4OELA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
367
structure length
281
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVLHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
total genus 77
structure length 281
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oelA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oelA02
2R9FA 2P0RA 5A24A 1Q6KA 3H8CA 3N4CA 3MORA 2GHUA 1POPA 4PADA 1YT7A 2FUDA 4MSXA 3HHAA 1MHWA 3QJ3A 3IMAA 2AUXA 4CDDA 3KSEA 3MTNA 2F7DA 1PPDA 3CBJA 3QSDA 2FQ9A 2DJGA 1KFUL 1NL6A 5CVOB 1PPOA 1AU3A 4QH6A 1KHPA 1EWOA 3KWBX 3RVVA 1BQIA 1ZCMA 4KLBA 2YJBA 3O0UA 4BS5A 2H7JA 4BPVA 1MEMA 1QXPA 2DZZA 1Y08A 3QT4A 2NQIA 5JA7A 3H6SA 1ITOA 3CH3X 4BQVA 2AIMA 3OISA 2F1GA 3WXEA 1XKGA 4YYSA 4I04A 2O6XA 2BDLA 2OULA 4CDEB 3MHSA 3PBHA 1GCBA 1U5IA 1NPZA 2DJGB 4YYUA 1VJVA 2E00A 4G54A 3WXGA 2VHSA 3O1GA 3P5VA 4FK5A 3TNXA 2PREA 6PADA 1STFE 2GFOA 1KFXL 2FT2A 2R9CA 2E02A 8PCHA 1YVBA 3I06A 3P5UA 4QRVA 4X6HA 4AXMA 3OVZA 2HD5A 1AU0A 2HH5A 2AYNA 2PNSA 3PW3A 2HXZA 1PIPA 2XU1A 2DC8A 2FRQA 1QOLA 1U9QX 1CPJA 2B1MA 1EF7A 2JQFR 1SP4B 4FJCA 3S3RA 1AYUA 2AU1A 3ZUAA 3BPMA 3BCNA 1MEGA 1M6DA 1NB5A 4I07A 2PADA 3KKUA 1CTEA 4PP2E 1MIRA 4OELA 2DJFB 3KWZA 1F2BA 4CDFA 2AS8A 2G6DA 4CDCB 2ACTA 1GMYA 1AECA 5CHVA 3D6SA 3BOWA 2YJ8A 1CVZA 5PADA 4W4UA 9PAPA 4HWYA 1Y4HA 2OP3A 4AXLA 3BWKA 4OEMA 2CB5A 4N8WA 3GCBA 2NQGA 1JQPA 4YYRA 4XR7A 4BSQA 2IBIA 2DZYA 2DCAA 3V6CA 5EF4A 1QDQA 3H8BA 4PI3A 3CH2X 1BGOA 1O0EA 4CDCA 2YJ2A 3RVWA 1F2AA 1PXVA 1EWPA 2R9MA 4CDDB 3IHPA 3IEJA 4YYVA 1CJLA 5CVNB 1BP4A 3C9EA 3P5XA 1QMYA 5F02A 1K3BA 3CBKA 3KFQA 1ATKA 2JQGR 4FIPA 1EWMA 2OZ2A 2C0YA 2NQAA 3P5WA 2R9OA 3N3KA 3IOQA 2G7YA 2XU4A 1U9WA 3KW9A 1ZIVA 1A6RA 3USVA 3HWNA 1GLOA 3F75A 4N79A 1YK8A 4YYWA 2DC9A 1YK7A 3B79A 3S3QA 3AI8A 1U9XA 2E01A 4Q8HA 5EGWA 1CQDA 3RVXA 4DMYA 1EWLA 2AYOA 1CSBB 1DEUA 5CHTA 2YJCA 3BPFA 3LXSA 1THEA 1CB5A 2NQDB 2Y5BA 2G8JA 2PBHA 4CZWA 3U8EA 4YV8A 2DCCA 3NHEA 3LFYA 4W5CA 2FYEA 4PP1A 3K8UA 4DMXA 1U9VA 1AU2A 1FH0A 3K24A 5FPWA 1PPNA 1IWDA 1PPPA 1PADA 1GECE 1PBHA 2B1NA 4MZOA 3DF0A 2AVWA 4N4ZA 1VSNA 4Q8GA 1AU4A 4P6EA 4X6JA 3ERVA 2P86A 1NLJA 2DC6A 4I05A 1F2CA 1AIMA 2AUZA 3PDFA 3PNRA 2BDZA 2HHNA 2WBFX 3H89A 1NQCA 4BS6A 2ARYA 1CV8A 1AYVA 3WXFA 1K3BB 2YJ9A 4CDFB 3MHHA 4QBBA 1X9YA 4XUIA 4W5BA 2VHFA 1ICFA 2P7UA 3M99A 2ATOA 2IPPB 1S4VA 2FTDA 1BY8A 3F5VA 4ZUXU 3IV2A 3HHIA 3E1ZB 2G8EA 3BC3A 1MS6A 1SNKA 2R6NA 3N3GA 2DJFA 4QRGA 7PCKA 2DCDA 2DCBA 1DF0A 2R9NA 4WA6A 3HD3A 3H7DA 5JH3A 3OF8A 3OVXA 1KHQA 3V6EA 1MDWA 3K9MA 3OF9A 1HUCB 5K16A 2DC7A 4CDEA 2FO5A 2Y6EA 4P6GA 2E03A 1NB3A 1TLOA 1ME4A 1ME3A 2FRAA 3I3TA 3KX1A 4YVAA 4RY2A 3IUTA 1PE6A 4K7CA 1KXRA 5J94A 5CVMA 1TL9A 2XU3A 2XU5A 1YALA 1AYWA 1CS8A 4QRXA 1PCIA 4MZSA 1TU6A 2CIOA 1F29A 4X6IA 4YYQA
chains in the Genus database with same CATH superfamily
5A24A 2RTDB 1PVJA 5BVSA 3RKGA 1MDCA 1LKEA 4D8EA 3N4CA 4BX6B 2AF5A 3MORA 1SRHA 3HK1A 1ERBA 3DTQA 5EZQA 5JZEA 3CKGA 2IZGB 5B27A 1AVEA 2VFBA 1Y52X 2MJIA 2AUXA 5B5FA 4CDDA 2CZUA 3G7XA 3KSEA 3MTNA 1GX3A 1KT6A 4ZHFA 2J7QC 3CBJA 3B2LA 3AUMO 1PPOA 1AU3A 3STMX 1KHPA 1B4MA 1U17A 1ZRYA 1ZCMA 2L5PA 4BS5A 1GKAB 1QXPA 3TF6A 3QT4A 5L8NA 3FR4A 3H6SA 2HZRA 3OBLA 4XMEA 2IZFB 1GM6A 1EQDA 3CR6A 1PTSA 4YYSA 2OFRX 4IB9A 3LTWA 2KD2A 3NQ9A 2QO6A 1SWUA 4YYUA 1VJVA 4ON1A 4CV7A 2FR2A 1SWQA 3WXGA 1X8PA 4NLJA 3O1GA 3P5VA 2DOSA 4P16A 4IABA 4BOEA 5LJEA 1YZBA 3TNXA 2RTFB 5LJDA 1LDQA 4O3ZA 1AQBA 3VG4A 2IZCB 3I06A 2CM9A 3P5UA 1BJ7A 1H91A 2RTAA 2HD5A 1AU0A 5AJBA 4YBPA 2KTDA 2RA6A 2FRQA 2Q39A 1ICMA 2YMSA 4EKVA 1EI5A 4Z6JA 1T68X 1EXSA 1B56A 2RTGB 3PPTA 2JQFR 3VE1A 3CBSA 2R56A 1SXYA 3BCNA 3ELXA 3KKUA 4QQ1A 2ZAIA 1MIRA 2Q4NA 4QZUA 5B2AO 2G8CO 2ACTA 3OQCA 2E4JA 1AECA 5CHVA 1SWCA 2OL7A 4WBKA 3BOWA 4A1YA 5FQ7E 3FA9A 2R73A 2IZAA 5PADA 2ALLX 5AJCA 1DZPA 2NP1A 4YKMA 2JRIA 4AXLA 1B8EA 4XMGA 2CB5A 2OL8O 4N8WA 1OBQA 3GCBA 4BOQA 1BM5A 4XR7A 1SWOA 1SWKA 2DZYA 3V6CA 1CBSA 4I6SA 3B2JA 5FFHA 1DV9A 4PI3A 3U03A 4KT5A 1UREA 3OE3A 4NV8A 4C5PA 1PXVA 3VHHA 2NNEA 2W2FA 5CVNB 2FLJA 3C9EA 3D97A 3D4RA 2GTLM 3RY2A 3IFBA 1VWOB 2OZ2A 2C0YA 3C76X 2NQAA 2R9OA 2QOSC 3FIDA 1STPA 2QO4A 5L8OA 4MM3B 5HCCC 1Z24A 3MTVA 4Z2PA 5D4AA 3F75A 4BOSA 3ZW1A 4YYWA 4A8ZA 3T6FA 2DC9A 3WZOA 4PSQA 2C1SA 4OS3A 2G79A 3HWFA 1WUBA 5EPQA 4YVBA 4NP1A 4I9RA 2E01A 2OFMX 3APWA 4INNA 3PQUA 5L8IA 1NGLA 2LBAA 3ELZA 4M0WA 2OFBA 2AYOA 1DEUA 2Q2PA 5H9AA 4BOUA 1THEA 1MK5A 2Y5BA 3STKA 3FMZA 4MVEA 1KFFA 4M6SA 1FDQA 2PBHA 4CZWA 3O65A 2ZSCA 3U8EA 4YV8A 4IAWA 2RN4A 4PP1A 3BS2A 2RTKA 4FGIB 4DMXA 1FH0A 3C0RA 1PPNA 1PPPA 2RTPB 4RF0A 5EZSA 1L6MA 3FYFA 1GECE 1E2TA 4MZOA 3EC5A 4HFOA 2LFOA 4CPHA 1JMZA 1F2CA 4QGXA 3B21A 2RQ0A 2WBFX 5IRUA 2ARYA 1TVQA 5HA0A 4YCHA 1AYVA 1SWEA 5DPQA 4YFRA 1IKJA 4CDFB 5BVQA 3CBCA 2RTBB 1X9YA 5FENA 2OFAA 2X46A 1E02A 1S2PA 1QFVA 4R3DA 1KL4A 