HMBA 4B55A 3NPOA 3D4RA 1IW2A 1OEKA 2IZHB 3F5VA 1RLBE 2Q2PA 4I6SA 5LJEA 1ICMA 5HCEC 1FTPA 4QRXA 3RE6A 2OZ2A 1GKAA 5HCCC 4FGIB 1B0OA 2X55A 4K19A 4O4XA 5LJGA 1B56A 1F29A 4GU8A 3ZWEA 1LIBA 1EWLA 2X56A 5F02A 1SXUA 3ZUIA 4XMDA 2HHNA 3PP6A 1YWBA 3AI8A 3WXEA 1HBPA 4U8UO 2LFOA 1QFVA 1SWEA 4K7CA 1Y9LA 2A8GA 2WPUA 2LBVA 4PI3A 5FFHA 2OVDA 3SOTA 2FT2A 2RQ0A 4BGFA 3EC5A 4HPDA 2OVEA 2G5LA 4XZXA 2O62A 3FIDA 4RF0A 5L3YA 2DC7A 2X4MA 4A60A 1G5WA 3WOVA 1XKIA 2QOMA 4WFUA 2Q4NA 3DTQA 3FR4A 3VG6A 1VWKB 1MDWA 4CZWA 1ZRYA 3F9DA 3OD9A 3VG5A 1LELA 1S7DA 4O9SA 1TLOA 3HHAA 2I5ZO 4IAXA 3HWNA 1KXOA 1KOIA 2DC8A 2G8EA 3G7XA 3VHIA 4NNSA 4A1HA 2E02A 1BSQA 5F7GA 3E1ZB 4BPVA 4GGZA 3WZPA 4JNJA 4FJCA 2JQFR 4KC8A 4DCBA 1SLEB 1N4JA 2I5VO 1QY0A 5L8OA 2BS6A 1VWPB 4UU2A 4CV7A 1MDCA 4KC7A 4COTA 1EWMA 4YYRA 1CSBB 3SAOA 1SNKA 4Q8GA 2DC6A 3QT4A 4NW4A 3ELZA 3PECA 1PADA 3HK1A 5K68A 1ZNHA 5H8TA 3OBLA 2GTLO 3IMAA 5CHVA 4DNEA 2DM5A 3KWBX 4FBVA 2VFBA 3RDUA 1KQWA 1VWMB 3NQ9A 3RY2A 5EPQA 1KZWA 1ALBA 1X89A 1MEGA 5B3MO 3GE2A 3E3CA 5BVTA 2NP1A 2BDLA 1JBHA 1PM1X 2C1QA 3CQNA 1CJLA 4BCSA 1OBPA 5DPQA 3P6GA 2K62A 3KVNA 3WJFA 2NNQA 3Q34A 4INNA 3T2WA 2FE8A 2VHFA 3HTYA 2IZLB 5B10O 5KICA 1SY0A 1EWPA 5DG4A 2KT4B 3PK2A 1ICFA 1H91A 2WR6A 1KHQA 2CZUA 1DV9A 2Y6EA 1I78A 4BX5A 2JU7A 5K06A 1FELA 4FK5A 5H9AA 1W5RA 2P7UA 2Z4HA 3STMX 4C5PA 3FA8A 2RTPB 2KD2A 4W5BA 5EF4A 1GT1A 4BOZA 4ZUXU 5CVNB 2IPPB 3BLGA 1ZNEA 2F09A 1JQPA 1I9HA 2AVIA 4R3DA 2J7QC 4ORYA 5EGWA 5CHTA 2OFMX 4GETA 2YJ2A 1YALA 4ZH6A 5CYBA 2C0YA 2NQAA 5JZEA 4AZPA 1MVGA 2OZQA 4ORWA 4X6HA 5HZQA 1N9MA 4UU3A 3WVMA 3DF0A 1ZCMA 4OVZB 1ME3A 1LPJA 3MVFA 3UEUA 4XMGA 2RTOB 2P0RA 4IABA 3IV2A 5IRAA 2IZAA 2KTSA 1NPZA 1YWAA 1FENA 2FT9A 5JH3A 1VYGA 4N8WA 1SRGA 4EEJA 5IO7A 2YMSA 4L1NA 4BX6A 1A2DA 4BBOA 1DF0A 1A18A 4IMNA 4O4UA 1QDQA 3BPMA 4ARHA 3MHSA 3MBTA 1Q6KA 1ZNGA 2IZCB 1QG5A 3CBCA 3RDXA 3K9MA 1CJ5A 3OISA 3S3RA 4DMYA 4ON1A 2WUTA 1SWJA 2WEWA 2HNXA 3FW5A 1DZPA 1E00A 2C4IA 3OF8A 4FBRA 2B1NA 2JN3A 3KFFA 2RTQB 3BPFA 3FW4A 3MTNA 4KT5A 3P6CA 3C78X 4MISA 2R9CA 2AVWA 2RTKA 2CAMA 1PPNA 1A6RA 3RVXA 2X8TA 3LTWA 4LKTA 3IEJA 1ADLA 1UYOX 1SWQA 3TGBA 2FQ9A 4GE1A 3VE1A 1VWCB 2OF8A 3PDFA 3KWZA 1CBRA 3EW2A 1RXKA 2UYWA 4CK4A 4MM3B 3STKA 3BRNA 1ERXA 2FRAA 2R56A 1P6PA 4QGVA 5IO5A 4YGHA 1AU4A 2HLVA 4GDZA 3U8EA 1ML7A 5D4AA 4FQBB 5CVOB 3S60A 4WA6A 1ATKA 1BRPA 1VWNB 3BY0A 3BU9A
chains in the Genus database with same CATH topology
2BDZA 4QRVA 1AU0A 3N3GA 2PREA 1KFXL 1PPDA 4B55A 4GUZA 3MHHA 4I04A 1E2TA 1CQDA 4OELA 2E01A 3H8BA 4BSQA 4NV8A 2YJ9A 3F5VA 2H7JA 3C9EA 3CH3X 2YJBA 2JQGR 2AIMA 2AU1A 4QRXA 2OZ2A 3P5WA 3BCNA 1YK8A 2F1GA 3OVZA 2AYNA 3K24A 1F29A 4YV8A 3P5VA 4PP2E 3MORA 1MHWA 2AUXA 1EWLA 5F02A 2GFOA 2E03A 4N79A 4CDDB 5A24A 7PCKA 2HHNA 1W4TA 3H89A 3AI8A 3WXEA 2DZZA 3D9WA 4K7CA 2DJFA 1EWOA 1FH0A 2DCDA 3BOWA 4CDCA 3V6CA 1GX3A 4PI3A 2YJCA 3BWKA 4CDFA 1XKGA 1AYUA 2HXZA 2AUZA 2FT2A 4BGFA 1GLOA 3LFYA 1S4VA 2PNSA 3WXFA 3QSDA 2GHUA 3N3KA 4PADA 1MEMA 2DC7A 2AS8A 1AECA 2R6NA 4YYWA 2DC9A 2NQIA 3N4CA 3LXSA 3H8CA 1MDWA 3P5UA 1EF7A 4CZWA 4DMXA 3GCBA 9PAPA 2FYEA 4YYSA 1TLOA 3HHAA 3HWNA 2CB5A 2DC8A 1O0EA 2G8EA 3ERVA 2XU5A 2FO5A 2NQDB 1U9QX 2G7YA 2R9MA 2E02A 3E1ZB 4BPVA 2R9OA 2P86A 3IUTA 2DJGA 4FJCA 2ATOA 2JQFR 4CDEA 2VHSA 2NQGA 2PBHA 3H6SA 4AXMA 4BQVA 2YJ8A 4W4UA 1YK7A 1EWMA 1GMYA 4YYRA 3BC3A 1CSBB 1KHPA 1U9VA 1SNKA 4Q8GA 1F2CA 2DC6A 3QT4A 1MIRA 3KKUA 1QOLA 3USVA 1ME4A 1PADA 2WBFX 3IMAA 3P5XA 5CHVA 1CV8A 2DJFB 1IWDA 5FPWA 4CDCB 