4OELA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
367
structure length
281
Chain Sequence
b'DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVLHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 77
structure length 281
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oelA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oelA02
1YVBA 3OF8A 1NQCA 4QRGA 1DF0A 1CPJA 1MDWA 4X6IA 1SP4B 3BWKA 3MTNA 2BDLA 1AU2A 1STFE 1ME3A 2PADA 1GLOA 8PCHA 3OF9A 2VHSA 1EWOA 1MIRA 2OULA 4WA6A 4QRVA 2NQIA 3KKUA 4W5BA 3HD3A 4YYRA 2R9FA 4I07A 1AYWA 1AYUA 1U9VA 1MEGA 2DJFA 2DC6A 4AXLA 3K24A 3KW9A 3K8UA 5JH3A 2DC9A 2AU1A 3WXEA 1Y4HA 3MHSA 1PPDA 3I3TA 3H8CA 4DMYA 2R9OA 4AXMA 4BS5A 1F2CA 1U9QX 2CB5A 3OVZA 2NQGA 2DJGB 2AUXA 2DCCA 5PADA 1BQIA 2NQAA 2FRAA 4YYSA 3IMAA 2P7UA 3KSEA 4YYVA 4Q8HA 2JQFR 3AI8A 3O0UA 3KWBX 1BP4A 5CVOB 1EWMA 1PBHA 3P5UA 1U9WA 5EGWA 3H6SA 1BY8A 2E02A 2VHFA 4CDEB 2YJ2A 2WBFX 1ATKA 3BC3A 1AECA 2AVWA 3O1GA 4XR7A 2HD5A 5CHVA 2G6DA 1SNKA 2PBHA 5K16A 5A24A 1PXVA 3F5VA 2YJBA 2HHNA 2AYNA 4CDFA 5FPWA 2H7JA 1GECE 1NPZA 3RVVA 2YJ9A 3ZUAA 1YALA 3HHIA 1CVZA 3KX1A 3QT4A 3D6SA 1MEMA 3P5WA 2ACTA 4QH6A 3RVWA 1AU0A 4I05A 3P5VA 4BPVA 1PCIA 5CVNB 4CDCA 2G8JA 2B1NA 2B1MA 2NQDB 1Q6KA 4MZSA 3BPMA 3QJ3A 1M6DA 2FO5A 4QBBA 4X6HA 2FYEA 4P6EA 2AS8A 3V6CA 2G8EA 1CB5A 2HXZA 3M99A 4I04A 1GMYA 1KXRA 3B79A 1U9XA 3C9EA 2Y6EA 3K9MA 1YT7A 4YYWA 3MORA 1QOLA 2GHUA 6PADA 4PP2E 4X6JA 3U8EA 1PADA 7PCKA 2DCBA 2HH5A 4K7CA 3IOQA 3BOWA 1ICFA 1PPNA 3RVXA 1EWPA 1IWDA 1QDQA 5F02A 1TL9A 1GCBA 1PPOA 2FRQA 3IV2A 1KHPA 1XKGA 1PIPA 2JQGR 2R9CA 4PI3A 1X9YA 3N3KA 4FK5A 4QRXA 4YYQA 2XU1A 3LFYA 1K3BB 1KHQA 2XU4A 3OVXA 1PE6A 5J94A 1QMYA 2YJCA 4OEMA 2OP3A 3CH2X 2DJGA 1U5IA 3KFQA 2E00A 3PBHA 1QXPA 4CDDB 1TLOA 1FH0A 2R9NA 4PP1A 2P86A 1JQPA 1F2AA 4P6GA 3WXFA 1PPPA 2IBIA 3IHPA 1NB3A 1BGOA 4CDEA 3OISA 4ZUXU 2AUZA 4CZWA 2AYOA 2GFOA 3S3QA 4YVAA 1MS6A 3NHEA 4XUIA 4N8WA 4BSQA 1POPA 2O6XA 5JA7A 3KWZA 2G7YA 2DJFB 5CHTA 3H7DA 9PAPA 2PREA 1EF7A 3BCNA 3HHAA 3MHHA 1NLJA 4FIPA 1THEA 1AYVA 2XU3A 4KLBA 2E03A 1ITOA 1YK8A 3S3RA 1CJLA 2DC7A 1ME4A 2DCAA 3PNRA 3HWNA 3IEJA 3ERVA 3CH3X 4BQVA 1F29A 4W4UA 1NL6A 1CSBB 3BPFA 2ATOA 2E01A 3IUTA 1KFXL 2C0YA 2DC8A 1A6RA 1F2BA 1AU4A 1Y08A 5CVMA 3V6EA 3WXGA 4BS6A 2OZ2A 3PDFA 3PW3A 2FUDA 4PADA 3I06A 1AIMA 2FTDA 1KFUL 2XU5A 3P5XA 2FT2A 1NB5A 2BDZA 2AIMA 2DCDA 3TNXA 1CS8A 3F75A 2DZYA 1CTEA 3CBJA 4CDFB 1AU3A 1HUCB 4FJCA 2PNSA 3DF0A 1ZIVA 4G54A 4YYUA 3H8BA 3H89A 1ZCMA 3N3GA 2F7DA 2IPPB 3GCBA 4OELA 2P0RA 3CBKA 4DMXA 2Y5BA 4RY2A 5EF4A 1MHWA 3N4CA 2F1GA 4MSXA 4HWYA 4W5CA 4CDCB 4Q8GA 2FQ9A 2R6NA 1DEUA 4N79A 1YK7A 4MZOA 2DZZA 4N4ZA 1TU6A 3LXSA 1VSNA 1VJVA 2R9MA 1CV8A 1O0EA 1EWLA 1K3BA 2YJ8A 1S4VA 3USVA 3E1ZB 2ARYA 2CIOA 3QSDA 4YV8A 1CQDA 4CDDA