4D8BA 1S4VA 1FENA 3CQNA 2OY7A 1JIWI 3P6EA 2G8EA 3P02A 2A5BA 3SAOA 1QY1A 3X00A 3NADA 1G85A 1SWLA 4RKXA 7PCKA 2DCBA 5F2BA 4PT5A 4Y0QA 1VWNB 3HD3A 3OF8A 1I78A 4YBUA 5H9NA 5LJCA 1MX7A 3OF9A 2FWVA 1VWGB 4CDEA 2Y6EA 3RNVA 4EFGA 2Y3FA 1ML7A 4BJ8A 4MISA 2M4LA 4EDEA 4EEJA 4O4SA 3VG7A 4DQ4A 3QQ2A 1PE6A 2KT4B 2G5LA 3GAQA 1SWGA 2WQAE 5H9KA 3PP6A 3PECA 4QYPA 3OD9A 2AT0X 4MZSA 2IZLB 3VG6A 4AYHA 2FE8A 3UEUA 4KC8A 3H8CA 5EDBA 3PHUA 3WJEA 1ZNKA 2GHUA 1BSOA 3LHNA 1VWBB 4GKCA 1YT7A 1UYOX 4MSXA 4QZTA 1I9HA 3NX1A 4BGFA 2GTFX 3PT2A 3WJDA 1PEEA 4ZTBA 1W5RA 4NLIA 1Y0GA 3IMAA 4O3XB 1CBIA 1JMXA 1KT5A 1PPDA 3BB7A 3WJFA 3QSDA 1SWHA 1BEBA 2DJGA 4QRLA 1KFUL 4TQ2A 1OBUA 4QH6A 1EWOA 2AVIA 3FR2A 4KLBA 4HPDA 3O0UA 2H7JA 1MEMA 1Y08A 1VWFB 5JA7A 5CE4A 4MVKA 2G78A 3Q34A 3RDOA 2F1GA 4GGRA 3EM0A 4O4XA 2GTLO 2BDLA 3W30A 5L3YA 2OULA 2QO5A 4U8UO 3MHSA 1GCBA 1TOWA 1BBPA 1U5IA 1KQXA 3I0AA 2E00A 1GGLA 2OVSA 1AVDA 1KT3A 3DSZA 1ACDA 3P6HA 1STSB 1KFXL 2R9CA 1X89A 1MOYA 3FENA 3FW4A 3PSEA 2X32A 3JSQA 3CQRA 4QRVA 1P6PA 2AT8X 1FEMA 4IBAA 2FKJA 3ZW0B 1MUPA 3TMPA 1SRGA 1TW4A 2HXZA 2XU1A 2RD7C 1YWBA 2Z84A 3P24A 3S5XA 3FW5A 5LJGA 1MEPA 1EF7A 1SY0A 2FTBA 3MBTA 3S3RA 2AU1A 3ZUAA 3BPMA 1MEGA 1YP6A 1M6DA 5CSEA 3PRPA 2PADA 4BX6A 4LKPA 2JMBA 5EZ2A 2DJFB 4OKAA 1OPBA 4CDFA 4TJZA 4CDCB 2OY5O 3MVFA 2G7BA 5B3MO 3TZSA 1D2UA 1FE3A 4W4UA 5LJHA 4HWYA 1GT4A 1SXWA 2AT3X 3BWKA 4OEMA 4XMFA 1O8VA 4YYRA 4BSQA 2HNXA 4K19A 1HN2A 1ZNGA 3SOTA 2RTNB 3FA6A 3IFUA 5EF4A 1QDQA 4IP3A 5E6JA 3NQKA 1KT4A 1N7YA 3CH2X 1A3YA 1KGLA 3SLTA 5HAEA 1QY0A 4U8UM 1SY3A 4NNTA 2POAA 2ACOA 4O3YA 3ZI8A 4QGVA 1EWPA 2X8SA 3IHPA 1RSUB 1DZJA 1BP4A 3P5XA 4GK9A 4M7MA 5F02A 1K3BA 1G5WA 1ATKA 2JQGR 3AEHA 3S60A 1YUPA 3UEVA 1QWDA 3BU1A 2OZQA 4FIPA 5D45A 2XSTA 2OVAA 2WEWA 5FQ6E 2OVDA 2Z4HA 2KW1A 3HWDA 4ODDA 1JBHA 3IA8A 3VG3A 3IOQA 1SRIA 4ARHA 2G7YA 2XU4A 3O2YA 1PMPA 5B29A 4LKTA 1T8VA 4BCSA 3PRMA 1Y53X 3WXQA 5IO7A 1GLOA 2ACPX 5FQ8E 3RWXA 4N79A 1LUQA 1YK8A 4ALOA 2JU3A 2AL0X 1D3SA 1SLEB 4GNYA 4GU8A 2X4MA 3WJCA 2RTQB 3PH5A 3VGWA 3KZAA 4LQZA 1DF8A 5LKEA 5B5GA 4IMOA 3RVXA 2AMMX 2DM5A 3FEPA 4JO6A 4DMYA 1EWLA 3F8AA 1WBIA 3VPJE 1OPAA 4YH0A 2IZDB 4ORYA 3STNA 4BX5A 3LXSA 4ZGUA 1CB5A 2NQDB 1GX9A 3SZIA 2G8JA 3HTYA 4KCAA 3B2HA 2FGSA 1IIUA 3MG5A 2DCCA 5KICA 4BBOA 3QKGA 3LFYA 4I3BA 2FYEA 3WZNA 1NDJA 1U9VA 1HQQA 4IMNA 1MVGA 5FPWA 4QAEA 4I60A 2MM3A 2B1NA 1PBHA 1VWAB 3VG5A 4HPCA 2P8GA 5LJBA 2P86A 3MJ5A 3EBKA 1HBPA 1NQMA 1SWRA 2F01A 4IB7A 3PNRA 3NPOA 1LPJA 2FHLA 2WEXA 2HHNA 1EIIA 3PEDA 4BS6A 2C1QA 4OW0A 4GZVA 4IB8A 3SLJA 4BX7B 3APUA 3MHHA 4GUAA 2I5VO 4MIRA 4ES7A 2ATOA 4Y0SA 2IPPB 1MM9A 3SZHA 2OY1O 4ZHHA 2RTHB 2FTDA 1BY8A 3IV2A 3D96A 1CRBA 2GTLN 2RTJA 3BC3A 1DFVA 4YFPA 2R6NA 5C0NA 1AB0A 1VWJB 2IFBA 4UU2A 4B55A 3BSZE 2R9NA 4WA6A 3FIQA 2A2GA 1KHQA 3T2XA 1MDWA 3K9MA 1SWAA 5K16A 4KC7A 2CBRA 1CJ5A 3FA8A 5HZ8A 4BX7A 1TOUA 1B0OA 3KX1A 4LZUA 2LBVA 4YVAA 4ZHCA 3IUTA 3O19A 4K7CA 4CPFA 3ZWEA 3RY1A 1NBXA 4Z2VA 1N0SA 4NYQA 2AT6X 2XU3A 1GXAA 1S7DA 2A0AA 1SWPA 1LCWA 4QRXA 2CIOA 4U3QA 1F29A 2L68A 2IZIA 4O9SA 3D9WA 1Q6KA 3BBAA 1T0VA 3B2KA 3TGCA 4RNAA 2X34A 2FKGA 4PADA 1KT7A 4Y0PA 4WFVA 1SWTA 5HTEA 4WFUA 3HHAA 2QM9A 1MHWA 3W31A 3EBWA 2RTEB 2FS6A 3QJ3A 4IB6A 3TGAA 5EEDA 1CBQA 4HPAA 1QG5A 3S5VA 2F7DA 4ORUA 3P6CA 2FQ9A 2JU7A 4BOZA 2I5ZO 2L67A 1BQIA 1E00A 4ZR2A 2MO5A 4I95A 3WZPA 4BOPA 4BPVA 5KO3A 2F73A 3WJGA 4Y0RA 1ADLA 5HZ5A 2FRSA 4OVZA 1XKGA 2JW1A 2O6XA 4U8UN 1UZ2X 1LF7A 1GT3A 3PBHA 1X8UA 2A13A 1U0XA 2MF6A 4RUNA 1K24A 4OS0A 4TKBA 1NC9A 4FK5A 4TNNA 2PREA 4FBOA 1A57A 1STFE 1PBYA 1YP7A 2JN3A 2FT2A 3B2IA 5K67A 2E02A 3BLGA 5AQ6A 8PCHA 3P6GA 5B11O 1OSPO 2IZBA 2OF9A 4ALBA 1DKIA 3WJBA 3BY0A 3OVZA 4Y59A 2AYNA 1VWKB 1ICNA 5EEEA 4AZPA 3JS1A 3BU9A 1RAVA 1BRPA 4YFQA 4U9CA 4ZHGA 3AKMA 1U9QX 4TKJA 2RCTA 2OVEA 1YWCA 2B1MA 3RDMA 1AYUA 1BSQA 4AZQA 3U9PC 4I07A 1YWAA 3KFIA 2AGAA 1CTEA 4OMXA 1MX8A 1F2BA 1KL3A 1SLGB 3WOVA 2G6DA 1GMYA 3D6SA 3ZW0A 1VWIB 4FBRA 3HOEA 2YJ8A 3GE2A 1CVZA 2Y32A 1Y4HA 5B10O 4MVLA 1E06A 4GDZA 3ZZVA 1SREA 1QFTA 4YMYA 2NQGA 1SXXA 1JQPA 1VWMB 1FELA 1EW3A 1ZNDA 1OBPA 5HZQA 3MX7A 1EALA 1BGOA 1O0EA 1OEKA 1F2AA 2K62A 1AVGI 3RDXA 3VG2A 4ZGFA 3T2WA 4YCEA 4ML7B 4COTA 3FA7A 3AKNA 1W6FA 2W2BA 4KH8A 3PQSA 3CBKA 3KFQA 2JOZA 4XZXA 1EWMA 4EQAC 4PJ2A 1OEJA 2CAMA 4YKOA 1DZKA 1QQSA 1I4UA 4NW4A 3ZQ3A 4EXZA 3P5WA 2RCQA 3N3KA 1EPBA 4WHIA 3PK2A 4CPIA 4A5UA 3UEWA 1U9WA 4AW8A 3HWNA 2BHVA 2QMIA 1VYOA 3CKFA 4ZCBA 2BLGA 3EW2A 4Z27A 5BYPA 2OF8A 1YK7A 3B79A 3S3QA 1VPRA 1X71A 1EPAA 3AI8A 4QNIA 5D47A 2BU3A 3KVNA 5EDCA 2X45A 3T1DA 1SY2A 3UEXA 3NP1A 1KQWA 4JHQA 1HXLA 3LV4A 4XMDA 5D8JA 1N9MA 4HXDB 3KFGA 5CYBA 5HWZA 2YJCA 1O1VA 4AZOA 2YG2A 3RDUA 1LIDA 4CPHB 1IFBA 2UZJA 1SWDA 1SWBA 3RE5A 3WYQA 3KFFA 4W5CA 3BX7A 2MWHA 4N7CA 2BS6A 3K24A 2CBSA 3WZQA 1DZMA 4ORSA 1SXUA 1Y9LA 1YWDA 1JYJA 