3RVVA 2R9FA 2FUDA 3I3TA 3KWBX 4CDFB 3D6SA 2BSZA 2VFBA 3QJ3A 4XUIA 3OVXA 3NHEA 1ITOA 1MEGA 2DZYA 3CBKA 3PW3A 2BDLA 4Q8HA 3KFQA 4HWYA 1K3BB 1QMYA 1CJLA 1PPPA 1TU6A 3WXGA 1GECE 4YVAA 4MZOA 3CH2X 4P6GA 1TL9A 4AXLA 4OEMA 2VHFA 2Y5BA 4I05A 2OP3A 1NL6A 1U9WA 3HHIA 5CVMA 2CIOA 1POPA 1EWPA 3IOQA 1PIPA 1ICFA 4QRGA 1KHQA 2Y6EA 3KX1A 1VJVA 4FK5A 1W5RA 2P7UA 5J94A 1CS8A 4C5PA 1CPJA 8PCHA 2FTDA 4W5BA 5EF4A 2DJGB 4ZUXU 1SP4B 4BS6A 1BGOA 2HH5A 1MS6A 5CVNB 4YYUA 2IPPB 3KW9A 4CDEB 2IBIA 1U5IA 2R9NA 4X6JA 1M6DA 1JQPA 3PBHA 2XU4A 4W5CA 2XU1A 1VSNA 5EGWA 4KLBA 5CHTA 3ZUAA 1AU3A 2YJ2A 1YALA 1YVBA 2DCCA 4QH6A 2C0YA 2NQAA 3K8UA 3H7DA 4X6HA 6PADA 3DF0A 1ZCMA 1AU2A 1ME3A 1PBHA 2FRQA 4MZSA 4I07A 2G6DA 4G54A 4PP1A 1W6FA 2P0RA 3IV2A 1NPZA 5K16A 5JH3A 3HD3A 1PCIA 4N8WA 2DCBA 2O6XA 4XR7A 1THEA 3V6EA 1DF0A 3KSEA 2B1MA 1QDQA 1NLJA 3IHPA 2ACTA 4FIPA 3BPMA 3MHSA 1Q6KA 3K9MA 4BS5A 3O0UA 1NQCA 1QXPA 3OISA 3S3RA 4DMYA 1PXVA 1BQIA 1AIMA 3M99A 4RY2A 1HUCB 1Y4HA 1X9YA 2DCAA 1AYWA 3OF8A 2E00A 1CTEA 2XU3A 1AYVA 3CBJA 4MSXA 4QBBA 2B1NA 1BP4A 1KFUL 1Y08A 5JA7A 4N4ZA 3BPFA 4CDDA 2ARYA 1PE6A 2G8JA 3MTNA 1CB5A 2VFCA 1F2AA 2OULA 2R9CA 2AVWA 3RVWA 2F7DA 1CVZA 1PPNA 1PPOA 1A6RA 3RVXA 3LTWA 3IEJA 2FQ9A 1K3BA 3O1GA 2PADA 3PDFA 3KWZA 1DEUA 4X6IA 1ZIVA 1U9XA 2FRAA 4YYVA 5PADA 4P6EA 1STFE 1KXRA 3I06A 1NB5A 3PNRA 3F75A 3OF9A 1AU4A 1GCBA 1F2BA 3B79A 3TNXA 2AYOA 3U8EA 1BY8A 5CVOB 3S3QA 4WA6A 1ATKA 4YYQA 1YT7A 1NB3A 2HD5A 4NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDZ A;  4QRV A;  1AU0 A;  3N3G A;  2PRE A;  1KFX L;  1PPD A;  3MHH A;  4I04 A;  1CQD A;  4OEL A;  2E01 A;  3H8B A;  4BSQ A;  2YJ9 A;  3F5V A;  2H7J A;  3C9E A;  3CH3 X;  2YJB A;  2JQG R;  2AIM A;  2AU1 A;  4QRX A;  2OZ2 A;  3P5W A;  3BCN A;  1YK8 A;  2F1G A;  3OVZ A;  2AYN A;  3K24 A;  1F29 A;  4YV8 A;  3P5V A;  4PP2 E;  3MOR A;  1MHW A;  2AUX A;  1EWL A;  5F02 A;  2GFO A;  2E03 A;  4N79 A;  4CDD B;  5A24 A;  7PCK A;  2HHN A;  3H89 A;  3AI8 A;  3WXE A;  2DZZ A;  4K7C A;  2DJF A;  1EWO A;  1FH0 A;  2DCD A;  3BOW A;  4CDC A;  3V6C A;  4PI3 A;  2YJC A;  3BWK A;  4CDF A;  1XKG A;  1AYU A;  2HXZ A;  2AUZ A;  2FT2 A;  1GLO A;  3LFY A;  1S4V A;  2PNS A;  3WXF A;  3QSD A;  2GHU A;  3N3K A;  4PAD A;  1MEM A;  2DC7 A;  2AS8 A;  1AEC A;  2R6N A;  4YYW A;  2DC9 A;  2NQI A;  3N4C A;  3LXS A;  3H8C A;  1MDW A;  3P5U A;  1EF7 A;  4CZW A;  4DMX A;  3GCB A;  9PAP A;  2FYE A;  4YYS A;  1TLO A;  3HHA A;  3HWN A;  2CB5 A;  2DC8 A;  1O0E A;  2G8E A;  3ERV A;  2XU5 A;  2FO5 A;  2NQD B;  1U9Q X;  2G7Y A;  2R9M A;  2E02 A;  3E1Z B;  4BPV A;  2R9O A;  2P86 A;  3IUT A;  2DJG A;  4FJC A;  2ATO A;  2JQF R;  4CDE A;  2VHS A;  2NQG A;  2PBH A;  3H6S A;  4AXM A;  4BQV A;  2YJ8 A;  4W4U A;  1YK7 A;  1EWM A;  1GMY A;  4YYR A;  3BC3 A;  1CSB B;  1KHP A;  1U9V A;  1SNK A;  4Q8G A;  1F2C A;  2DC6 A;  3QT4 A;  1MIR A;  3KKU A;  1QOL A;  3USV A;  1ME4 A;  1PAD A;  2WBF X;  3IMA A;  3P5X A;  5CHV A;  1CV8 A;  2DJF B;  1IWD A;  5FPW A;  4CDC B;  3RVV A;  2R9F A;  2FUD A;  3I3T A;  3KWB X;  4CDF B;  3D6S A;  3QJ3 A;  4XUI A;  3OVX A;  3NHE A;  1ITO A;  1MEG A;  2DZY A;  3CBK A;  3PW3 A;  2BDL A;  4Q8H A;  3KFQ A;  4HWY A;  1K3B B;  1QMY A;  1CJL A;  1PPP A;  1TU6 A;  3WXG A;  1GEC E;  4YVA A;  4MZO A;  3CH2 X;  4P6G A;  1TL9 A;  4AXL A;  4OEM A;  2VHF A;  2Y5B A;  4I05 A;  2OP3 A;  1NL6 A;  1U9W A;  3HHI A;  5CVM A;  2CIO A;  1POP A;  1EWP A;  3IOQ A;  1PIP A;  1ICF A;  4QRG A;  