chains in the Genus database with same CATH superfamily
1LPJA 1YVBA 3WVMA 1KGLA 1NQCA 1Y9LA 1LCZA 2RTNB 4A8ZA 1SWHA 4JHQA 1ML7A 1X8OA 1LUQA 4DCBA 3OF9A 2HNXA 1EW3A 5BVQA 4ZJ0A 3TF6A 1VWRB 2NNDA 1EWOA 4REZA 1MIRA 1OSPO 1SLFB 3NQ9A 3WJEA 4QRVA 4WFVA 4AZPA 3KKUA 1K24A 1OEEA 5EEDA 4TKBA 3HD3A 4OMWA 1ZNGA 1MEGA 2DJFA 4GRJA 3K8UA 1QWDA 1Y55X 5JH3A 5HCCC 3WXEA 4O3XB 3S26A 5LJKA 3KFHA 4OS8A 4GGTA 3FIQA 2NQGA 3AKMA 1U0XA 2DCCA 1BQIA 4IB6A 2FRAA 4YYSA 2RTEB 3FR5A 3KSEA 1TXLA 5B10O 5IRUA 3P6GA 1D3SA 1WUBA 3APVA 4KH8A 2WEWA 4Z2VA 1CJ5A 1QABE 5EGWA 2RTJA 1IKJA 4ZR2A 1SWDA 2R56A 1JYJA 2JOZA 3O1GA 1HXLA 2HD5A 2AVIA 4BX6A 3IFUA 1SNKA 1IFBA 2PBHA 1SY0A 5K16A 3BU9A 1PXVA 1SXXA 4QRLA 2FE8A 1ICNA 2AYNA 2ZSCA 4MVKA 2OVEA 3F9DA 4NYRA 2H7JA 5LJGA 5HA0A 4GNWA 1JZUA 5EDCA 2AT8X 4YGHA 4WBKA 3EC5A 4Z2OA 1YALA 1N9MA 1VYFA 4WFUA 2QMIA 3FR2A 5FFHA 2ACTA 4QH6A 3RVWA 4I05A 5D47A 1VWLB 1G5WA 4HFOA 4HPCA 2YG2A 1M6DA 3WZPA 1GKAB 1YZBA 3RDQA 3VU1A 1A2DA 2G8EA 4XMGA 1LIDA 4Y0PA 1HMSA 2HXZA 4AW8A 3ZUOA 3MVFA 1S7DA 1W5RA 1U9XA 5B5FA 5IO5A 1GX3A 4O3YA 4U46A 4YFQA 1VWIB 1YT7A 1B56A 4MISA 3RDUA 3PHUA 4RF1A 4IB9A 4GJVA 3U8EA 1SWEA 2OZQA 5EZSA 3P6EA 5F2BA 3S5XA 1SREA 2HH5A 4ORWA 1ICFA 1SWGA 1PPNA 3RVXA 1T0VA 3D96A 4AYHA 4R3DA 2AT5X 5F02A 1LCWA 3QKGA 1CBSA 2IZCB 2NNQA 4D8BA 4YBPA 4TNNA 1KHPA 1HXZA 1XKGA 2R9CA 4P16A 4PI3A 1NGLA 5LKEA 2OVSA 3KFFA 4L3RA 3LFYA 1MEPA 3OVXA 1HBQA 4IABA 4I9SA 4LZVA 2RQ0A 5HCDC 2OP3A 4BCSA 2DJGA 3TGAA 2OF8A 2E00A 3PBHA 3Q6LA 1IKEA 4TQ2A 1OBQA 2OL6O 4ON1A 1VWJB 1TLOA 3VG5A 2R9NA 2FWVA 1KXOA 1DV9A 4BOSA 4P6GA 3UEXA 2RTAA 3CQNA 4YGZA 1I78A 2A5BA 5CYBA 1NB3A 2IBIA 1BGOA 3TMPA 4ZHGA 2AUZA 4AZNA 4BX7A 2G7BA 3HOLA 4OS0A 3NHEA 3FA7A 4N8WA 4BSQA 1POPA 1QY1A 2DJFB 2KT4B 3EMMA 5CHTA 3H7DA 1EF7A 1D2UA 5AEOA 2KW1A 2RN4A 1X8UA 3VPJE 1BRPA 4ALOA 4I6SA 1LFOA 4NP1A 1MM9A 1SRIA 1CJLA 1ME4A 2X34A 1YP6A 2DCAA 1T68X 2IZFB 1F29A 3BPFA 2ATOA 3IUTA 4M7MA 1KFXL 4GUAA 1F2BA 4I3DA 3WJCA 3O2YA 4GDAA 3WXGA 1FJ1E 3MM0A 3PDFA 2P8GA 3PW3A 2FUDA 4PADA 3MG5A 1AIMA 3APXA 2FTDA 4OKAA 2FT2A 4BX6B 2L68A 3TNXA 4MVIA 5HZ9A 1JIWI 5LKFA 3SOTA 1LF7A 3CBJA 4ORYA 4TLJA 4BBOA 3CKFA 2FT9A 1ZIVA 4Y59A 3H89A 3VG4A 1ZCMA 1BSOA 4O4UA 1KZXA 2RTDB 2IPPB 3FIDA 4XMHA 2BSZA 3JSQA 3T1DA 4BOQA 2W2BA 1VWKB 4CPIA 1PMPA 2GTLO 3PSEA 1SWFA 4O4OA 4Z6JA 2FQ9A 3CQRA 5HWZA 4XMCA 1QFTA 3UEWA 1E5PA 4YMYA 3C0RA 4BOPA 5F1EA 4N4ZA 2KD2A 1EI5A 5KICA 4Y0RA 3LXSA 1N9YA 4QNIA 4FBRA 2R9MA 3VHMA 3IA8A 1STSB 2W2FA 5LJHA 1EWLA 2Y3EA 1O0EA 3RDOA 1E02A 1U18A 3E1ZB 3L4RA 3C78X 1CQDA 1ADLA 5KIDA 1PEEA 1GM6A 1YIVA 2JGSA 4CPEA 5HAEA 3OF8A 4QRGA 2ACPX 1DF0A 3WJGA 3NX2A 1SP4B 2EU7X 4GUZA 2IZDB 4ODDA 4Z2PA 3PHXA 2M4LA 2L9CA 1ME3A 4ID2A 1GLOA 4LZUA 1JJXA 4I9RA 1N0SA 1N4JA 4GGRA 2Q2PA 4U8UO 1STPA 2OFMX 1ZRYA 4HXDB 3BX8A 2GTFX 1BSYA 4YDBA 2A5CA 1VWOB 1FTPA 4W5BA 