1N43A 4MVIA 4N4ZA 4ORRA 1BLRA 3PHWA 3ZUIA 4X6JA 4NV7A 1SLFB 2DC6A 4I05A 2Q2MA 2AUZA 1O1UA 1VYGA 1SA8A 2QOMA 4A1HA 3H89A 1NQCA 1CV8A 2AT5X 3MP2A 3WXFA 1K3BB 1RBPA 1LNMA 1SWJA 2LKKA 3HWEA 2HWKA 4QBBA 3FEKA 3O22A 4GH7A 1X8QA 2WSJA 3RSWA 4Z28A 1S44A 2PY1A 2GJ5A 4I9SA 1SLDB 3KFHA 5F1EA 1NQNA 3HHIA 4NNSA 1RXKA 3P6DA 3ZW1B 3JQOA 5LKFA 2HYSA 3FR5A 1VWCB 1BRQA 4D6BA 3U0DA 1MS6A 1SNKA 4BQUA 2DJFA 1HQPA 2HMBA 3VE2A 5CHKA 1XKIA 1DF0A 5JH3A 3H7DA 1KL5A 1BSYA 4L1NA 2VDFA 3EMMA 2FO5A 1I04A 3VHMA 2RTMA 2E03A 2C4IA 4YGZA 3UAQA 4ZHDA 1TLOA 1ME4A 1ME3A 4HPBA 4KIIA 1G7NA 2F09A 2FHNX 3MM0A 1FJ1E 4GGZA 4RY2A 5H9LA 1LIBA 2IZEB 1NP1A 1RXJA 1KXRA 5J94A 5CVMA 2HKDA 1SWFA 4CK4A 1TL9A 1IFCA 4JNJA 1OEEA 3BDRA 2N93A 2XU5A 3RBYA 3NX2A 1AYWA 1KOIA 4RF1A 2RTIB 4GETA 1PCIA 1TU6A 4GNWA 4IRWA 4WURA 4YYQA 2R9FA 2X56A 2P0RA 4DCBA 4GE1A 2AH7X 2A8GA 1GKAA 2AKQA 4N7DA 1POPA 4GRJA 3H3IA 2FUDA 1KXOA 5HA1A 2IZJA 5K06A 4AZMA 1VWHB 1KZWA 2BTWB 2BTWA 4AZNA 3APVA 2OL6O 2Q9SA 3F6ZB 5F58A 5AEOA 1NL6A 5CVOB 1XCAA 3KWBX 2QCBA 3RVVA 4ZH9A 2YJBA 4ORWA 5F6ZA 4TLJA 4JGLA 2DZZA 1VWEB 2NQIA 2Y3EA 3HPEA 1RLBE 1ITOA 2RTLA 3WYPA 2WUTA 4ORXA 3CH3X 4A60A 4IUMA 4BQVA 2AIMA 3OISA 1JJXA 3WXEA 4YGHA 4I04A 3KQ0A 4CSBA 4TKHA 2LB6A 3PH6A 4CDEB 5HCEC 1Y9TA 5D48A 5IO6A 1NPZA 2DJGB 4G54A 2UZ2A 2VHSA 2J7QA 2WQ9A 3NQ3A 2HLVA 4D8IA 4D6AA 2OYBO 3CWKA 4QYNA 5KIDA 6PADA 2GFOA 2ZAGA 4GUZA 5BVTA 3FELA 2IZHB 5IRWA 2NNQA 1ZNLA 1BWYA 3C78X 3WVMA 1YVBA 2WWPA 1E5PA 3N91A 4ZFXA 4X6HA 4AXMA 5H8TA 1JV4A 1A18A 1QY2A 2HH5A 2X8TA 2PNSA 3PW3A 2WPUA 5IRAA 2MHDA 1PIPA 1JJUA 2DC8A 1HY2A 3I17A 1U18A 1ERXA 1QOLA 1CPJA 5K68A 2JU8A 1SP4B 4GJVA 1PM1X 4FBVA 4O4UA 4FJCA 2GH7A 2Z4IA 1NB5A 3TGBA 3BX8A 3ZUOA 3F9DA 4PP2E 4FQBB 4OELA 3KWZA 3SLOA 3NBXX 1LICA 4RUUA 1IW2A 2AS8A 2A2UA 5IXGA 1I06A 3RDQA 1ZNEA 4GGTA 3TRKA 3K3LA 2GC9A 9PAPA 4I3DA 3E3CA 1DC9A 2OP3A 1EIOA 4DQ3A 5HBSA 4BX5B 4R0BA 4Z2OA 4GD9A 4IAXA 2IBIA 3NR3A 4LZVA 1VWDB 2DCAA 3FLLA 2O62A 4L3RA 3H8BA 2RTCB 5HZ9A 5JD2A 4CDCA 3FDCA 1LFOA 4CPEA 2YJ2A 4DNEA 3RVWA 4OVZB 1LELA 3ZW2A 1RXHA 1G74A 2R9MA 4CDDB 3IEJA 4YYVA 2FT9A 1CJLA 2XKLA 4HWMA 1UKFA 5LJKA 4OMWA 1QMYA 2RTRB 2FS7A 1QABE 3Q6LA 5F7GA 3T6LA 4AZRA 3P6FA 1HMRA 3WBGA 3C77X 1DF3A 3KW9A 1ZIVA 2CZTA 5F6BA 1A6RA 4GJSA 3USVA 1A2DA 4XMCA 1STRB 2CM4A 2BT9A 5KHPA 3V8UA 1LDOA 5FAZA 5JR8A 1U9XA 1RSTB 1HMSA 3S26A 1UYNX 1X8NA 2EU7X 4Q8HA 4ZJ0A 4YDAA 5EGWA 1CQDA 2BSZA 2W2AA 1CSBB 5CHTA 1N4JA 3RZYA 4NYRA 5HCDC 3BPFA 4BVMA 2ANSA 3E9SA 4REZA 2OY8A 1FTPA 1HXZA 2VFCA 1VWPB 4OS8A 3BRNA 1PBOA 2RTOB 1KZXA 4Y5DA 2K23A 3NHEA 2PI3O 1VWLB 3HWGA 3RE6A 4GDAA 3K8UA 1AU2A 1TXLA 2NNDA 1CBRA 1LIFA 2UYWA 1X8OA 1EUOA 3VU1A 1IWDA 5HZ6A 2JGSA 4U46A 2X55A 1GX8A 1PADA 1HBQA 3DF0A 2AVWA 1VSNA 3APXA 4Q8GA 2KTSA 1AU4A 4P6EA 2IZKA 3ERVA 3BY4A 1NLJA 1AIMA 3L4RA 3PDFA 5DG4A 1LCZA 5HTDA 2BDZA 3OJYC 2A5CA 2ASNX 4YDBA 1VYFA 1NP4A 3RDSA 1ALBA 2L9CA 2YJ9A 4YGGA 1HMTA 1IKEA 4ZH6A 3PHXA 4O3WA 4XUIA 3SZJA 4W5BA 4MI7A 1N9YA 2WR6A 2VHFA 1SWNA 1SRFA 3EYCA 1ICFA 2P7UA 1JZUA 3M99A 1I05A 1LCVA 3CMPA 1YIVA 1SWSA 2R74A 3F5VA 4ZUXU 1SY1A 1JYDA 3E1ZB 4QGWA 1VWQB 4I3CA 4UU3A 1W4TA 1R0UA 3N3GA 4QRGA 4ID2A 2DCDA 1LIEA 1SMPI 2BC3A 2FR3A 3HOLA 5IO5A 4XMHA 1SRJA 2A3FX 3OVXA 4O49A 3V6EA 3ZNHA 1Y55X 1HUCB 2DC7A 4P6GA 1NB3A 3VHIA 1VWRB 1ZNHA 4MEEA 3D95A 3EW1A 2FRAA 3I3TA 4O4OA 2JTCA 1GT1A 1GT5A 1AELA 1JJJA 1IJ8A 2X8FA 1YALA 1CS8A 2HZQA 2BS5A 2LA7A 4X6IA
chains in the Genus database with same CATH topology
2R9FA 2P0RA 5A24A 3D9WA 1Q6KA 3H8CA 3N4CA 3MORA 2GHUA 1POPA 4PADA 1YT7A 2FUDA 4MSXA 3HHAA 4BGFA 1MHWA 2VFBA 3QJ3A 1W5RA 3IMAA 2AUXA 4CDDA 3KSEA 3MTNA 1GX3A 2F7DA 1PPDA 3CBJA 3QSDA 2FQ9A 2DJGA 1KFUL 1NL6A 5CVOB 1PPOA 1AU3A 4QH6A 1KHPA 1EWOA 3KWBX 3RVVA 1BQIA 1ZCMA 4KLBA 2YJBA 3O0UA 4BS5A 2H7JA 4BPVA 1MEMA 1QXPA 2DZZA 1Y08A 3QT4A 2NQIA 5JA7A 3H6SA 1ITOA 3CH3X 4BQVA 2AIMA 3OISA 2F1GA 3WXEA 1XKGA 4YYSA 4I04A 2O6XA 2BDLA 2OULA 4CDEB 3LTWA 3MHSA 3PBHA 1GCBA 1U5IA 1NPZA 2DJGB 4YYUA 1VJVA 2E00A 4G54A 3WXGA 2VHSA 3O1GA 3P5VA 4FK5A 3TNXA 2PREA 6PADA 1STFE 2GFOA 4GUZA 1KFXL 2FT2A 2R9CA 2E02A 8PCHA 1YVBA 3I06A 3P5UA 4QRVA 4X6HA 4AXMA 3OVZA 2HD5A 1AU0A 2HH5A 2AYNA 2PNSA 3PW3A 2HXZA 1PIPA 2XU1A 2DC8A 2FRQA 1QOLA 1U9QX 1CPJA 2B1MA 1EF7A 2JQFR 1SP4B 4FJCA 3S3RA 1AYUA 2AU1A 3ZUAA 3BPMA 3BCNA 1MEGA 1M6DA 1NB5A 4I07A 2PADA 3KKUA 1CTEA 4PP2E 1MIRA 4OELA 2DJFB 3KWZA 1F2BA 4CDFA 2AS8A 2G6DA 4CDCB 2ACTA 1GMYA 1AECA 5CHVA 3D6SA 3BOWA 2YJ8A 1CVZA 4W4UA 5PADA 9PAPA 4HWYA 1Y4HA 2OP3A 4AXLA 3BWKA 4OEMA 2CB5A 4N8WA 3GCBA 2NQGA 1JQPA 4YYRA 4XR7A 4BSQA 2IBIA 2DZYA 2DCAA 3V6CA 5EF4A 1QDQA 3H8BA 4PI3A 3CH2X 1BGOA 1O0EA 4CDCA 2YJ2A 3RVWA 1F2AA 4NV8A 4C5PA 1PXVA 1EWPA 2R9MA 4CDDB 3IHPA 3IEJA 4YYVA 1CJLA 5CVNB 1BP4A 3C9EA 3P5XA 1QMYA 1W6FA 5F02A 1K3BA 3CBKA 3KFQA 1ATKA 2JQGR 4FIPA 1EWMA 2OZ2A 2C0YA 2NQAA 3P5WA 2R9OA 3N3KA 3IOQA 2G7YA 2XU4A 1U9WA 3KW9A 1ZIVA 1A6RA 3USVA 3HWNA 1GLOA 3F75A 4N79A 1YK8A 4YYWA 2DC9A 1YK7A 3B79A 3S3QA 3AI8A 1U9XA 2E01A 4Q8HA 5EGWA 1CQDA 3RVXA 2BSZA 4DMYA 1EWLA 2AYOA 1CSBB 1DEUA 5CHTA 2YJCA 3BPFA 3LXSA 1THEA 1CB5A 2NQDB 2Y5BA 2G8JA 2VFCA 2PBHA 4CZWA 3U8EA 4YV8A 2DCCA 3NHEA 3LFYA 4W5CA 2FYEA 4PP1A 3K8UA 4DMXA 1U9VA 1AU2A 1FH0A 3K24A 5FPWA 1PPNA 1IWDA 1PPPA 1PADA 1GECE 1E2TA 1PBHA 2B1NA 4MZOA 3DF0A 4N4ZA 2AVWA 1VSNA 4Q8GA 1AU4A 4P6EA 4X6JA 3ERVA 4NV7A 2P86A 1NLJA 2DC6A 4I05A 1F2CA 1AIMA 2AUZA 3PDFA 3PNRA 2BDZA 2HHNA 2WBFX 3H89A 1NQCA 4BS6A 2ARYA 1CV8A 1AYVA 3WXFA 1K3BB 2YJ9A 4CDFB 3MHHA 4QBBA 1X9YA 4XUIA 4W5BA 2VHFA 1ICFA 2P7UA 3M99A 2ATOA 2IPPB 1S4VA 2FTDA 1BY8A 3F5VA 4ZUXU 3IV2A 3HHIA 3E1ZB 2G8EA 3BC3A 1MS6A 1SNKA 2R6NA 1W4TA 3N3GA 2DJFA 4QRGA 7PCKA 4B55A 2DCDA 2DCBA 1DF0A 2R9NA 4WA6A 3HD3A 3H7DA 5JH3A 3OF8A 3OVXA 1KHQA 3V6EA 1MDWA 3K9MA 3OF9A 1HUCB 5K16A 2DC7A 4CDEA 2FO5A 2Y6EA 4P6GA 2E03A 1NB3A 1TLOA 1ME4A 1ME3A 2FRAA 3I3TA 3KX1A 4YVAA 4RY2A 3IUTA 1PE6A 4K7CA 1KXRA 5J94A 5CVMA 1TL9A 2XU3A 2XU5A 1YALA 1AYWA 1CS8A 4QRXA 1PCIA 4MZSA 1TU6A 2CIOA 1F29A 4X6IA 4YYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9F A;  2P0R A;  5A24 A;  1Q6K A;  3H8C A;  3N4C A;  3MOR A;  2GHU A;  1POP A;  4PAD A;  1YT7 A;  2FUD A;  4MSX A;  3HHA A;  1MHW A;  3QJ3 A;  3IMA A;  2AUX A;  4CDD A;  3KSE A;  3MTN A;  2F7D A;  1PPD A;  3CBJ A;  3QSD A;  2FQ9 A;  2DJG A;  1KFU L;  1NL6 A;  5CVO B;  1PPO A;  1AU3 A;  4QH6 A;  1KHP A;  1EWO A;  3KWB X;  3RVV A;  1BQI A;  1ZCM A;  4KLB A;  2YJB A;  3O0U A;  4BS5 A;  2H7J A;  4BPV A;  1MEM A;  1QXP A;  2DZZ A;  1Y08 A;  3QT4 A;  2NQI A;  5JA7 A;  3H6S A;  1ITO A;  3CH3 X;  4BQV A;  2AIM A;  3OIS A;  2F1G A;  3WXE A;  1XKG A;  4YYS A;  4I04 A;  2O6X A;  2BDL A;  2OUL A;  4CDE B;  3MHS A;  3PBH A;  1GCB A;  1U5I A;  1NPZ A;  2DJG B;  4YYU A;  1VJV A;  2E00 A;  4G54 A;  3WXG A;  2VHS A;  3O1G A;  3P5V A;  4FK5 A;  3TNX A;  2PRE A;  6PAD A;  1STF E;  2GFO A;  1KFX L;  2FT2 A;  2R9C A;  2E02 A;  8PCH A;  1YVB A;  3I06 A;  3P5U A;  4QRV A;  4X6H A;  4AXM A;  3OVZ A;  2HD5 A;  1AU0 A;  2HH5 A;  2AYN A;  2PNS A;  3PW3 A;  2HXZ A;  1PIP A;  2XU1 A;  2DC8 A;  2FRQ A;  1QOL A;  1U9Q X;  1CPJ A;  2B1M A;  1EF7 A;  2JQF R;  1SP4 B;  4FJC A;  3S3R A;  1AYU A;  2AU1 A;  3ZUA A;  3BPM A;  3BCN A;  1MEG A;  1M6D A;  1NB5 A;  4I07 A;  2PAD A;  3KKU A;  1CTE A;  4PP2 E;  1MIR A;  4OEL A;  2DJF B;  3KWZ A;  1F2B A;  4CDF A;  2AS8 A;  2G6D A;  4CDC B;  2ACT A;  1GMY A;  1AEC A;  5CHV A;  3D6S A;  3BOW A;  2YJ8 A;  1CVZ A;  5PAD A;  4W4U A;  9PAP A;  4HWY A;  1Y4H A;  2OP3 A;  4AXL A;  3BWK A;  4OEM A;  2CB5 A;  4N8W A;  3GCB A;  2NQG A;  1JQP A;  4YYR A;  4XR7 A;  4BSQ A;  2IBI A;  2DZY A;  2DCA A;  3V6C A;  5EF4 A;  1QDQ A;  3H8B A;  4PI3 A;  3CH2 X;  1BGO A;  1O0E A;  4CDC A;  2YJ2 A;  3RVW A;  1F2A A;  1PXV A;  1EWP A;  2R9M A;  4CDD B;  3IHP A;  3IEJ A;  4YYV A;  1CJL A;  5CVN B;  1BP4 A;  3C9E A;  3P5X A;  1QMY A;  5F02 A;  1K3B A;  3CBK A;  3KFQ A;  1ATK A;  2JQG R;  4FIP A;  1EWM A;  2OZ2 A;  2C0Y A;  2NQA A;  3P5W A;  2R9O A;  3N3K A;  3IOQ A;  2G7Y A;  2XU4 A;  1U9W A;  3KW9 A;  1ZIV A;  1A6R A;  3USV A;  3HWN A;  1GLO A;  3F75 A;  4N79 A;  1YK8 A;  4YYW A;  2DC9 A;  1YK7 A;  3B79 A;  3S3Q A;  3AI8 A;  1U9X A;  2E01 A;  4Q8H A;  5EGW A;  1CQD A;  3RVX A;  4DMY A;  1EWL A;  2AYO A;  1CSB B;  1DEU A;  5CHT A;  2YJC A;  3BPF A;  3LXS A;  1THE A;  1CB5 A;  2NQD B;  2Y5B A;  2G8J A;  2PBH A;  4CZW A;  3U8E A;  4YV8 A;  2DCC A;  3NHE A;  3LFY A;  4W5C A;  2FYE A;  4PP1 A;  3K8U A;  4DMX A;  1U9V A;  1AU2 A;  1FH0 A;  3K24 A;  5FPW A;  1PPN A;  1IWD A;  1PPP A;  1PAD A;  1GEC E;  1PBH A;  2B1N A;  4MZO A;  3DF0 A;  2AVW A;  4N4Z A;  1VSN A;  4Q8G A;  1AU4 A;  4P6E A;  4X6J A;  3ERV A;  2P86 A;  1NLJ A;  2DC6 A;  4I05 A;  1F2C A;  1AIM A;  2AUZ A;  3PDF A;  3PNR A;  2BDZ A;  2HHN A;  2WBF X;  3H89 A;  1NQC A;  4BS6 A;  2ARY A;  1CV8 A;  1AYV A;  3WXF A;  1K3B B;  2YJ9 A;  4CDF B;  3MHH A;  4QBB A;  1X9Y A;  4XUI A;  4W5B A;  2VHF A;  1ICF A;  2P7U A;  3M99 A;  2ATO A;  2IPP B;  1S4V A;  2FTD A;  1BY8 A;  3F5V A;  4ZUX U;  3IV2 A;  3HHI A;  3E1Z B;  2G8E A;  3BC3 A;  1MS6 A;  1SNK A;  2R6N A;  3N3G A;  2DJF A;  4QRG A;  7PCK A;  2DCD A;  2DCB A;  1DF0 A;  2R9N A;  4WA6 A;  3HD3 A;  3H7D A;  5JH3 A;  3OF8 A;  3OVX A;  1KHQ A;  3V6E A;  1MDW A;  3K9M A;  3OF9 A;  1HUC B;  5K16 A;  2DC7 A;  4CDE A;  2FO5 A;  2Y6E A;  4P6G A;  2E03 A;  1NB3 A;  1TLO A;  1ME4 A;  1ME3 A;  2FRA A;  3I3T A;  3KX1 A;  4YVA A;  4RY2 A;  3IUT A;  1PE6 A;  4K7C A;  1KXR A;  5J94 A;  5CVM A;  1TL9 A;  2XU3 A;  2XU5 A;  1YAL A;  1AYW A;  1CS8 A;  4QRX A;  1PCI A;  4MZS A;  1TU6 A;  2CIO A;  1F29 A;  4X6I A;  4YYQ A; 