1KHQ A;  2Y6E A;  3KX1 A;  1VJV A;  4FK5 A;  2P7U A;  5J94 A;  1CS8 A;  1CPJ A;  8PCH A;  2FTD A;  4W5B A;  5EF4 A;  2DJG B;  4ZUX U;  1SP4 B;  4BS6 A;  1BGO A;  2HH5 A;  1MS6 A;  5CVN B;  4YYU A;  2IPP B;  3KW9 A;  4CDE B;  2IBI A;  1U5I A;  2R9N A;  4X6J A;  1M6D A;  1JQP A;  3PBH A;  2XU4 A;  4W5C A;  2XU1 A;  1VSN A;  5EGW A;  4KLB A;  5CHT A;  3ZUA A;  1AU3 A;  2YJ2 A;  1YAL A;  1YVB A;  2DCC A;  4QH6 A;  2C0Y A;  2NQA A;  3K8U A;  3H7D A;  4X6H A;  6PAD A;  3DF0 A;  1ZCM A;  1AU2 A;  1ME3 A;  1PBH A;  2FRQ A;  4MZS A;  4I07 A;  2G6D A;  4G54 A;  4PP1 A;  2P0R A;  3IV2 A;  1NPZ A;  5K16 A;  5JH3 A;  3HD3 A;  1PCI A;  4N8W A;  2DCB A;  2O6X A;  4XR7 A;  1THE A;  3V6E A;  1DF0 A;  3KSE A;  2B1M A;  1QDQ A;  1NLJ A;  3IHP A;  2ACT A;  4FIP A;  3BPM A;  3MHS A;  1Q6K A;  3K9M A;  4BS5 A;  3O0U A;  1NQC A;  1QXP A;  3OIS A;  3S3R A;  4DMY A;  1PXV A;  1BQI A;  1AIM A;  3M99 A;  4RY2 A;  1HUC B;  1Y4H A;  1X9Y A;  2DCA A;  1AYW A;  3OF8 A;  2E00 A;  1CTE A;  2XU3 A;  1AYV A;  3CBJ A;  4MSX A;  4QBB A;  2B1N A;  1BP4 A;  1KFU L;  1Y08 A;  5JA7 A;  4N4Z A;  3BPF A;  4CDD A;  2ARY A;  1PE6 A;  2G8J A;  3MTN A;  1CB5 A;  1F2A A;  2OUL A;  2R9C A;  2AVW A;  3RVW A;  2F7D A;  1CVZ A;  1PPN A;  1PPO A;  1A6R A;  3RVX A;  3IEJ A;  2FQ9 A;  1K3B A;  3O1G A;  2PAD A;  3PDF A;  3KWZ A;  1DEU A;  4X6I A;  1ZIV A;  1U9X A;  2FRA A;  4YYV A;  5PAD A;  4P6E A;  1STF E;  1KXR A;  3I06 A;  1NB5 A;  3PNR A;  3F75 A;  3OF9 A;  1AU4 A;  1GCB A;  1F2B A;  3B79 A;  3TNX A;  2AYO A;  3U8E A;  1BY8 A;  5CVO B;  3S3Q A;  4WA6 A;  1ATK A;  4YYQ A;  1YT7 A;  1NB3 A;  2HD5 A; 
#chains in the Genus database with same CATH topology
 2RTJ A;  4QRV A;  5LJB A;  3C77 X;  1NQN A;  4GJV A;  1LCV A;  2XKL A;  3T2X A;  4IB8 A;  1HQP A;  4XME A;  4EQA C;  3TRK A;  4GUZ A;  1VWL B;  3MHH A;  1NQM A;  1EQD A;  1E2T A;  1CQD A;  2HWK A;  1QY2 A;  4AZM A;  5AEO A;  1SWF A;  2YJ9 A;  2OFB A;  4A1Y A;  5KHP A;  2N93 A;  5H9K A;  2MF6 A;  2MWH A;  2Y3E A;  1IKJ A;  1EW3 A;  1VYO A;  1YK8 A;  2F1G A;  3OVZ A;  1DKI A;  1SRI A;  3IA8 A;  1ZND A;  3OQC A;  2OYB O;  3MOR A;  1MHW A;  2AUX A;  4ZTB A;  1GXA A;  2E03 A;  5A24 A;  7PCK A;  2CM9 A;  3H89 A;  2M4L A;  2PI3 O;  2DZZ A;  4D8E A;  3D9W A;  2MJI A;  4IP3 A;  4U8U N;  3B2J A;  4ID2 A;  3BOW A;  4CDC A;  3V6C A;  1X8O A;  4GDA A;  1EI5 A;  1SY1 A;  4CDF A;  1AYU A;  2HXZ A;  3FMZ A;  1PTS A;  3LV4 A;  3ZI8 A;  4ZHG A;  1MUP A;  3RNV A;  1S4V A;  1SWN A;  2G78 A;  4IB6 A;  3WXF A;  3EW1 A;  4Y0S A;  2A5B A;  3N3K A;  2ALL X;  2GTF X;  1MM9 A;  4ZHH A;  3APX A;  3RDO A;  5IO6 A;  2JRI A;  2BC3 A;  5KO3 A;  2RTB B;  1VWD B;  3LXS A;  4PJ2 A;  2K23 A;  4WFV A;  3P5U A;  1DC9 A;  4QYP A;  3UAQ A;  3T6F A;  4ZR2 A;  5LKE A;  4I9R A;  9PAP A;  2FYE A;  4YYS A;  2JGS A;  5F6Z A;  2X45 A;  1I4U A;  4MVL A;  4A5U A;  4FBO A;  2DJG A;  4MVK A;  1E5P A;  1DZJ A;  3VE2 A;  1GKA B;  2ATO A;  1SWK A;  3T1D A;  1VWB B;  2VHS A;  1SWU A;  3N91 A;  4QZT A;  4AXM A;  4BQV A;  4W4U A;  2QO6 A;  3BC3 A;  3B21 A;  1JJU A;  1MIR A;  3RZY A;  2IZG B;  3USV A;  5EDB A;  2FS6 A;  5IXG A;  3FEN A;  2P8G A;  1T0V A;  4IB9 A;  1G85 A;  1GX9 A;  2L5P A;  4QQ1 A;  1XCA A;  3P5X A;  2GTL N;  3RVV A;  4D6A A;  1STR B;  3I3T A;  3NQK A;  2BSZ A;  5D48 A;  3QJ3 A;  4A8Z A;  5H9L A;  4IBA A;  3APW A;  5FAZ A;  4Z6J A;  4LKP A;  1ITO A;  4BOQ A;  1I04 A;  3CBK A;  2MO5 A;  4Y5D A;  3KFQ A;  3PRP A;  4HWY A;  1K3B B;  1QMY A;  3VG3 A;  5CSE A;  4NLJ A;  3TF6 A;  3CH2 X;  4P6G A;  4AXL A;  1UYN X;  3LHN A;  1A57 A;  4TKJ A;  2IZF B;  4RUU A;  2UZJ A;  3O22 A;  3HWE A;  4AYH A;  3HHI A;  3APV A;  1SWP A;  1OSP O;  1NC9 A;  4ZCB A;  3IOQ A;  2HKD A;  4BOP A;  3WJB A;  1VJV A;  4ZFX A;  2QO4 A;  3VHH A;  4KH8 A;  2WEX A;  1CS8 A;  5LJD A;  2Z4I A;  4DQ4 A;  1CPJ A;  5EDC A;  2FTD A;  1D3S A;  2C1S A;  3ZW1 A;  1CBI A;  3NBX X;  4ML7 B;  1BGO A;  2HH5 A;  1MS6 A;  1NGL A;  4TKH A;  3ZW2 A;  1TOU A;  3KW9 A;  5AJC A;  2J7Q A;  1U5I A;  1M6D A;  4YBU A;  2RTF B;  2AMM X;  3NQ3 A;  2EU7 X;  2ZSC A;  1VWA B;  2XU1 A;  1VSN A;  1E06 A;  4KLB A;  3FR5 A;  1IFB A;  4QYN A;  5CHK A;  4PSQ A;  5D47 A;  2OFA A;  5HZ5 A;  3MJ5 A;  5F1E A;  1KT3 A;  3GAQ A;  5FQ8 E;  3H7D A;  3JSQ A;  1VWR B;  1SWB A;  2FGS A;  5BVQ A;  1IIU A;  1R0U A;  2FR3 A;  1OPA A;  3RKG A;  1YWC A;  4ZHD A;  4G54 A;  4PP1 A;  5L8N A;  1EIO A;  3NX1 A;  1Y55 X;  1MX8 A;  1B8E A;  3NAD A;  4IAW A;  1TOW A;  4WBK A;  1FDQ A;  2X32 A;  4CPH A;  4RNA A;  3O2Y A;  2XST A;  1G74 A;  4KII A;  2IZI A;  3PH6 A;  1THE A;  3PHX A;  3KSE A;  3IHP A;  2BU3 A;  4FIP A;  1JJX A;  4XMH A;  4BVM A;  1ZNK A;  1HY2 A;  1SWA A;  5HZ6 A;  1NP4 A;  1S2P A;  2FHL A;  3O0U A;  3VGW A;  1QXP A;  4Y0R A;  2RTM A;  4ZJ0 A;  5JR8 A;  2AT3 X;  2GC9 A;  3KFH A;  2IFB A;  1ACD A;  4U3Q A;  1AIM A;  4RY2 A;  1HUC B;  4BX5 B;  4BJ8 A;  1X9Y A;  3CQR A;  4L3R A;  1AYW A;  2E00 A;  4Z2P A;  3CBJ A;  3WZN A;  4MSX A;  4MVI A;  4Z28 A;  3JQO A;  5IRU A;  4ORU A;  4MEE A;  5JA7 A;  4N4Z A;  4CDD A;  1RBP A;  2HZR A;  1OBU A;  2VFC A;  4ODD A;  2OUL A;  4BOE A;  1YUP A;  3EYC A;  2ACO A;  2F7D A;  1CVZ A;  5LJC A;  4YKM A;  3PQS A;  3W30 A;  2RTN B;  1AEL A;  2PAD A;  2FS7 A;  4AZN A;  1DEU A;  1URE A;  2Q9S A;  4YBP A;  1UKF A;  4QAE A;  1SWR A;  3BU1 A;  4M0W A;  4O49 A;  1AVG I;  1LUQ A;  5HTE A;  4WUR A;  4OKA A;  1KXR A;  3I06 A;  1F2B A;  1QAB E;  1MOY A;  2WWP A;  3PRM A;  3HWD A;  1AQB A;  1BY8 A;  1YP6 A;  2UZ2 A;  1Y53 X;  1O8V A;  1LKE A;  2OL7 A;  1VYF A;  2JTC A;  2BDZ A;  4YCH A;  5E6J A;  1KFX L;  4BX6 B;  4MI7 A;  3D96 A;  3PED A;  5HTD A;  1EUO A;  2G79 A;  4I04 A;  1HQQ A;  4OEL A;  1BSY A;  2QMI A;  2OY8 A;  3F6Z B;  3H8B A;  1E02 A;  4BSQ A;  4NV8 A;  5HCD C;  2MHD A;  4DQ3 A;  4RKX A;  3C9E A;  3CH3 X;  2YJB A;  4ZH9 A;  2AU1 A;  5HA0 A;  3FYF A;  3CWK A;  3BCN A;  1MEP A;  1LF7 A;  3BX8 A;  4O3Y A;  1X8P A;  1BWY A;  1KT5 A;  5EZS A;  5FQ6 E;  3JS1 A;  4RF1 A;  3K24 A;  4YV8 A;  3P5V A;  4PP2 E;  4O4S A;  5BVS A;  1FE3 A;  2GFO A;  4YFR A;  2RTD B;  4N79 A;  1W4T A;  1GM6 A;  1VWO B;  2DJF A;  1N43 A;  1FH0 A;  3P24 A;  3KFI A;  2QO5 A;  4NNT A;  1OBQ A;  2YJC A;  3C0R A;  1BJ7 A;  1XKG A;  2FKJ A;  3VG2 A;  1KT6 A;  1SRF A;  1STS B;  1DF8 A;  3LFY A;  2RTR B;  3QSD A;  1VWI B;  1MEM A;  2LBA A;  1LFO A;  3U9P C;  3BS2 A;  1DZK A;  4YMY A;  1SMP I;  3AKN A;  1X71 A;  2RCQ A;  1AEC A;  3CKF A;  2KTD A;  4YGZ A;  2R6N A;  2Y32 A;  4YFQ A;  1OPB A;  2NQI A;  2WQ9 A;  1CBQ A;  1SWC A;  2NND A;  3NP1 A;  1RST B;  1LCW A;  3N4C A;  4U9C A;  1EF7 A;  2E4J A;  4Z2O A;  3GCB A;  4Y0Q A;  1OEJ A;  2FKG A;  2CB5 A;  4U46 A;  2JOZ A;  1LNM A;  4XMF A;  4I95 A;  3ERV A;  4HPC A;  1TVQ A;  2XU5 A;  2FO5 A;  1U9Q X;  1A3Y A;  5HAE A;  4LZU A;  2RTI B;  2P86 A;  2RTC B;  2X8F A;  4CDE A;  3ZNH A;  2PBH A;  1OEE