3NR3A 2FR3A 3VG3A 4YYRA 1H91A 3EM0A 1TW4A 4AXLA 2F09A 1VWPB 2JW1A 1DZJA 2RTKA 1NC9A 4D6AA 2ALLX 1NDJA 3RNVA 2Q39A 4BS5A 1F2CA 1YWBA 4Y0QA 1VWFB 1EQDA 2DJGB 4YKMA 5PADA 1OPBA 2NQAA 2OY1O 4ZFXA 1NQNA 3RDSA 4IUMA 1SRJA 2IZLB 1YWDA 4Q8HA 3VG6A 3KQ0A 1BSQA 3APWA 1X8NA 1MUPA 3EBKA 5CVOB 1E00A 1HBPA 1PBHA 3VHIA 1EIIA 2KTDA 2ANSA 1BY8A 4TJZA 1SMPI 2E02A 1VWHB 2WBFX 3BC3A 1AECA 4BX7B 5HZ5A 5E6JA 4GNYA 1MDCA 5D8JA 1GT4A 2OY7A 2QO6A 2RTPB 1I9HA 5LJEA 4JGLA 2OY8A 1YUPA 4IAWA 2YJBA 3F5VA 1ERXA 4AZQA 4CDFA 2X8TA 3FENA 3TRKA 4YVBA 3OQCA 1BJ7A 3AEHA 3VE1A 2K62A 4CSBA 2FGSA 1AU0A 5CVNB 1DKIA 4ORXA 4CDCA 1SXWA 2B1NA 3MP2A 1KL5A 1PVJA 1BLRA 1Q6KA 1SWBA 4FBOA 3RE6A 3BPMA 3QJ3A 2FO5A 2LFOA 2AF5A 4A1HA 4MVEA 3E9SA 1U17A 3T2WA 2AS8A 3V6CA 1EUOA 3BLGA 3STNA 1DC9A 4FBVA 1RLBE 4PJ2A 1KXRA 1PTSA 3HWDA 3I17A 1G7NA 2IZKA 3VHHA 3PQSA 2Y6EA 2G8CO 3BY0A 4ML7B 4BGFA 2MM3A 3BDRA 4X6JA 2HMBA 2HZQA 2A0AA 1PADA 1JYDA 3KVNA 1KT4A 5EZ2A 7PCKA 3Q34A 5FQ7E 3BOWA 1I06A 2AMMX 4BOEA 4GK9A 3PECA 1E2TA 3PK2A 1QDQA 3LHNA 4ORRA 1ALBA 1SWOA 3D4RA 3STMX 3IV2A 1R0UA 2CAMA 1PIPA 1KT7A 3NP1A 4DQ4A 5B5GA 4FK5A 1O1VA 5KO3A 4ALBA 4QRXA 1LKEA 1KT3A 1KHQA 4NW4A 2A8GA 5LJDA 2L67A 5J94A 2FTBA 1Y52X 2C1QA 1KZWA 4OEMA 5EEEA 3N91A 3ZW1A 1U5IA 3KFQA 4IBAA 3RKGA 1VWEB 2QCBA 1VWBB 1A3YA 1AVGI 4QQ1A 5DG4A 3PPTA 3MTVA 4Y5DA 5JZEA 3F6ZB 1T8VA 1FH0A 4BJ8A 5LJCA 4BX5A 3W31A 4U9CA 2BTWA 2C1SA 4QZUA 1JV4A 1X8QA 1I05A 4D6BA 3OJYC 4A60A 1OBUA 1F2AA 2ZAIA 1JJUA 4I3CA 1BRQA 4NLJA 4CDEA 3OISA 4ZUXU 1LDQA 2GFOA 2O62A 2MF6A 2OL8O 1MS6A 5IRAA 2UZ2A 3FA9A 1SLDB 1KOIA 2G7YA 1FENA 2UYWA 2MO5A 2Q2MA 3WBGA 3MHHA 5F7GA 1I4UA 3F8AA 4NNSA 1AYVA 2XU3A 5K67A 4KLBA 4M6SA 1YK8A 2RTFB 3IEJA 1SRHA 4Z28A 1DZKA 5HA1A 2IZBA 1KFFA 1NL6A 4BQUA 3ZUIA 3T2XA 3BBAA 5HZ8A 2JTCA 2MHDA 5HZ6A 1AVDA 2C0YA 5FENA 5KHPA 2OF9A 1AU4A 5CVMA 4FGIB 5HTEA 3TGCA 2OFRX 3P5XA 3ZNHA 1ZNLA 2G78A 2BDZA 1VWCB 2AIMA 2DCDA 4D8IA 2ACOA 2GJ5A 4QAEA 3STKA 3F75A 4BOZA 1EPBA 2HWKA 3WOVA 4CDFB 1AU3A 1DF8A 5H9AA 4RNAA 2LB6A 4G54A 2AT3X 2F73A 2F7DA 2GTLN 3GCBA 2WPUA 4DMXA 1SWCA 3C77X 2HYSA 4WHIA 1MHWA 1VWMB 4ES7A 4MSXA 4HWYA 4CDCB 1NBXA 2R6NA 4EEJA 4YH0A 3WYQA 5L3YA 2KTSA 5C0NA 4MZOA 4RUNA 4CPFA 3P02A 2OVDA 3PT2A 1S44A 1BM5A 1MX7A 2FR2A 1KT6A 1SWSA 4HPBA 4K19A 4YCHA 4ZGFA 2BLGA 2XSTA 3NQKA 4YV8A 4CV7A 2FLJA 3B21A 3RE5A 3SZIA 2R74A 3WZQA 3B2LA 1MDWA 4X6IA 4NNTA 2E4JA 5CHKA 2PI3O 5H9LA 4INNA 3WXQA 2RCQA 4U8UN 8PCHA 1NP4A 4OS3A 4D8EA 1ACDA 3HWEA 4QYPA 3BX7A 2VFBA 4PT5A 3NQ3A 2AT0X 5LJBA 2X55A 4RKXA 2QOSC 4UU2A 3ZWEA 3O22A 1SXUA 3B2HA 3CR6A 1VWGB 1AYWA 1AYUA 2AKQA 1U9VA 1VYOA 5F6BA 2DC6A 3HK1A 4U3QA 1VWNB 4QZTA 3U0DA 3FDCA 4YFPA 3U03A 3MHSA 4O4SA 3H8CA 3I3TA 2R9OA 3HPEA 4AXMA 4I95A 5L8IA 2X56A 3EW2A 1U9QX 2CZTA 3OVZA 3ZW1B 4QGVA 3LTWA 4GD9A 1SWRA 2J7QC 2OVAA 4HPAA 