#chains in the Genus database with same CATH topology
 5A24 A;  2RTD B;  1PVJ A;  5BVS A;  3RKG A;  1MDC A;  1LKE A;  4D8E A;  3N4C A;  4BX6 B;  2AF5 A;  3MOR A;  1SRH A;  3HK1 A;  1ERB A;  3DTQ A;  5EZQ A;  5JZE A;  3CKG A;  2IZG B;  5B27 A;  1AVE A;  2VFB A;  1Y52 X;  2MJI A;  2AUX A;  5B5F A;  4CDD A;  2CZU A;  3G7X A;  3KSE A;  3MTN A;  1GX3 A;  1KT6 A;  4ZHF A;  2J7Q C;  3CBJ A;  3B2L A;  3AUM O;  1PPO A;  1AU3 A;  3STM X;  1KHP A;  1B4M A;  1U17 A;  1ZRY A;  1ZCM A;  2L5P A;  4BS5 A;  1GKA B;  1QXP A;  3TF6 A;  3QT4 A;  5L8N A;  3FR4 A;  3H6S A;  2HZR A;  3OBL A;  4XME A;  2IZF B;  1GM6 A;  1EQD A;  3CR6 A;  1PTS A;  4YYS A;  2OFR X;  4IB9 A;  3LTW A;  2KD2 A;  3NQ9 A;  2QO6 A;  1SWU A;  4YYU A;  1VJV A;  4ON1 A;  4CV7 A;  2FR2 A;  1SWQ A;  3WXG A;  1X8P A;  4NLJ A;  3O1G A;  3P5V A;  2DOS A;  4P16 A;  4IAB A;  4BOE A;  5LJE A;  1YZB A;  3TNX A;  2RTF B;  5LJD A;  1LDQ A;  4O3Z A;  1AQB A;  3VG4 A;  2IZC B;  3I06 A;  2CM9 A;  3P5U A;  1BJ7 A;  1H91 A;  2RTA A;  2HD5 A;  1AU0 A;  5AJB A;  4YBP A;  2KTD A;  2RA6 A;  2FRQ A;  2Q39 A;  1ICM A;  2YMS A;  4EKV A;  1EI5 A;  4Z6J A;  1T68 X;  1EXS A;  1B56 A;  2RTG B;  3PPT A;  2JQF R;  3VE1 A;  3CBS A;  2R56 A;  1SXY A;  3BCN A;  3ELX A;  3KKU A;  4QQ1 A;  2ZAI A;  1MIR A;  2Q4N A;  4QZU A;  5B2A O;  2G8C O;  2ACT A;  3OQC A;  2E4J A;  1AEC A;  5CHV A;  1SWC A;  2OL7 A;  4WBK A;  3BOW A;  4A1Y A;  5FQ7 E;  3FA9 A;  2R73 A;  2IZA A;  5PAD A;  2ALL X;  5AJC A;  1DZP A;  2NP1 A;  4YKM A;  2JRI A;  4AXL A;  1B8E A;  4XMG A;  2CB5 A;  2OL8 O;  4N8W A;  1OBQ A;  3GCB A;  4BOQ A;  1BM5 A;  4XR7 A;  1SWO A;  1SWK A;  2DZY A;  3V6C A;  1CBS A;  4I6S A;  3B2J A;  5FFH A;  1DV9 A;  4PI3 A;  3U03 A;  4KT5 A;  1URE A;  3OE3 A;  4NV8 A;  4C5P A;  1PXV A;  3VHH A;  2NNE A;  2W2F A;  5CVN B;  2FLJ A;  3C9E A;  3D97 A;  3D4R A;  2GTL M;  3RY2 A;  3IFB A;  1VWO B;  2OZ2 A;  2C0Y A;  3C76 X;  2NQA A;  2R9O A;  2QOS C;  3FID A;  1STP A;  2QO4 A;  5L8O A;  4MM3 B;  5HCC C;  1Z24 A;  3MTV A;  4Z2P A;  5D4A A;  3F75 A;  4BOS A;  3ZW1 A;  4YYW A;  4A8Z A;  3T6F A;  2DC9 A;  3WZO A;  4PSQ A;  2C1S A;  4OS3 A;  2G79 A;  3HWF A;  1WUB A;  5EPQ A;  4YVB A;  4NP1 A;  4I9R A;  2E01 A;  2OFM X;  3APW A;  4INN A;  3PQU A;  5L8I A;  1NGL A;  2LBA A;  3ELZ A;  4M0W A;  2OFB A;  2AYO A;  1DEU A;  2Q2P A;  5H9A A;  4BOU A;  1THE A;  1MK5 A;  2Y5B A;  3STK A;  3FMZ A;  4MVE A;  1KFF A;  4M6S A;  1FDQ A;  2PBH A;  4CZW A;  3O65 A;  2ZSC A;  3U8E A;  4YV8 A;  4IAW A;  2RN4 A;  4PP1 A;  3BS2 A;  2RTK A;  4FGI B;  4DMX A;  1FH0 A;  3C0R A;  1PPN A;  1PPP A;  2RTP B;  4RF0 A;  5EZS A;  1L6M A;  3FYF A;  1GEC E;  1E2T A;  4MZO A;  3EC5 A;  4HFO A;  2LFO A;  4CPH A;  1JMZ A;  1F2C A;  4QGX A;  3B21 A;  2RQ0 A;  2WBF X;  5IRU A;  2ARY A;  1TVQ A;  5HA0 A;  4YCH A;  1AYV A;  1SWE A;  5DPQ A;  4YFR A;  1IKJ A;  4CDF B;  5BVQ A;  3CBC A;  2RTB B;  1X9Y A;  5FEN A;  2OFA A;  2X46 A;  1E02 A;  1S2P A;  1QFV A;  4R3D A;  1KL4 A;  4D8B A;  1S4V A;  1FEN A;  3CQN A;  2OY7 A;  1JIW I;  3P6E A;  2G8E A;  3P02 A;  2A5B A;  3SAO A;  1QY1 A;  3X00 A;  3NAD A;  1G85 A;  1SWL A;  4RKX A;  7PCK A;  2DCB A;  5F2B A;  4PT5 A;  4Y0Q A;  1VWN B;  3HD3 A;  3OF8 A;  1I78 A;  4YBU A;  5H9N A;  5LJC A;  1MX7 A;  3OF9 A;  2FWV A;  1VWG B;  4CDE A;  2Y6E A;  3RNV A;  4EFG A;  2Y3F A;  1ML7 A;  4BJ8 A;  4MIS A;  2M4L A;  4EDE A;  4EEJ A;  4O4S A;  3VG7 A;  4DQ4 A;  3QQ2 A;  1PE6 A;  2KT4 B;  2G5L A;  3GAQ A;  1SWG A;  2WQA E;  5H9K A;  3PP6 A;  3PEC A;  4QYP A;  3OD9 A;  2AT0 X;  4MZS A;  2IZL B;  3VG6 A;  4AYH A;  2FE8 A;  3UEU A;  4KC8 A;  3H8C A;  5EDB A;  3PHU A;  3WJE A;  1ZNK A;  2GHU A;  1BSO A;  3LHN A;  1VWB B;  4GKC A;  1YT7 A;  1UYO X;  4MSX A;  4QZT A;  1I9H A;  3NX1 A;  4BGF A;  2GTF X;  3PT2 A;  3WJD A;  1PEE A;  4ZTB A;  1W5R A;  4NLI A;  1Y0G A;  3IMA A;  4O3X B;  1CBI A;  1JMX A;  1KT5 A;  1PPD A;  3BB7 A;  3WJF A;  3QSD A;  1SWH A;  1BEB A;  2DJG A;  4QRL A;  1KFU L;  4TQ2 A;  1OBU A;  4QH6 A;  1EWO A;  2AVI A;  3FR2 A;  4KLB A;  4HPD A;  3O0U A;  2H7J A;  1MEM A;  1Y08 A;  1VWF B;  5JA7 A;  5CE4 A;  4MVK A;  2G78 A;  3Q34 A;  3RDO A;  2F1G A;  4GGR A;  3EM0 A;  4O4X A;  2GTL O;  2BDL A;  3W30 A;  5L3Y A;  2OUL A;  2QO5 A;  4U8U O;  3MHS A;  1GCB A;  1TOW A;  1BBP A;  1U5I A;  1KQX A;  3I0A A;  2E00 A;  1GGL A;  2OVS A;  1AVD A;  1KT3 A;  3DSZ A;  1ACD A;  3P6H A;  1STS B;  1KFX L;  2R9C A;  1X89 A;  1MOY A;  3FEN A;  3FW4 A;  3PSE A;  2X32 A;  3JSQ A;  3CQR A;  4QRV A;  1P6P A;  2AT8 X;  1FEM A;  4IBA A;  2FKJ A;  3ZW0 B;  1MUP A;  3TMP A;  1SRG A;  1TW4 A;  2HXZ A;  2XU1 A;  2RD7 C;  1YWB A;  2Z84 A;  3P24 A;  3S5X A;  3FW5 A;  5LJG A;  1MEP A;  1EF7 A;  1SY0 A;  2FTB A;  3MBT A;  