A;  2A13 A;  4CPE A;  1SWG A;  2AT6 X;  5B5F A;  4OMW A;  1F2C A;  1QOL A;  1ME4 A;  5FQ7 E;  2JW1 A;  2PY1 A;  1SXX A;  4I3C A;  2LB6 A;  2W2A A;  2WBF X;  1GT4 A;  1CV8 A;  4ZHF A;  1EXS A;  1N9Y A;  4CDC B;  3FA7 A;  5K67 A;  4CDF B;  3WJD A;  3MM0 A;  1JMZ A;  4NP1 A;  3OVX A;  3D97 A;  2DZY A;  2Y3F A;  3P02 A;  1VWH B;  3PW3 A;  1DF3 A;  1TXL A;  4OS8 A;  1AVD A;  5HWZ A;  2GH7 A;  3PH5 A;  3FDC A;  1PPP A;  4ZHC A;  3WXG A;  1GEC E;  4MZO A;  5IRW A;  3DSZ A;  1TL9 A;  3D95 A;  3VHM A;  2Y5B A;  4I05 A;  3SZJ A;  2FTB A;  5H9N A;  1NL6 A;  3ELX A;  1VWF B;  1LIC A;  3ZQ3 A;  1EPB A;  5CVM A;  2CIO A;  4EKV A;  3PHU A;  1SLG B;  3WJC A;  1EAL A;  1YZB A;  1EPA A;  4QRG A;  3ZW0 A;  1GGL A;  4I60 A;  1SRH A;  2POA A;  1VWJ B;  1IKE A;  1LDQ A;  4JGL A;  1UZ2 X;  2AKQ A;  5KID A;  8PCH A;  3WJE A;  2RD7 C;  2DJG B;  2L67 A;  4BS6 A;  4M7M A;  3PHW A;  3RDQ A;  2R9N A;  3EMM A;  3KFG A;  2OY7 A;  3PBH A;  2AL0 X;  2XU4 A;  2AT0 X;  3ZUA A;  1JYJ A;  4N7C A;  3TGA A;  4GNY A;  4YGG A;  2DCC A;  3HWF A;  4BX7 A;  3SZH A;  1BSO A;  4EFG A;  6PAD A;  4Y0P A;  4QZU A;  2CM4 A;  2FRQ A;  4I07 A;  2G6D A;  1PEE A;  2RTG B;  1LDO A;  1Y52 X;  4XMC A;  4CPI A;  3V8U A;  3HWG A;  2BTW A;  1GT3 A;  4QGX A;  4O4O A;  5K16 A;  1VWQ B;  3HD3 A;  1JMX A;  2DCB A;  5HBS A;  4XR7 A;  1JJJ A;  2W2B A;  2X8S A;  3AKM A;  1LID A;  2RTA A;  3U03 A;  3PQU A;  1NLJ A;  4OS3 A;  1SWH A;  2ACT A;  4BOS A;  4ALB A;  1PBO A;  3EBK A;  2F01 A;  1NQC A;  5B5G A;  3FIQ A;  4IB7 A;  2FWV A;  1JV4 A;  3S26 A;  4Z2V A;  1BEB A;  1SWL A;  2DCA A;  1CTE A;  1AYV A;  2BS5 A;  2FLJ A;  3WYP A;  4GGR A;  3ZW1 B;  1Y08 A;  2A0A A;  5HA1 A;  2AH7 X;  1PE6 A;  1SXY A;  2G8J A;  1CB5 A;  3B2H A;  3WJG A;  1KL3 A;  4YH0 A;  4HPA A;  1BM5 A;  2G7B A;  2HYS A;  1SLF B;  3BDR A;  1SXW A;  2QCB A;  1GX8 A;  1K3B A;  4GGT A;  5B29 A;  3O1G A;  4BOU A;  2AGA A;  2AF5 A;  3FA9 A;  2AT5 X;  1VPR A;  1ZIV A;  5BYP A;  1LIF A;  3RWX A;  4ALO A;  3ZUO A;  1VWE B;  4AZR A;  1TW4 A;  1X8U A;  1NB5 A;  3RY1 A;  1PMP A;  2WQA E;  4GK9 A;  3F8A A;  2HZQ A;  3B79 A;  3TNX A;  1DZM A;  1Z24 A;  4MVE A;  2DOS A;  1I05 A;  2OVS A;  4LZV A;  2QOS C;  4M6S A;  4QGW A;  2OF9 A;  2X34 A;  3S3Q A;  3L4R A;  3BX7 A;  4CPH B;  1YT7 A;  1NB3 A;  2CBR A;  4NV7 A;  5AJB A;  1AU0 A;  3KQ0 A;  3N3G A;  2OY5 O;  4HFO A;  3AEH A;  3HOE A;  3APU A;  1PPD A;  4GH7 A;  1KFF A;  1HBQ A;  1EII A;  2CBS A;  2E01 A;  3AUM O;  3OJY C;  4LQZ A;  4YFP A;  2H7J A;  2ASN X;  2JQG R;  2AIM A;  3P6H A;  4NLI A;  3BSZ E;  4QNI A;  1T8V A;  3P5W A;  4O3W A;  4IUM A;  2VDF A;  1WBI A;  5EEE A;  2WSJ A;  1BRQ A;  1QWD A;  4RUN A;  3CMP A;  3CBS A;  4R0B A;  1KT4 A;  2AYN A;  1NP1 A;  2IZJ A;  2RTE B;  3RDM A;  3EM0 A;  1U18 A;  4QRL A;  1ERB A;  5D8J A;  4CDD B;  4GNW A;  3B2I A;  4OS0 A;  1EWO A;  2DCD A;  1HMS A;  1GX3 A;  2MM3 A;  3BWK A;  3VG7 A;  2AUZ A;  4I3D A;  2OL6 O;  4GKC A;  3H3I A;  2LKK A;  3FR2 A;  3NR3 A;  1GLO A;  1RXH A;  4IRW A;  1PVJ A;  4PT5 A;  2PNS A;  2GHU A;  4NYQ A;  4PAD A;  1HMT A;  1SRE A;  2AS8 A;  4I3B A;  1O1U A;  1MX7 A;  4YDA A;  1B4M A;  1Y9T A;  1YWD A;  1RAV A;  2R73 A;  4YYW A;  1JYD A;  4IMO A;  2DC9 A;  2FHN X;  2Z84 A;  3BB7 A;  3I17 A;  3H8C A;  3IFU A;  3STN A;  4DMX A;  1X8N A;  3Q6L A;  1X8Q A;  2RN4 A;  1GT5 A;  4TNN A;  1O0E A;  4YDB A;  4ORR A;  2NQD B;  1ZNL A;  2G7Y A;  2R9M A;  2R9O A;  4TJZ A;  