3PEDA 3KFGA 4YYVA 3ZZVA 4BX5B 4ZCBA 3VG7A 2BTWB 1DZMA 3AI8A 3O0UA 3APUA 1BP4A 4ORUA 5AJBA 4AZMA 2JN3A 1EWMA 1ZNDA 3P5UA 1ZNKA 1P6PA 1U9WA 4KC8A 3H6SA 4CDEB 3QQ2A 4GKCA 1L6MA 3T6LA 2AVWA 3BU1A 5CHVA 2G6DA 1PM1X 1KQWA 4JNJA 5F6ZA 1A57A 2Q9SA 1ZNHA 2QO5A 3NPOA 5A24A 1G74A 3FR4A 4N7CA 4IRWA 1EXSA 2HHNA 5FPWA 4DNEA 4KCAA 2IZJA 2RTOB 1VWQB 2BHVA 4TKJA 1NPZA 2OL7A 4EDEA 2LKKA 5K06A 3HHIA 2IZIA 4BOUA 2YMSA 3RDMA 3QT4A 2IFBA 3D6SA 2RTLA 1MEMA 2RCTA 4XMEA 3SAOA 5L8NA 3P5VA 3SZJA 1PCIA 4YBUA 2G8JA 5IXGA 4LQZA 5DPQA 1AVEA 5F58A 3S5VA 1I04A 4XMDA 2WUTA 4QBBA 4X6HA 1HQPA 2FYEA 2N93A 1GT5A 5B11O 3M99A 2WEXA 4I3BA 3D95A 1GMYA 3B79A 3C9EA 2AH7X 1SXYA 2Y3FA 1SWLA 1PBYA 1HN2A 3K9MA 3HOEA 4CK4A 3MORA 5AQ6A 4AZRA 1QY0A 2RA6A 1GX8A 3FEPA 4K7CA 3IOQA 1VWAB 1XCAA 1EWPA 4KC7A 4MVLA 3TGBA 1SWAA 1QY2A 1W4TA 3X00A 5AJCA 2R73A 2BS5A 1GCBA 1PPOA 2FRQA 2BC3A 3N3KA 4YYQA 2CZUA 2XU1A 4ZHHA 2XU4A 3BY4A 2C4IA 4NV8A 2JMBA 1N43A 1OBPA 1WBIA 5FQ8E 1TOWA 2YJCA 3CH2X 1OEKA 3WJDA 3C76X 4M0WA 1QXPA 2QO4A 1UYOX 3MX7A 2FRSA 2JRIA 5H9KA 3P6CA 2X4MA 2P86A 3P24A 5BVTA 1BWYA 2CM9A 2BS6A 2RTCB 3WXFA 1PPPA 1QG5A 5CE4A 3OBLA 4MM3B 5B27A 4CZWA 2AYOA 2OYBO 3WJFA 4IB7A 3S3QA 1EIOA 1ICMA 4YVAA 2J7QA 4WURA 4GGZA 5JD2A 2GC9A 1GXAA 2IZAA 4QYNA 2WQ9A 2NNEA 3RSWA 1RBPA 1O1UA 9PAPA 4KT5A 2WSJA 4FIPA 1THEA 1DZPA 3CWKA 2E03A 3S3RA 2A13A 2DC7A 1TVQA 3ZQ3A 4LKPA 5B29A 3PNRA 3HWNA 5EZQA 4IMOA 3JQOA 1S2PA 1SY2A 3CKGA 2VFCA 1SWQA 2E01A 3KZAA 1BEBA 1SLEB 2AT6X 1SWNA 4A1YA 1A6RA 5IO7A 1Y08A 4B55A 1MX8A 4BS6A 2VDFA 2AL0X 2XU5A 1AELA 4CPHA 4COTA 4O4XA 1HMRA 3IFBA 2NP1A 5BVSA 1LIEA 5IRWA 4O49A 4EQAC 1SWKA 3UEVA 1CS8A 1DF3A 3GE2A 2WQAE 2DZYA 1XKIA 2QOMA 2HKDA 1HUCB 2FKGA 2JU8A 2K23A 4FJCA 4IP3A 3SLTA 2PNSA 2MJIA 3DF0A 1UKFA 3ZW2A 3H8BA 3N3GA 3HWGA 2Z84A 1DFVA 1O8VA 2P0RA 4HWMA 2GH7A 4RY2A 5EF4A 5H9NA 3G7XA 3BS2A 3CBCA 3N4CA 4W5CA 2LBVA 2FHNX 3PRMA 4C5PA 1X71A 4N79A 1LELA 3PHWA 4MI7A 1SY3A 2DZZA 1MK5A 1VSNA 1LNMA 1CV8A 2WR6A 3NBXX 1K3BA 1YP7A 1STRB 1S4VA 2DM5A 2XKLA 4L1NA 4Y0SA 4O3WA 2ARYA 3MJ5A 3DTQA 4CDDA 2FS6A 5EPQA 1HY2A 2X8SA 3FMZA 1E06A 2A2GA 2FS7A 3SLOA 2CBRA 1CPJA 3BWKA 2W2AA 1X8PA 3CMPA 3MTNA 2BDLA 1NP1A 5H8TA 1AU2A 1Z24A 1STFE 2PADA 2ASNX 1LCVA 2VHSA 2HLVA 3RY1A 2OULA 4NYQA 2IZGB 4WA6A 2Z4IA 3V8UA 3I0AA 1SRFA 3FA8A 1LIFA 3O19A 2NQIA 2R9FA 4I07A 4FQBB 3HWFA 1Y9TA 3K24A 3KW9A 2G79A 4EKVA 2DC9A 2AU1A 4OVZA 1Y4HA 3WZOA 1PPDA 3ELXA 4DMYA 1HQQA 3T6FA 1JMZA 4ZH9A 2CB5A 2AUXA 3VG2A 2P7UA 3IMAA 3ZI8A 4BVMA 4OW0A 1Y0GA 1CBIA 2JQFR 3KWBX 2UZJA 1RXJA 1SWUA 2VHFA 4ORSA 1A18A 1JMXA 5HBSA 2YJ2A 1ATKA 4XR7A 2MWHA 2Y32A 1EPAA 2OFAA 1VPRA 1GX9A 4OMXA 2RTHB 3UEUA 1GECE 3RVVA 2RTIB 3O65A 2OY5O 1AB0A 1B8EA 2YJ9A 2Q4NA 3ZUAA 1NQMA 1BBPA 1CVZA 3KX1A 2A2UA 1SWTA 2RTMA 3P5WA 1LIBA 4BPVA 1G85A 1LICA 3AUMO 2DOSA 3P6FA 