3S3R A;  2AU1 A;  3ZUA A;  3BPM A;  1MEG A;  1YP6 A;  1M6D A;  5CSE A;  3PRP A;  2PAD A;  4BX6 A;  4LKP A;  2JMB A;  5EZ2 A;  2DJF B;  4OKA A;  1OPB A;  4CDF A;  4TJZ A;  4CDC B;  2OY5 O;  3MVF A;  2G7B A;  5B3M O;  3TZS A;  1D2U A;  1FE3 A;  4W4U A;  5LJH A;  4HWY A;  1GT4 A;  1SXW A;  2AT3 X;  3BWK A;  4OEM A;  4XMF A;  1O8V A;  4YYR A;  4BSQ A;  2HNX A;  4K19 A;  1HN2 A;  1ZNG A;  3SOT A;  2RTN B;  3FA6 A;  3IFU A;  5EF4 A;  1QDQ A;  4IP3 A;  5E6J A;  3NQK A;  1KT4 A;  1N7Y A;  3CH2 X;  1A3Y A;  1KGL A;  3SLT A;  5HAE A;  1QY0 A;  4U8U M;  1SY3 A;  4NNT A;  2POA A;  2ACO A;  4O3Y A;  3ZI8 A;  4QGV A;  1EWP A;  2X8S A;  3IHP A;  1RSU B;  1DZJ A;  1BP4 A;  3P5X A;  4GK9 A;  4M7M A;  5F02 A;  1K3B A;  1G5W A;  1ATK A;  2JQG R;  3AEH A;  3S60 A;  1YUP A;  3UEV A;  1QWD A;  3BU1 A;  2OZQ A;  4FIP A;  5D45 A;  2XST A;  2OVA A;  2WEW A;  5FQ6 E;  2OVD A;  2Z4H A;  2KW1 A;  3HWD A;  4ODD A;  1JBH A;  3IA8 A;  3VG3 A;  3IOQ A;  1SRI A;  4ARH A;  2G7Y A;  2XU4 A;  3O2Y A;  1PMP A;  5B29 A;  4LKT A;  1T8V A;  4BCS A;  3PRM A;  1Y53 X;  3WXQ A;  5IO7 A;  1GLO A;  2ACP X;  5FQ8 E;  3RWX A;  4N79 A;  1LUQ A;  1YK8 A;  4ALO A;  2JU3 A;  2AL0 X;  1D3S A;  1SLE B;  4GNY A;  4GU8 A;  2X4M A;  3WJC A;  2RTQ B;  3PH5 A;  3VGW A;  3KZA A;  4LQZ A;  1DF8 A;  5LKE A;  5B5G A;  4IMO A;  3RVX A;  2AMM X;  2DM5 A;  3FEP A;  4JO6 A;  4DMY A;  1EWL A;  3F8A A;  1WBI A;  3VPJ E;  1OPA A;  4YH0 A;  2IZD B;  4ORY A;  3STN A;  4BX5 A;  3LXS A;  4ZGU A;  1CB5 A;  2NQD B;  1GX9 A;  3SZI A;  2G8J A;  3HTY A;  4KCA A;  3B2H A;  2FGS A;  1IIU A;  3MG5 A;  2DCC A;  5KIC A;  4BBO A;  3QKG A;  3LFY A;  4I3B A;  2FYE A;  3WZN A;  1NDJ A;  1U9V A;  1HQQ A;  4IMN A;  1MVG A;  5FPW A;  4QAE A;  4I60 A;  2MM3 A;  2B1N A;  1PBH A;  1VWA B;  3VG5 A;  4HPC A;  2P8G A;  5LJB A;  2P86 A;  3MJ5 A;  3EBK A;  1HBP A;  1NQM A;  1SWR A;  2F01 A;  4IB7 A;  3PNR A;  3NPO A;  1LPJ A;  2FHL A;  2WEX A;  2HHN A;  1EII A;  3PED A;  4BS6 A;  2C1Q A;  4OW0 A;  4GZV A;  4IB8 A;  3SLJ A;  4BX7 B;  3APU A;  3MHH A;  4GUA A;  2I5V O;  4MIR A;  4ES7 A;  2ATO A;  4Y0S A;  2IPP B;  1MM9 A;  3SZH A;  2OY1 O;  4ZHH A;  2RTH B;  2FTD A;  1BY8 A;  3IV2 A;  3D96 A;  1CRB A;  2GTL N;  2RTJ A;  3BC3 A;  1DFV A;  4YFP A;  2R6N A;  5C0N A;  1AB0 A;  1VWJ B;  2IFB A;  4UU2 A;  4B55 A;  3BSZ E;  2R9N A;  4WA6 A;  3FIQ A;  2A2G A;  1KHQ A;  3T2X A;  1MDW A;  3K9M A;  1SWA A;  5K16 A;  4KC7 A;  2CBR A;  1CJ5 A;  3FA8 A;  5HZ8 A;  4BX7 A;  1TOU A;  1B0O A;  3KX1 A;  4LZU A;  2LBV A;  4YVA A;  4ZHC A;  3IUT A;  3O19 A;  4K7C A;  4CPF A;  3ZWE A;  3RY1 A;  1NBX A;  4Z2V A;  1N0S A;  4NYQ A;  2AT6 X;  2XU3 A;  1GXA A;  1S7D A;  2A0A A;  1SWP A;  1LCW A;  4QRX A;  2CIO A;  4U3Q A;  1F29 A;  2L68 A;  2IZI A;  4O9S A;  3D9W A;  1Q6K A;  3BBA A;  1T0V A;  3B2K A;  3TGC A;  4RNA A;  2X34 A;  2FKG A;  4PAD A;  1KT7 A;  4Y0P A;  4WFV A;  1SWT A;  5HTE A;  4WFU A;  3HHA A;  2QM9 A;  1MHW A;  3W31 A;  3EBW A;  2RTE B;  2FS6 A;  3QJ3 A;  4IB6 A;  3TGA A;  5EED A;  1CBQ A;  4HPA A;  1QG5 A;  3S5V A;  2F7D A;  4ORU A;  3P6C A;  2FQ9 A;  2JU7 A;  4BOZ A;  2I5Z O;  2L67 A;  1BQI A;  1E00 A;  4ZR2 A;  2MO5 A;  4I95 A;  3WZP A;  4BOP A;  4BPV A;  5KO3 A;  2F73 A;  3WJG A;  4Y0R A;  1ADL A;  5HZ5 A;  2FRS A;  4OVZ A;  1XKG A;  2JW1 A;  2O6X A;  4U8U N;  1UZ2 X;  1LF7 A;  1GT3 A;  3PBH A;  1X8U A;  2A13 A;  1U0X A;  2MF6 A;  4RUN A;  1K24 A;  4OS0 A;  4TKB A;  1NC9 A;  4FK5 A;  4TNN A;  2PRE A;  4FBO A;  1A57 A;  1STF E;  1PBY A;  1YP7 A;  2JN3 A;  2FT2 A;  3B2I A;  5K67 A;  2E02 A;  3BLG A;  5AQ6 A;  8PCH A;  3P6G A;  5B11 O;  1OSP O;  2IZB A;  2OF9 A;  4ALB A;  1DKI A;  3WJB A;  3BY0 A;  3OVZ A;  4Y59 A;  2AYN A;  1VWK B;  1ICN A;  5EEE A;  4AZP A;  3JS1 A;  3BU9 A;  1RAV A;  1BRP A;  4YFQ A;  4U9C A;  4ZHG A;  3AKM A;  1U9Q X;  4TKJ A;  2RCT A;  2OVE A;  1YWC A;  2B1M A;  3RDM A;  1AYU A;  1BSQ A;  4AZQ A;  3U9P C;  4I07 A;  1YWA A;  3KFI A;  2AGA A;  1CTE A;  4OMX A;  1MX8 A;  1F2B A;  1KL3 A;  1SLG B;  3WOV A;  2G6D A;  1GMY A;  3D6S A;  3ZW0 A;  1VWI B;  4FBR A;  3HOE A;  2YJ8 A;  3GE2 A;  1CVZ A;  2Y32 A;  1Y4H A;  5B10 O;  4MVL A;  1E06 A;  4GDZ A;  3ZZV A;  1SRE A;  1QFT A;  4YMY A;  2NQG A;  1SXX A;  1JQP A;  1VWM B;  1FEL A;  1EW3 A;  1ZND A;  1OBP A;  5HZQ A;  3MX7 A;  1EAL A;  1BGO A;  1O0E A;  1OEK A;  1F2A A;  2K62 A;  1AVG I;  3RDX A;  3VG2 A;  4ZGF A;  3T2W A;  4YCE A;  4ML7 B;  4COT A;  3FA7 A;  3AKN A;  1W6F A;  2W2B A;  4KH8 A;  3PQS A;  3CBK A;  3KFQ A;  2JOZ A;  4XZX A;  1EWM A;  4EQA C;  4PJ2 A;  1OEJ A;  2CAM A;  4YKO A;  1DZK A;  1QQS A;  1I4U A;  4NW4 A;  3ZQ3 A;  4EXZ A;  3P5W A;  2RCQ A;  3N3K A;  1EPB A;  4WHI A;  3PK2 A;  4CPI A;  4A5U A;  3UEW A;  1U9W A;  4AW8 A;  