5LJH A;  3IUT A;  1AB0 A;  2ZAG A;  3MX7 A;  3EBW A;  5F58 A;  2OY1 O;  3RBY A;  2NNE A;  3SLJ A;  2NQG A;  3H6S A;  1QY1 A;  1JIW I;  4HXD B;  3P6F A;  2YJ8 A;  3T6L A;  3VU1 A;  1YK7 A;  3P6D A;  1GMY A;  5HZ8 A;  2IZK A;  1KHP A;  1U9V A;  3IFB A;  5D45 A;  5EZ2 A;  2L9C A;  3KKU A;  2BLG A;  3FEP A;  1QQS A;  3WYQ A;  2L68 A;  1SWT A;  1KZX A;  4HWM A;  3TZS A;  1SWO A;  3K3L A;  1WUB A;  3FEL A;  3UEX A;  4YKO A;  4TQ2 A;  2DJF B;  1IWD A;  1SLD B;  3O65 A;  5LJK A;  5FPW A;  1DFV A;  4OVZ A;  1SY2 A;  2R9F A;  3SLT A;  2FUD A;  2BHV A;  3D6S A;  1AVE A;  4I9S A;  4MIR A;  4XUI A;  4AZO A;  5B11 O;  3KZA A;  1LIE A;  4U8U M;  3WBG A;  3NHE A;  1U17 A;  3FA6 A;  3WXQ A;  1KT7 A;  2QM9 A;  4EXZ A;  1LCZ A;  3CKG A;  3RE5 A;  3PT2 A;  4Q8H A;  5L8I A;  1TU6 A;  4ES7 A;  4YVA A;  1KGL A;  2Q2M A;  2CZT A;  4JO6 A;  5B2A O;  4YVB A;  3PPT A;  3E9S A;  1IFC A;  2RA6 A;  4OEM A;  2OP3 A;  5JD2 A;  1U9W A;  3S5X A;  3VPJ E;  2ANS A;  4Z27 A;  1POP A;  2A5C A;  5F2B A;  4GJS A;  1PIP A;  2FR2 A;  1K24 A;  2RTH B;  3KX1 A;  2KW1 A;  3UEW A;  3W31 A;  1RXJ A;  3NX2 A;  5J94 A;  2A2G A;  3TMP A;  2IZE B;  4ZGF A;  2ACP X;  1YP7 A;  3BY4 A;  1N0S A;  1SWS A;  1SP4 B;  3TGC A;  4YYU A;  2LA7 A;  4O3Z A;  4CDE B;  3UEV A;  2IBI A;  4P16 A;  5AQ6 A;  4X6J A;  4D8I A;  5LKF A;  1HN2 A;  1IJ8 A;  1SY3 A;  3S5V A;  4W5C A;  3X00 A;  1FJ1 E;  2JU3 A;  1AU3 A;  2IZB A;  1CRB A;  1CBS A;  4N7D A;  1YVB A;  4QH6 A;  4REZ A;  1Y0G A;  3K8U A;  4TLJ A;  2OL8 O;  3VG4 A;  4OW0 A;  2W2F A;  3OE3 A;  1U0X A;  3CR6 A;  4AW8 A;  4WHI A;  1AU2 A;  1PBH A;  4MZS A;  4HPB A;  3B2L A;  1W6F A;  1BLR A;  2GTL M;  4OMX A;  1T68 X;  1PCI A;  4ZGU A;  3HOL A;  1KL5 A;  5HZ9 A;  3B2K A;  2O6X A;  3WZO A;  3V6E A;  1I06 A;  2OFR X;  2X46 A;  2G8C O;  3C76 X;  3RSW A;  5EZQ A;  4D6B A;  2B1M A;  1BBP A;  2GJ5 A;  4GUA A;  1FEM A;  3O19 A;  2ZAI A;  3BBA A;  1RSU B;  4D8B A;  4BS5 A;  3PSE A;  4EDE A;  1O1V A;  1PXV A;  4O3X B;  2BT9 A;  2FRS A;  4CPF A;  1BQI A;  3U0D A;  2OVA A;  5B27 A;  3ZW0 B;  1L6M A;  3M99 A;  3SLO A;  1Y4H A;  3MTV A;  2F73 A;  3ZZV A;  1STP A;  3MG5 A;  5CE4 A;  2XU3 A;  1NDJ A;  3RDS A;  4QBB A;  3HPE A;  3MP2 A;  1BP4 A;  4ORS A;  1KFU L;  1QFT A;  4YCE A;  1VWG B;  3FEK A;  4AZQ A;  2ARY A;  1G7N A;  1HMR A;  1F2A A;  2AT8 X;  5FEN A;  3RVW A;  2RCT A;  4KCA A;  4GD9 A;  1PPO A;  3P6E A;  1SWD A;  2RTL A;  4TKB A;  3WZQ A;  1PBY A;  3SZI A;  1KL4 A;  4Y59 A;  1D2U A;  5C0N A;  1YIV A;  3QKG A;  4X6I A;  4CSB A;  3I0A A;  4NYR A;  1N7Y A;  1SRJ A;  1ICN A;  4BX7 B;  1U9X A;  2R74 A;  2JMB A;  1MK5 A;  2JU8 A;  5PAD A;  4YYV A;  1NBX A;  4GRJ A;  5EED A;  3FLL A;  4P6E A;  2A3F X;  1JZU A;  1STF E;  3PNR A;  3F75 A;  3OF9 A;  1GCB A;  1HXZ A;  2YG2 A;  4GZV A;  3QQ2 A;  5F6B A;  4JHQ A;  1S44 A;  2AYO A;  1SA8 A;  2BTW B;  2IZD B;  2Q39 A;  4BQU A;  4YYQ A;  2HD5 A;  1HXL A;  4ORX A;  2PRE A;  1KQX A;  2A2U A;  2HMB A;  4B55 A;  3NPO A;  3D4R A;  1IW2 A;  1OEK A;  2IZH B;  3F5V A;  1RLB E;  2Q2P A;  4I6S A;  5LJE A;  1ICM A;  5HCE C;  1FTP A;  4QRX A;  3RE6 A;  2OZ2 A;  1GKA A;  5HCC C;  4FGI B;  1B0O A;  2X55 A;  4K19 A;  4O4X A;  5LJG A;  1B56 A;  1F29 A;  4GU8 A;  3ZWE A;  1LIB A;  1EWL A;  2X56 A;  5F02 A;  1SXU A;  3ZUI A;  4XMD A;  2HHN A;  3PP6 A;  1YWB A;  3AI8 A;  3WXE A;  1HBP A;  4U8U O;  2LFO A;  1QFV A;  1SWE A;  4K7C A;  1Y9L A;  2A8G A;  2WPU A;  