2B1MA 2NQDB 5K68A 2GTLM 3KFIA 2RTRB 1IFCA 3MBTA 4MZSA 5D4AA 5EDBA 2PY1A 2AGAA 3BB7A 3ZW0A 2IZHB 1RXKA 3E3CA 3S60A 1IIUA 4P6EA 4HPDA 4ZH6A 4YDAA 3SZHA 1CB5A 3SLJA 4ZTBA 4I04A 5JR8A 4GU8A 2RTBB 4CPHB 3U9PC 1SWPA 1GGLA 1OPAA 1UZ2X 4DQ3A 1YWCA 1ERBA 1KL4A 3BSZE 4YCEA 4Z27A 4MIRA 4YYWA 1TOUA 3RBYA 1IJ8A 3K3LA 3EYCA 3FW5A 1QOLA 2GHUA 6PADA 4PP2E 2OFBA 1YWAA 3W30A 1FE3A 1SRGA 3B2KA 4GE1A 2I5VO 3NX1A 2G5LA 5HCEC 3AKNA 2DCBA 2RTGB 1B0OA 3FLLA 5L8OA 1EALA 1IWDA 1HMTA 1CBQA 3UAQA 1TL9A 4U8UM 4R0BA 3FYFA 5HZQA 2X32A 4ZHFA 5FQ6E 2JQGR 5D48A 2X8FA 1X9YA 2POAA 4PSQA 1MOYA 1RSTB 3FA6A 1K3BB 2JU7A 1PE6A 3D97A 1QQSA 3PH6A 3VGWA 1QMYA 1SWJA 1KQXA 5CSEA 2CM4A 5BYPA 4MEEA 4CDDB 4NLIA 2HZRA 3RDXA 4EFGA 1N7YA 4AZOA 3WYPA 1X89A 3VE2A 4PP1A 1CBRA 1IW2A 4XMFA 3TZSA 1JQPA 2BU3A 3JS1A 1QFVA 3IHPA 2RD7C 2QM9A 2X46A 2ZAGA 4GDZA 1CRBA 3ELZA 4I60A 4XUIA 3EBWA 1SLGB 3NADA 4LKTA 2O6XA 5JA7A 3KWZA 1KL3A 3FW4A 3PRPA 1FEMA 3LV4A 2WWPA 2CBSA 3DSZA 2PREA 3BCNA 4N7DA 3HHAA 4ARHA 5B2AO 1NLJA 4OVZB 3RZYA 3GAQA 1SA8A 4IMNA 3RY2A 1VYGA 1ITOA 4YGGA 2LBAA 4IB8A 3D9WA 4ZHDA 4KIIA 3PP6A 3ERVA 3HTYA 3CH3X 3WZNA 4BQVA 2FKJA 2RTQB 4W4UA 2I5ZO 1CSBB 2JU3A 2FHLA 1RXHA 4YFRA 1SY1A 1FELA 1UREA 1GKAA 3FELA 4GZVA 2DC8A 3OE3A 3B2JA 4NV7A 3V6EA 1FDQA 2OZ2A 4O3ZA 2LA7A 4YKOA 3PH5A 1MVGA 3I06A 4UU3A 1KFUL 1W6FA 1NB5A 5D45A 3P6HA 1AQBA 3BRNA 1RSUB 1CTEA 3WJBA 1GT3A 4JO6A 3CBSA 1KT5A 1OEJA 4YYUA 3RWXA 3OD9A 4EXZA 1GT1A 2IZEB 4A5UA 4OELA 5IO6A 3B2IA 2F01A 1PBOA 3CBKA 2BT9A 2Y5BA 4QGWA 1RAVA 3PQUA 4ZHCA 5HTDA 2F1GA 2X45A 4Q8GA 4GETA 4XZXA 1DEUA 5B3MO 1B4MA 3H3IA 4RUUA 1YK7A 2L5PA 3FEKA 4ZGUA 4QGXA 1TU6A 3ZW0B 1ZNEA 4GJSA 4RF0A 3EW1A 1VJVA 3P6DA 4O9SA 1Y53X 4GH7A 1JJJA 2A3FX 2YJ8A 1JBHA 4IAXA 3USVA 1LDOA 5FAZA 4TKHA 2CIOA 3QSDA 1UYNX 1VWDB 2Z4HA
chains in the Genus database with same CATH topology
1YVBA 3OF8A 1NQCA 4QRGA 1DF0A 1CPJA 1MDWA 4X6IA 1SP4B 3BWKA 4GUZA 3MTNA 2BDLA 1AU2A 1STFE 1ME3A 2PADA 1GLOA 8PCHA 3OF9A 2VHSA 1EWOA 1MIRA 2VFBA 2OULA 4WA6A 4QRVA 2NQIA 3KKUA 4W5BA 3HD3A 4YYRA 2R9FA 4I07A 1AYWA 1AYUA 1U9VA 1MEGA 2DJFA 2DC6A 4AXLA 3K24A 3KW9A 3K8UA 5JH3A 2DC9A 2AU1A 3WXEA 1Y4HA 3MHSA 1PPDA 3I3TA 3H8CA 4DMYA 2R9OA 4AXMA 4BS5A 1F2CA 1U9QX 2CB5A 3OVZA 2NQGA 2DJGB 2AUXA 2DCCA 3LTWA 5PADA 1BQIA 2NQAA 2FRAA 4YYSA 3IMAA 2P7UA 3KSEA 4YYVA 4Q8HA 2JQFR 3AI8A 3O0UA 3KWBX 1BP4A 5CVOB 1EWMA 1PBHA 3P5UA 1U9WA 5EGWA 3H6SA 1BY8A 2E02A 2VHFA 4CDEB 2YJ2A 2WBFX 1ATKA 3BC3A 1AECA 2AVWA 3O1GA 4XR7A 2HD5A 5CHVA 2G6DA 1SNKA 2PBHA 5K16A 5A24A 1PXVA 3F5VA 2YJBA 2HHNA 2AYNA 4CDFA 5FPWA 2H7JA 1GECE 1NPZA 3RVVA 2YJ9A 3ZUAA 1YALA 3HHIA 1CVZA 3KX1A 3QT4A 3D6SA 1MEMA 3P5WA 2ACTA 4QH6A 3RVWA 1AU0A 4I05A 3P5VA 4BPVA 1PCIA 5CVNB 4CDCA 2G8JA 2B1NA 2B1MA 2NQDB 1Q6KA 4MZSA 3BPMA 3QJ3A 1M6DA 2FO5A 4QBBA 4X6HA 2FYEA 4P6EA 2AS8A 