3HWN A;  2BHV A;  2QMI A;  1VYO A;  3CKF A;  4ZCB A;  2BLG A;  3EW2 A;  4Z27 A;  5BYP A;  2OF8 A;  1YK7 A;  3B79 A;  3S3Q A;  1VPR A;  1X71 A;  1EPA A;  3AI8 A;  4QNI A;  5D47 A;  2BU3 A;  3KVN A;  5EDC A;  2X45 A;  3T1D A;  1SY2 A;  3UEX A;  3NP1 A;  1KQW A;  4JHQ A;  1HXL A;  3LV4 A;  4XMD A;  5D8J A;  1N9M A;  4HXD B;  3KFG A;  5CYB A;  5HWZ A;  2YJC A;  1O1V A;  4AZO A;  2YG2 A;  3RDU A;  1LID A;  4CPH B;  1IFB A;  2UZJ A;  1SWD A;  1SWB A;  3RE5 A;  3WYQ A;  3KFF A;  4W5C A;  3BX7 A;  2MWH A;  4N7C A;  2BS6 A;  3K24 A;  2CBS A;  3WZQ A;  1DZM A;  4ORS A;  1SXU A;  1Y9L A;  1YWD A;  1JYJ A;  1N43 A;  4MVI A;  4N4Z A;  4ORR A;  1BLR A;  3PHW A;  3ZUI A;  4X6J A;  4NV7 A;  1SLF B;  2DC6 A;  4I05 A;  2Q2M A;  2AUZ A;  1O1U A;  1VYG A;  1SA8 A;  2QOM A;  4A1H A;  3H89 A;  1NQC A;  1CV8 A;  2AT5 X;  3MP2 A;  3WXF A;  1K3B B;  1RBP A;  1LNM A;  1SWJ A;  2LKK A;  3HWE A;  2HWK A;  4QBB A;  3FEK A;  3O22 A;  4GH7 A;  1X8Q A;  2WSJ A;  3RSW A;  4Z28 A;  1S44 A;  2PY1 A;  2GJ5 A;  4I9S A;  1SLD B;  3KFH A;  5F1E A;  1NQN A;  3HHI A;  4NNS A;  1RXK A;  3P6D A;  3ZW1 B;  3JQO A;  5LKF A;  2HYS A;  3FR5 A;  1VWC B;  1BRQ A;  4D6B A;  3U0D A;  1MS6 A;  1SNK A;  4BQU A;  2DJF A;  1HQP A;  2HMB A;  3VE2 A;  5CHK A;  1XKI A;  1DF0 A;  5JH3 A;  3H7D A;  1KL5 A;  1BSY A;  4L1N A;  2VDF A;  3EMM A;  2FO5 A;  1I04 A;  3VHM A;  2RTM A;  2E03 A;  2C4I A;  4YGZ A;  3UAQ A;  4ZHD A;  1TLO A;  1ME4 A;  1ME3 A;  4HPB A;  4KII A;  1G7N A;  2F09 A;  2FHN X;  3MM0 A;  1FJ1 E;  4GGZ A;  4RY2 A;  5H9L A;  1LIB A;  2IZE B;  1NP1 A;  1RXJ A;  1KXR A;  5J94 A;  5CVM A;  2HKD A;  1SWF A;  4CK4 A;  1TL9 A;  1IFC A;  4JNJ A;  1OEE A;  3BDR A;  2N93 A;  2XU5 A;  3RBY A;  3NX2 A;  1AYW A;  1KOI A;  4RF1 A;  2RTI B;  4GET A;  1PCI A;  1TU6 A;  4GNW A;  4IRW A;  4WUR A;  4YYQ A;  2R9F A;  2X56 A;  2P0R A;  4DCB A;  4GE1 A;  2AH7 X;  2A8G A;  1GKA A;  2AKQ A;  4N7D A;  1POP A;  4GRJ A;  3H3I A;  2FUD A;  1KXO A;  5HA1 A;  2IZJ A;  5K06 A;  4AZM A;  1VWH B;  1KZW A;  2BTW B;  2BTW A;  4AZN A;  3APV A;  2OL6 O;  2Q9S A;  3F6Z B;  5F58 A;  5AEO A;  1NL6 A;  5CVO B;  1XCA A;  3KWB X;  2QCB A;  3RVV A;  4ZH9 A;  2YJB A;  4ORW A;  5F6Z A;  4TLJ A;  4JGL A;  2DZZ A;  1VWE B;  2NQI A;  2Y3E A;  3HPE A;  1RLB E;  1ITO A;  2RTL A;  3WYP A;  2WUT A;  4ORX A;  3CH3 X;  4A60 A;  4IUM A;  4BQV A;  2AIM A;  3OIS A;  1JJX A;  3WXE A;  4YGH A;  4I04 A;  3KQ0 A;  4CSB A;  4TKH A;  2LB6 A;  3PH6 A;  4CDE B;  5HCE C;  1Y9T A;  5D48 A;  5IO6 A;  1NPZ A;  2DJG B;  4G54 A;  2UZ2 A;  2VHS A;  2J7Q A;  2WQ9 A;  3NQ3 A;  2HLV A;  4D8I A;  4D6A A;  2OYB O;  3CWK A;  4QYN A;  5KID A;  6PAD A;  2GFO A;  2ZAG A;  4GUZ A;  5BVT A;  3FEL A;  2IZH B;  5IRW A;  2NNQ A;  1ZNL A;  1BWY A;  3C78 X;  3WVM A;  1YVB A;  2WWP A;  1E5P A;  3N91 A;  4ZFX A;  4X6H A;  4AXM A;  5H8T A;  1JV4 A;  1A18 A;  1QY2 A;  2HH5 A;  2X8T A;  2PNS A;  3PW3 A;  2WPU A;  5IRA A;  2MHD A;  1PIP A;  1JJU A;  2DC8 A;  1HY2 A;  3I17 A;  1U18 A;  1ERX A;  1QOL A;  1CPJ A;  5K68 A;  2JU8 A;  1SP4 B;  4GJV A;  1PM1 X;  4FBV A;  4O4U A;  4FJC A;  2GH7 A;  2Z4I A;  1NB5 A;  3TGB A;  3BX8 A;  3ZUO A;  3F9D A;  4PP2 E;  4FQB B;  4OEL A;  3KWZ A;  3SLO A;  3NBX X;  1LIC A;  4RUU A;  1IW2 A;  2AS8 A;  2A2U A;  5IXG A;  1I06 A;  3RDQ A;  1ZNE A;  4GGT A;  3TRK A;  3K3L A;  2GC9 A;  9PAP A;  4I3D A;  3E3C A;  1DC9 A;  2OP3 A;  1EIO A;  4DQ3 A;  5HBS A;  4BX5 B;  4R0B A;  4Z2O A;  4GD9 A;  4IAX A;  2IBI A;  3NR3 A;  4LZV A;  1VWD B;  2DCA A;  3FLL A;  2O62 A;  4L3R A;  3H8B A;  2RTC B;  5HZ9 A;  5JD2 A;  4CDC A;  3FDC A;  1LFO A;  4CPE A;  2YJ2 A;  4DNE A;  3RVW A;  4OVZ B;  1LEL A;  3ZW2 A;  1RXH A;  1G74 A;  2R9M A;  4CDD B;  3IEJ A;  4YYV A;  2FT9 A;  1CJL A;  2XKL A;  4HWM A;  1UKF A;  5LJK A;  4OMW A;  1QMY A;  2RTR B;  2FS7 A;  1QAB E;  3Q6L A;  5F7G A;  3T6L A;  4AZR A;  3P6F A;  1HMR A;  3WBG A;  3C77 X;  1DF3 A;  3KW9 A;  1ZIV A;  2CZT A;  5F6B A;  1A6R A;  4GJS A;  3USV A;  1A2D A;  4XMC A;  1STR B;  2CM4 A;  2BT9 A;  5KHP A;  3V8U A;  1LDO A;  5FAZ A;  5JR8 A;  1U9X A;  1RST B;  1HMS A;  3S26 A;  1UYN X;  1X8N A;  2EU7 X;  4Q8H A;  4ZJ0 A;  4YDA A;  5EGW A;  1CQD A;  2BSZ A;  2W2A A;  1CSB B;  5CHT A;  1N4J A;  3RZY A;  4NYR A;  5HCD C;  3BPF A;  4BVM A;  2ANS A;  3E9S A;  4REZ A;  2OY8 A;  1FTP A;  1HXZ A;  2VFC A;  1VWP B;  4OS8 A;  3BRN A;  1PBO A;  2RTO B;  1KZX A;  4Y5D A;  2K23 A;  3NHE A;  2PI3 O;  1VWL B;  3HWG A;  3RE6 A;  4GDA A;  3K8U A;  1AU2 A;  1TXL A;  2NND A;  1CBR A;  1LIF A;  2UYW A;  1X8O A;  1EUO A;  3VU1 A;  1IWD A;  5HZ6 A;  2JGS A;  4U46 A;  2X55 A;  1GX8 A;  1PAD A;  1HBQ A;  3DF0 A;  2AVW A;  1VSN A;  3APX A;  4Q8G A;  2KTS A;  1AU4 A;  4P6E A;  2IZK A;  3ERV A;  3BY4 A;  1NLJ A;  1AIM A;  3L4R A;  3PDF A;  5DG4 A;  1LCZ A;  5HTD A;  2BDZ A;  3OJY C;  2A5C A;  2ASN X;  4YDB A;  1VYF A;  1NP4 A;  3RDS A;  1ALB A;  2L9C A;  2YJ9 A;  4YGG A;  1HMT A;  1IKE A;  4ZH6 A;  3PHX A;  4O3W A;  4XUI A;  3SZJ A;  4W5B A;  4MI7 A;  1N9Y A;  2WR6 A;  2VHF A;  1SWN A;  1SRF A;  3EYC A;  1ICF A;  2P7U A;  1JZU A;  3M99 A;  1I05 A;  1LCV A;  3CMP A;  1YIV A;  1SWS A;  2R74 A;  3F5V A;  4ZUX U;  1SY1 A;  1JYD A;  3E1Z B;  4QGW A;  1VWQ B;  4I3C A;  4UU3 A;  1W4T A;  1R0U A;  3N3G A;  4QRG A;  4ID2 A;  2DCD A;  1LIE A;  1SMP I;  2BC3 A;  2FR3 A;  3HOL A;  5IO5 A;  4XMH A;  1SRJ A;  2A3F X;  3OVX A;  4O49 A;  3V6E A;  3ZNH A;  1Y55 X;  1HUC B;  2DC7 A;  4P6G A;  1NB3 A;  3VHI A;  1VWR B;  1ZNH A;  4MEE A;  3D95 A;  3EW1 A;  2FRA A;  3I3T A;  4O4O A;  2JTC A;  1GT1 A;  1GT5 A;  1AEL A;  1JJJ A;  1IJ8 A;  2X8F A;  1YAL A;  1CS8 A;  2HZQ A;  2BS5 A;  2LA7 A;  4X6I A; 
#chains in the Genus database with same CATH homology
 2R9F A;  2P0R A;  5A24 A;  3D9W A;  1Q6K A;  3H8C A;  3N4C A;  3MOR A;  2GHU A;  1POP A;  4PAD A;  1YT7 A;  2FUD A;  4MSX A;  3HHA A;  4BGF A;  1MHW A;  2VFB A;  3QJ3 A;  1W5R A;  3IMA A;  2AUX A;  4CDD A;  3KSE A;  3MTN A;  1GX3 A;  2F7D A;  1PPD A;  3CBJ A;  3QSD A;  2FQ9 A;  2DJG A;  1KFU L;  1NL6 A;  5CVO B;  1PPO A;  1AU3 A;  4QH6 A;  1KHP A;  1EWO A;  3KWB X;  3RVV A;  1BQI A;  1ZCM A;  4KLB A;  2YJB A;  3O0U A;  4BS5 A;  2H7J A;  4BPV A;  1MEM A;  1QXP A;  2DZZ A;  1Y08 A;  3QT4 A;  2NQI A;  5JA7 A;  3H6S A;  1ITO A;  3CH3 X;  4BQV A;  2AIM A;  3OIS A;  2F1G A;  3WXE A;  1XKG A;  4YYS A;  4I04 A;  2O6X A;  2BDL A;  2OUL A;  4CDE B;  3LTW A;  3MHS A;  3PBH A;  1GCB A;  1U5I A;  1NPZ A;  2DJG B;  4YYU A;  1VJV A;  2E00 A;  4G54 A;  3WXG A;  2VHS A;  3O1G A;  3P5V A;  4FK5 A;  3TNX A;  2PRE A;  6PAD A;  1STF E;  2GFO A;  4GUZ A;  1KFX L;  2FT2 A;  2R9C A;  2E02 A;  8PCH A;  1YVB A;  3I06 A;  3P5U A;  4QRV A;  4X6H A;  4AXM A;  3OVZ A;  2HD5 A;  1AU0 A;  2HH5 A;  2AYN A;  2PNS A;  3PW3 A;  2HXZ A;  1PIP A;  2XU1 A;  2DC8 A;  2FRQ A;  1QOL A;  1U9Q X;  1CPJ A;  2B1M A;  1EF7 A;  2JQF R;  1SP4 B;  4FJC A;  3S3R A;  1AYU A;  2AU1 A;  3ZUA A;  3BPM A;  3BCN A;  1MEG A;  1M6D A;  1NB5 A;  4I07 A;  2PAD A;  3KKU A;  1CTE A;  4PP2 E;  1MIR A;  4OEL A;  2DJF B;  3KWZ A;  1F2B A;  4CDF A;  2AS8 A;  2G6D A;  4CDC B;  2ACT A;  1GMY A;  1AEC A;  5CHV A;  3D6S A;  3BOW A;  2YJ8 A;  1CVZ A;  4W4U A;  5PAD A;  9PAP A;  4HWY A;  1Y4H A;  2OP3 A;  4AXL A;  3BWK A;  4OEM A;  2CB5 A;  4N8W A;  3GCB A;  2NQG A;  1JQP A;  4YYR A;  4XR7 A;  4BSQ A;  2IBI A;  2DZY A;  2DCA A;  3V6C A;  5EF4 A;  1QDQ A;  3H8B A;  4PI3 A;  3CH2 X;  1BGO A;  1O0E A;  4CDC A;  2YJ2 A;  3RVW A;  1F2A A;  4NV8 A;  4C5P A;  1PXV A;  1EWP A;  2R9M A;  4CDD B;  3IHP A;  3IEJ A;  4YYV A;  1CJL A;  5CVN B;  1BP4 A;  3C9E A;  3P5X A;  1QMY A;  1W6F A;  5F02 A;  1K3B A;  3CBK A;  3KFQ A;  1ATK A;  2JQG R;  4FIP A;  1EWM A;  2OZ2 A;  2C0Y A;  2NQA A;  3P5W A;  2R9O A;  3N3K A;  3IOQ A;  2G7Y A;  2XU4 A;  1U9W A;  3KW9 A;  1ZIV A;  1A6R A;  3USV A;  3HWN A;  1GLO A;  3F75 A;  4N79 A;  1YK8 A;  4YYW A;  2DC9 A;  1YK7 A;  3B79 A;  3S3Q A;  3AI8 A;  1U9X A;  2E01 A;  4Q8H A;  5EGW A;  1CQD A;  3RVX A;  2BSZ A;  4DMY A;  1EWL A;  2AYO A;  1CSB B;  1DEU A;  5CHT A;  2YJC A;  3BPF A;  3LXS A;  1THE A;  1CB5 A;  2NQD B;  2Y5B A;  2G8J A;  2VFC A;  2PBH A;  4CZW A;  3U8E A;  4YV8 A;  2DCC A;  3NHE A;  3LFY A;  4W5C A;  2FYE A;  4PP1 A;  3K8U A;  4DMX A;  1U9V A;  1AU2 A;  1FH0 A;  3K24 A;  5FPW A;  1PPN A;  1IWD A;  1PPP A;  1PAD A;  1GEC E;  1E2T A;  1PBH A;  2B1N A;  4MZO A;  3DF0 A;  4N4Z A;  2AVW A;  1VSN A;  4Q8G A;  1AU4 A;  4P6E A;  4X6J A;  3ERV A;  4NV7 A;  2P86 A;  1NLJ A;  2DC6 A;  4I05 A;  1F2C A;  1AIM A;  2AUZ A;  3PDF A;  3PNR A;  2BDZ A;  2HHN A;  2WBF X;  3H89 A;  1NQC A;  4BS6 A;  2ARY A;  1CV8 A;  1AYV A;  3WXF A;  1K3B B;  2YJ9 A;  4CDF B;  3MHH A;  4QBB A;  1X9Y A;  4XUI A;  4W5B A;  2VHF A;  1ICF A;  2P7U A;  3M99 A;  2ATO A;  2IPP B;  1S4V A;  2FTD A;  1BY8 A;  3F5V A;  4ZUX U;  3IV2 A;  3HHI A;  3E1Z B;  2G8E A;  3BC3 A;  1MS6 A;  1SNK A;  2R6N A;  1W4T A;  3N3G A;  2DJF A;  4QRG A;  7PCK A;  4B55 A;  2DCD A;  2DCB A;  1DF0 A;  2R9N A;  4WA6 A;  3HD3 A;  3H7D A;  5JH3 A;  3OF8 A;  3OVX A;  1KHQ A;  3V6E A;  1MDW A;  3K9M A;  3OF9 A;  1HUC B;  5K16 A;  2DC7 A;  4CDE A;  2FO5 A;  2Y6E A;  4P6G A;  2E03 A;  1NB3 A;  1TLO A;  1ME4 A;  1ME3 A;  2FRA A;  3I3T A;  3KX1 A;  4YVA A;  4RY2 A;  3IUT A;  1PE6 A;  4K7C A;  1KXR A;  5J94 A;  5CVM A;  1TL9 A;  2XU3 A;  2XU5 A;  1YAL A;  1AYW A;  1CS8 A;  4QRX A;  1PCI A;  4MZS A;  1TU6 A;  2CIO A;  1F29 A;  4X6I A;  4YYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...