2LBV A;  4PI3 A;  5FFH A;  2OVD A;  3SOT A;  2FT2 A;  2RQ0 A;  4BGF A;  3EC5 A;  4HPD A;  2OVE A;  2G5L A;  4XZX A;  2O62 A;  3FID A;  4RF0 A;  5L3Y A;  2DC7 A;  2X4M A;  4A60 A;  1G5W A;  3WOV A;  1XKI A;  2QOM A;  4WFU A;  2Q4N A;  3DTQ A;  3FR4 A;  3VG6 A;  1VWK B;  1MDW A;  4CZW A;  1ZRY A;  3F9D A;  3OD9 A;  3VG5 A;  1LEL A;  1S7D A;  4O9S A;  1TLO A;  3HHA A;  2I5Z O;  4IAX A;  3HWN A;  1KXO A;  1KOI A;  2DC8 A;  2G8E A;  3G7X A;  3VHI A;  4NNS A;  4A1H A;  2E02 A;  1BSQ A;  5F7G A;  3E1Z B;  4BPV A;  4GGZ A;  3WZP A;  4JNJ A;  4FJC A;  2JQF R;  4KC8 A;  4DCB A;  1SLE B;  1N4J A;  2I5V O;  1QY0 A;  5L8O A;  2BS6 A;  1VWP B;  4UU2 A;  4CV7 A;  1MDC A;  4KC7 A;  4COT A;  1EWM A;  4YYR A;  1CSB B;  3SAO A;  1SNK A;  4Q8G A;  2DC6 A;  3QT4 A;  4NW4 A;  3ELZ A;  3PEC A;  1PAD A;  3HK1 A;  5K68 A;  1ZNH A;  5H8T A;  3OBL A;  2GTL O;  3IMA A;  5CHV A;  4DNE A;  2DM5 A;  3KWB X;  4FBV A;  2VFB A;  3RDU A;  1KQW A;  1VWM B;  3NQ9 A;  3RY2 A;  5EPQ A;  1KZW A;  1ALB A;  1X89 A;  1MEG A;  5B3M O;  3GE2 A;  3E3C A;  5BVT A;  2NP1 A;  2BDL A;  1JBH A;  1PM1 X;  2C1Q A;  3CQN A;  1CJL A;  4BCS A;  1OBP A;  5DPQ A;  3P6G A;  2K62 A;  3KVN A;  3WJF A;  2NNQ A;  3Q34 A;  4INN A;  3T2W A;  2FE8 A;  2VHF A;  3HTY A;  2IZL B;  5B10 O;  5KIC A;  1SY0 A;  1EWP A;  5DG4 A;  2KT4 B;  3PK2 A;  1ICF A;  1H91 A;  2WR6 A;  1KHQ A;  2CZU A;  1DV9 A;  2Y6E A;  1I78 A;  4BX5 A;  2JU7 A;  5K06 A;  1FEL A;  4FK5 A;  5H9A A;  1W5R A;  2P7U A;  2Z4H A;  3STM X;  4C5P A;  3FA8 A;  2RTP B;  2KD2 A;  4W5B A;  5EF4 A;  1GT1 A;  4BOZ A;  4ZUX U;  5CVN B;  2IPP B;  3BLG A;  1ZNE A;  2F09 A;  1JQP A;  1I9H A;  2AVI A;  4R3D A;  2J7Q C;  4ORY A;  5EGW A;  5CHT A;  2OFM X;  4GET A;  2YJ2 A;  1YAL A;  4ZH6 A;  5CYB A;  2C0Y A;  2NQA A;  5JZE A;  4AZP A;  1MVG A;  2OZQ A;  4ORW A;  4X6H A;  5HZQ A;  1N9M A;  4UU3 A;  3WVM A;  3DF0 A;  1ZCM A;  4OVZ B;  1ME3 A;  1LPJ A;  3MVF A;  3UEU A;  4XMG A;  2RTO B;  2P0R A;  4IAB A;  3IV2 A;  5IRA A;  2IZA A;  2KTS A;  1NPZ A;  1YWA A;  1FEN A;  2FT9 A;  5JH3 A;  1VYG A;  4N8W A;  1SRG A;  4EEJ A;  5IO7 A;  2YMS A;  4L1N A;  4BX6 A;  1A2D A;  4BBO A;  1DF0 A;  1A18 A;  4IMN A;  4O4U A;  1QDQ A;  3BPM A;  4ARH A;  3MHS A;  3MBT A;  1Q6K A;  1ZNG A;  2IZC B;  1QG5 A;  3CBC A;  3RDX A;  3K9M A;  1CJ5 A;  3OIS A;  3S3R A;  4DMY A;  4ON1 A;  2WUT A;  1SWJ A;  2WEW A;  2HNX A;  3FW5 A;  1DZP A;  1E00 A;  2C4I A;  3OF8 A;  4FBR A;  2B1N A;  2JN3 A;  3KFF A;  2RTQ B;  3BPF A;  3FW4 A;  3MTN A;  4KT5 A;  3P6C A;  3C78 X;  4MIS A;  2R9C A;  2AVW A;  2RTK A;  2CAM A;  1PPN A;  1A6R A;  3RVX A;  2X8T A;  3LTW A;  4LKT A;  3IEJ A;  1ADL A;  1UYO X;  1SWQ A;  3TGB A;  2FQ9 A;  4GE1 A;  3VE1 A;  1VWC B;  2OF8 A;  3PDF A;  3KWZ A;  1CBR A;  3EW2 A;  1RXK A;  2UYW A;  4CK4 A;  4MM3 B;  3STK A;  3BRN A;  1ERX A;  2FRA A;  2R56 A;  1P6P A;  4QGV A;  5IO5 A;  4YGH A;  1AU4 A;  2HLV A;  4GDZ A;  3U8E A;  1ML7 A;  5D4A A;  4FQB B;  5CVO B;  3S60 A;  4WA6 A;  1ATK A;  1BRP A;  1VWN B;  3BY0 A;  3BU9 A; 
#chains in the Genus database with same CATH homology