3V6CA 2G8EA 1CB5A 2HXZA 3M99A 4I04A 1W5RA 1GMYA 1KXRA 3B79A 1U9XA 3C9EA 1GX3A 2Y6EA 3K9MA 1YT7A 4YYWA 3MORA 4BGFA 1QOLA 2GHUA 6PADA 4PP2E 4X6JA 3U8EA 1PADA 7PCKA 2DCBA 2HH5A 4K7CA 3IOQA 3BOWA 1ICFA 1PPNA 3RVXA 1EWPA 1E2TA 1IWDA 1QDQA 5F02A 1W4TA 1TL9A 1GCBA 1PPOA 2FRQA 3IV2A 1KHPA 1XKGA 1PIPA 2JQGR 2R9CA 4PI3A 1X9YA 3N3KA 4FK5A 4QRXA 4YYQA 2XU1A 3LFYA 1K3BB 1KHQA 2XU4A 3OVXA 4NV8A 1PE6A 5J94A 1QMYA 2YJCA 4OEMA 2OP3A 3CH2X 2DJGA 1U5IA 3KFQA 2E00A 3PBHA 1QXPA 4CDDB 1TLOA 1FH0A 2R9NA 4PP1A 2P86A 1JQPA 1F2AA 4P6GA 3WXFA 1PPPA 2IBIA 3IHPA 1NB3A 1BGOA 4CDEA 3OISA 4ZUXU 2AUZA 4CZWA 2AYOA 2GFOA 3S3QA 4YVAA 1MS6A 3NHEA 4XUIA 4N8WA 4BSQA 1POPA 2O6XA 5JA7A 3KWZA 2G7YA 2DJFB 5CHTA 3H7DA 9PAPA 2PREA 1EF7A 3BCNA 3HHAA 3MHHA 1NLJA 4FIPA 1THEA 1AYVA 2XU3A 4KLBA 2E03A 1ITOA 1YK8A 3S3RA 1CJLA 2DC7A 1ME4A 3D9WA 2DCAA 3PNRA 3HWNA 3IEJA 3ERVA 3CH3X 4BQVA 1F29A 4W4UA 1NL6A 1CSBB 2VFCA 3BPFA 2ATOA 2E01A 3IUTA 1KFXL 2C0YA 2DC8A 1A6RA 1F2BA 1AU4A 1Y08A 4NV7A 5CVMA 3V6EA 4B55A 3WXGA 4BS6A 2OZ2A 3PDFA 3PW3A 2FUDA 4PADA 3I06A 1AIMA 2FTDA 1KFUL 2XU5A 3P5XA 1W6FA 2FT2A 1NB5A 2BDZA 2AIMA 2DCDA 3TNXA 1CS8A 3F75A 2DZYA 1CTEA 3CBJA 4CDFB 1AU3A 1HUCB 4FJCA 2PNSA 3DF0A 1ZIVA 4G54A 4YYUA 3H8BA 3H89A 1ZCMA 3N3GA 2F7DA 2IPPB 3GCBA 4OELA 2BSZA 2P0RA 3CBKA 4DMXA 2Y5BA 4RY2A 5EF4A 1MHWA 3N4CA 2F1GA 4MSXA 4HWYA 4W5CA 4CDCB 4Q8GA 2FQ9A 2R6NA 1DEUA 4C5PA 4N79A 1YK7A 4MZOA 2DZZA 4N4ZA 1TU6A 3LXSA 1VSNA 1VJVA 2R9MA 1CV8A 1O0EA 1EWLA 1K3BA 2YJ8A 1S4VA 3USVA 3E1ZB 2ARYA 2CIOA 3QSDA 4YV8A 1CQDA 4CDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB A;  3OF8 A;  1NQC A;  4QRG A;  1DF0 A;  1CPJ A;  1MDW A;  4X6I A;  1SP4 B;  3BWK A;  3MTN A;  2BDL A;  1AU2 A;  1STF E;  1ME3 A;  2PAD A;  1GLO A;  8PCH A;  3OF9 A;  2VHS A;  1EWO A;  1MIR A;  2OUL A;  4WA6 A;  4QRV A;  2NQI A;  3KKU A;  4W5B A;  3HD3 A;  4YYR A;  2R9F A;  4I07 A;  1AYW A;  1AYU A;  1U9V A;  1MEG A;  2DJF A;  2DC6 A;  4AXL A;  3K24 A;  3KW9 A;  3K8U A;  5JH3 A;  2DC9 A;  2AU1 A;  3WXE A;  1Y4H A;  3MHS A;  1PPD A;  3I3T A;  3H8C A;  4DMY A;  2R9O A;  4AXM A;  4BS5 A;  1F2C A;  1U9Q X;  2CB5 A;  3OVZ A;  2NQG A;  2DJG B;  2AUX A;  2DCC A;  5PAD A;  1BQI A;  2NQA A;  2FRA A;  4YYS A;  3IMA A;  2P7U A;  3KSE A;  4YYV A;  4Q8H A;  2JQF R;  3AI8 A;  3O0U A;  3KWB X;  1BP4 A;  5CVO B;  1EWM A;  1PBH A;  3P5U A;  1U9W A;  5EGW A;  3H6S A;  1BY8 A;  2E02 A;  2VHF A;  4CDE B;  2YJ2 A;  2WBF X;  1ATK A;  3BC3 A;  1AEC A;  2AVW A;  3O1G A;  4XR7 A;  2HD5 A;  5CHV A;  2G6D A;  1SNK A;  2PBH A;  5K16 A;  5A24 A;  1PXV A;  3F5V A;  2YJB A;  2HHN A;  2AYN A;  4CDF A;  5FPW A;  2H7J A;  1GEC E;  1NPZ A;  3RVV A;  2YJ9 A;  3ZUA A;  1YAL A;  3HHI A;  1CVZ A;  3KX1 A;  3QT4 A;  3D6S A;  1MEM A;  3P5W A;  2ACT A;  4QH6 A;  3RVW A;  1AU0 A;  4I05 A;  3P5V A;  4BPV A;  1PCI A;  5CVN B;  4CDC A;  2G8J A;  2B1N A;  2B1M A;  2NQD B;  1Q6K A;  4MZS A;  3BPM A;  3QJ3 A;  1M6D A;  2FO5 A;  4QBB A;  4X6H A;  2FYE A;  4P6E A;  2AS8 A;  3V6C A;  2G8E A;  1CB5 A;  2HXZ A;  3M99 A;  4I04 A;  1GMY A;  1KXR A;  3B79 A;  1U9X A;  3C9E A;  2Y6E A;  3K9M A;  1YT7 A;  4YYW A;  3MOR A;  1QOL A;  2GHU A;  6PAD A;  4PP2 E;  4X6J A;  3U8E A;  1PAD A;  7PCK A;  2DCB A;  2HH5 A;  4K7C A;  3IOQ A;  3BOW A;  1ICF A;  1PPN A;  3RVX A;  1EWP A;  1IWD A;  1QDQ A;  5F02 A;  1TL9 A;  1GCB A;  1PPO A;  2FRQ A;  3IV2 A;  1KHP A;  1XKG A;  1PIP A;  2JQG R;  2R9C A;  4PI3 A;  1X9Y A;  3N3K A;  4FK5 A;  4QRX A;  4YYQ A;  2XU1 A;  3LFY A;  1K3B B;  1KHQ A;  2XU4 A;  3OVX A;  1PE6 A;  5J94 A;  1QMY A;  2YJC A;  4OEM A;  2OP3 A;  3CH2 X;  2DJG A;  1U5I A;  3KFQ A;  2E00 A;  3PBH A;  1QXP A;  4CDD B;  1TLO A;  1FH0 A;  2R9N A;  4PP1 A;  2P86 A;  1JQP A;  1F2A A;  4P6G A;  3WXF A;  1PPP A;  2IBI A;  3IHP A;  1NB3 A;  1BGO A;  4CDE A;  3OIS A;  4ZUX U;  2AUZ A;  4CZW A;  2AYO A;  2GFO A;  3S3Q A;  4YVA A;  1MS6 A;  3NHE A;  4XUI A;  4N8W A;  4BSQ A;  1POP A;  2O6X A;  5JA7 A;  3KWZ A;  2G7Y A;  2DJF B;  5CHT A;  3H7D A;  9PAP A;  2PRE A;  1EF7 A;  3BCN A;  3HHA A;  3MHH A;  1NLJ A;  4FIP A;  1THE A;  1AYV A;  2XU3 A;  4KLB A;  2E03 A;  1ITO A;  1YK8 A;  3S3R A;  1CJL A;  2DC7 A;  1ME4 A;  2DCA A;  3PNR A;  3HWN A;  3IEJ A;  3ERV A;  3CH3 X;  4BQV A;  1F29 A;  4W4U A;  1NL6 A;  1CSB B;  3BPF A;  2ATO A;  2E01 A;  3IUT A;  1KFX L;  2C0Y A;  2DC8 A;  1A6R A;  1F2B A;  1AU4 A;  1Y08 A;  5CVM A;  3V6E A;  3WXG A;  4BS6 A;  2OZ2 A;  3PDF A;  3PW3 A;  2FUD A;  4PAD A;  3I06 A;  1AIM A;  2FTD A;  1KFU L;  2XU5 A;  3P5X A;  2FT2 A;  1NB5 A;  2BDZ A;  2AIM A;  2DCD A;  3TNX A;  1CS8 A;  3F75 A;  2DZY A;  1CTE A;  3CBJ A;  4CDF B;  1AU3 A;  1HUC B;  4FJC A;  2PNS A;  3DF0 A;  1ZIV A;  4G54 A;  4YYU A;  3H8B A;  3H89 A;  1ZCM A;  3N3G A;  2F7D A;  2IPP B;  3GCB A;  4OEL A;  2P0R A;  3CBK A;  4DMX A;  2Y5B A;  4RY2 A;  5EF4 A;  1MHW A;  3N4C A;  2F1G A;  4MSX A;  4HWY A;  4W5C A;  4CDC B;  4Q8G A;  2FQ9 A;  2R6N A;  1DEU A;  4N79 A;  1YK7 A;  4MZO A;  2DZZ A;  4N4Z A;  1TU6 A;  3LXS A;  1VSN A;  1VJV A;  2R9M A;  1CV8 A;  1O0E A;  1EWL A;  1K3B A;  2YJ8 A;  1S4V A;  3USV A;  3E1Z B;  2ARY A;  2CIO A;  3QSD A;  4YV8 A;  1CQD A;  4CDD A; 
#chains in the Genus database with same CATH topology