 2BDZ A;  4QRV A;  1AU0 A;  3N3G A;  2PRE A;  1KFX L;  1PPD A;  4B55 A;  4GUZ A;  3MHH A;  4I04 A;  1E2T A;  1CQD A;  4OEL A;  2E01 A;  3H8B A;  4BSQ A;  4NV8 A;  2YJ9 A;  3F5V A;  2H7J A;  3C9E A;  3CH3 X;  2YJB A;  2JQG R;  2AIM A;  2AU1 A;  4QRX A;  2OZ2 A;  3P5W A;  3BCN A;  1YK8 A;  2F1G A;  3OVZ A;  2AYN A;  3K24 A;  1F29 A;  4YV8 A;  3P5V A;  4PP2 E;  3MOR A;  1MHW A;  2AUX A;  1EWL A;  5F02 A;  2GFO A;  2E03 A;  4N79 A;  4CDD B;  5A24 A;  7PCK A;  2HHN A;  1W4T A;  3H89 A;  3AI8 A;  3WXE A;  2DZZ A;  3D9W A;  4K7C A;  2DJF A;  1EWO A;  1FH0 A;  2DCD A;  3BOW A;  4CDC A;  3V6C A;  1GX3 A;  4PI3 A;  2YJC A;  3BWK A;  4CDF A;  1XKG A;  1AYU A;  2HXZ A;  2AUZ A;  2FT2 A;  4BGF A;  1GLO A;  3LFY A;  1S4V A;  2PNS A;  3WXF A;  3QSD A;  2GHU A;  3N3K A;  4PAD A;  1MEM A;  2DC7 A;  2AS8 A;  1AEC A;  2R6N A;  4YYW A;  2DC9 A;  2NQI A;  3N4C A;  3LXS A;  3H8C A;  1MDW A;  3P5U A;  1EF7 A;  4CZW A;  4DMX A;  3GCB A;  9PAP A;  2FYE A;  4YYS A;  1TLO A;  3HHA A;  3HWN A;  2CB5 A;  2DC8 A;  1O0E A;  2G8E A;  3ERV A;  2XU5 A;  2FO5 A;  2NQD B;  1U9Q X;  2G7Y A;  2R9M A;  2E02 A;  3E1Z B;  4BPV A;  2R9O A;  2P86 A;  3IUT A;  2DJG A;  4FJC A;  2ATO A;  2JQF R;  4CDE A;  2VHS A;  2NQG A;  2PBH A;  3H6S A;  4AXM A;  4BQV A;  2YJ8 A;  4W4U A;  1YK7 A;  1EWM A;  1GMY A;  4YYR A;  3BC3 A;  1CSB B;  1KHP A;  1U9V A;  1SNK A;  4Q8G A;  1F2C A;  2DC6 A;  3QT4 A;  1MIR A;  3KKU A;  1QOL A;  3USV A;  1ME4 A;  1PAD A;  2WBF X;  3IMA A;  3P5X A;  5CHV A;  1CV8 A;  2DJF B;  1IWD A;  5FPW A;  4CDC B;  3RVV A;  2R9F A;  2FUD A;  3I3T A;  3KWB X;  4CDF B;  3D6S A;  2BSZ A;  2VFB A;  3QJ3 A;  4XUI A;  3OVX A;  3NHE A;  1ITO A;  1MEG A;  2DZY A;  3CBK A;  3PW3 A;  2BDL A;  4Q8H A;  3KFQ A;  4HWY A;  1K3B B;  1QMY A;  1CJL A;  1PPP A;  1TU6 A;  3WXG A;  1GEC E;  4YVA A;  4MZO A;  3CH2 X;  4P6G A;  1TL9 A;  4AXL A;  4OEM A;  2VHF A;  2Y5B A;  4I05 A;  2OP3 A;  1NL6 A;  1U9W A;  3HHI A;  5CVM A;  2CIO A;  1POP A;  1EWP A;  3IOQ A;  1PIP A;  1ICF A;  4QRG A;  1KHQ A;  2Y6E A;  3KX1 A;  1VJV A;  4FK5 A;  1W5R A;  2P7U A;  5J94 A;  1CS8 A;  4C5P A;  1CPJ A;  8PCH A;  2FTD A;  4W5B A;  5EF4 A;  2DJG B;  4ZUX U;  1SP4 B;  4BS6 A;  1BGO A;  2HH5 A;  1MS6 A;  5CVN B;  4YYU A;  2IPP B;  3KW9 A;  4CDE B;  2IBI A;  1U5I A;  2R9N A;  4X6J A;  1M6D A;  1JQP A;  3PBH A;  2XU4 A;  4W5C A;  2XU1 A;  1VSN A;  5EGW A;  4KLB A;  5CHT A;  3ZUA A;  1AU3 A;  2YJ2 A;  1YAL A;  1YVB A;  2DCC A;  4QH6 A;  2C0Y A;  2NQA A;  3K8U A;  3H7D A;  4X6H A;  6PAD A;  3DF0 A;  1ZCM A;  1AU2 A;  1ME3 A;  1PBH A;  2FRQ A;  4MZS A;  4I07 A;  2G6D A;  4G54 A;  4PP1 A;  1W6F A;  2P0R A;  3IV2 A;  1NPZ A;  5K16 A;  5JH3 A;  3HD3 A;  1PCI A;  4N8W A;  2DCB A;  2O6X A;  4XR7 A;  1THE A;  3V6E A;  1DF0 A;  3KSE A;  2B1M A;  1QDQ A;  1NLJ A;  3IHP A;  2ACT A;  4FIP A;  3BPM A;  3MHS A;  1Q6K A;  3K9M A;  4BS5 A;  3O0U A;  1NQC A;  1QXP A;  3OIS A;  3S3R A;  4DMY A;  1PXV A;  1BQI A;  1AIM A;  3M99 A;  4RY2 A;  1HUC B;  1Y4H A;  1X9Y A;  2DCA A;  1AYW A;  3OF8 A;  2E00 A;  1CTE A;  2XU3 A;  1AYV A;  3CBJ A;  4MSX A;  4QBB A;  2B1N A;  1BP4 A;  1KFU L;  1Y08 A;  5JA7 A;  4N4Z A;  3BPF A;  4CDD A;  2ARY A;  1PE6 A;  2G8J A;  3MTN A;  1CB5 A;  2VFC A;  1F2A A;  2OUL A;  2R9C A;  2AVW A;  3RVW A;  2F7D A;  1CVZ A;  1PPN A;  1PPO A;  1A6R A;  3RVX A;  3LTW A;  3IEJ A;  2FQ9 A;  1K3B A;  3O1G A;  2PAD A;  3PDF A;  3KWZ A;  1DEU A;  4X6I A;  1ZIV A;  1U9X A;  2FRA A;  4YYV A;  5PAD A;  4P6E A;  1STF E;  1KXR A;  3I06 A;  1NB5 A;  3PNR A;  3F75 A;  3OF9 A;  1AU4 A;  1GCB A;  1F2B A;  3B79 A;  3TNX A;  2AYO A;  3U8E A;  1BY8 A;  5CVO B;  3S3Q A;  4WA6 A;  1ATK A;  4YYQ A;  1YT7 A;  1NB3 A;  2HD5 A;  4NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...