 1LPJ A;  1YVB A;  3WVM A;  1KGL A;  1NQC A;  1Y9L A;  1LCZ A;  2RTN B;  4A8Z A;  1SWH A;  4JHQ A;  1ML7 A;  1X8O A;  1LUQ A;  4DCB A;  3OF9 A;  2HNX A;  1EW3 A;  5BVQ A;  4ZJ0 A;  3TF6 A;  1VWR B;  2NND A;  1EWO A;  4REZ A;  1MIR A;  1OSP O;  1SLF B;  3NQ9 A;  3WJE A;  4QRV A;  4WFV A;  4AZP A;  3KKU A;  1K24 A;  1OEE A;  5EED A;  4TKB A;  3HD3 A;  4OMW A;  1ZNG A;  1MEG A;  2DJF A;  4GRJ A;  3K8U A;  1QWD A;  1Y55 X;  5JH3 A;  5HCC C;  3WXE A;  4O3X B;  3S26 A;  5LJK A;  3KFH A;  4OS8 A;  4GGT A;  3FIQ A;  2NQG A;  3AKM A;  1U0X A;  2DCC A;  1BQI A;  4IB6 A;  2FRA A;  4YYS A;  2RTE B;  3FR5 A;  3KSE A;  1TXL A;  5B10 O;  5IRU A;  3P6G A;  1D3S A;  1WUB A;  3APV A;  4KH8 A;  2WEW A;  4Z2V A;  1CJ5 A;  1QAB E;  5EGW A;  2RTJ A;  1IKJ A;  4ZR2 A;  1SWD A;  2R56 A;  1JYJ A;  2JOZ A;  3O1G A;  1HXL A;  2HD5 A;  2AVI A;  4BX6 A;  3IFU A;  1SNK A;  1IFB A;  2PBH A;  1SY0 A;  5K16 A;  3BU9 A;  1PXV A;  1SXX A;  4QRL A;  2FE8 A;  1ICN A;  2AYN A;  2ZSC A;  4MVK A;  2OVE A;  3F9D A;  4NYR A;  2H7J A;  5LJG A;  5HA0 A;  4GNW A;  1JZU A;  5EDC A;  2AT8 X;  4YGH A;  4WBK A;  3EC5 A;  4Z2O A;  1YAL A;  1N9M A;  1VYF A;  4WFU A;  2QMI A;  3FR2 A;  5FFH A;  2ACT A;  4QH6 A;  3RVW A;  4I05 A;  5D47 A;  1VWL B;  1G5W A;  4HFO A;  4HPC A;  2YG2 A;  1M6D A;  3WZP A;  1GKA B;  1YZB A;  3RDQ A;  3VU1 A;  1A2D A;  2G8E A;  4XMG A;  1LID A;  4Y0P A;  1HMS A;  2HXZ A;  4AW8 A;  3ZUO A;  3MVF A;  1S7D A;  1W5R A;  1U9X A;  5B5F A;  5IO5 A;  1GX3 A;  4O3Y A;  4U46 A;  4YFQ A;  1VWI B;  1YT7 A;  1B56 A;  4MIS A;  3RDU A;  3PHU A;  4RF1 A;  4IB9 A;  4GJV A;  3U8E A;  1SWE A;  2OZQ A;  5EZS A;  3P6E A;  5F2B A;  3S5X A;  1SRE A;  2HH5 A;  4ORW A;  1ICF A;  1SWG A;  1PPN A;  3RVX A;  1T0V A;  3D96 A;  4AYH A;  4R3D A;  2AT5 X;  5F02 A;  1LCW A;  3QKG A;  1CBS A;  2IZC B;  2NNQ A;  4D8B A;  4YBP A;  4TNN A;  1KHP A;  1HXZ A;  1XKG A;  2R9C A;  4P16 A;  4PI3 A;  1NGL A;  5LKE A;  2OVS A;  3KFF A;  4L3R A;  3LFY A;  1MEP A;  3OVX A;  1HBQ A;  4IAB A;  4I9S A;  4LZV A;  2RQ0 A;  5HCD C;  2OP3 A;  4BCS A;  2DJG A;  3TGA A;  2OF8 A;  2E00 A;  3PBH A;  3Q6L A;  1IKE A;  4TQ2 A;  1OBQ A;  2OL6 O;  4ON1 A;  1VWJ B;  1TLO A;  3VG5 A;  2R9N A;  2FWV A;  1KXO A;  1DV9 A;  4BOS A;  4P6G A;  3UEX A;  2RTA A;  3CQN A;  4YGZ A;  1I78 A;  2A5B A;  5CYB A;  1NB3 A;  2IBI A;  1BGO A;  3TMP A;  4ZHG A;  2AUZ A;  4AZN A;  4BX7 A;  2G7B A;  3HOL A;  4OS0 A;  3NHE A;  3FA7 A;  4N8W A;  4BSQ A;  1POP A;  1QY1 A;  2DJF B;  2KT4 B;  3EMM A;  5CHT A;  3H7D A;  1EF7 A;  1D2U A;  5AEO A;  2KW1 A;  2RN4 A;  1X8U A;  3VPJ E;  1BRP A;  4ALO A;  4I6S A;  1LFO A;  4NP1 A;  1MM9 A;  1SRI A;  1CJL A;  1ME4 A;  2X34 A;  1YP6 A;  2DCA A;  1T68 X;  2IZF B;  1F29 A;  3BPF A;  2ATO A;  3IUT A;  4M7M A;  1KFX L;  4GUA A;  1F2B A;  4I3D A;  3WJC A;  3O2Y A;  4GDA A;  3WXG A;  1FJ1 E;  3MM0 A;  3PDF A;  2P8G A;  3PW3 A;  2FUD A;  4PAD A;  3MG5 A;  1AIM A;  3APX A;  2FTD A;  4OKA A;  2FT2 A;  4BX6 B;  2L68 A;  3TNX A;  4MVI A;  5HZ9 A;  1JIW I;  5LKF A;  3SOT A;  1LF7 A;  3CBJ A;  4ORY A;  4TLJ A;  4BBO A;  3CKF A;  2FT9 A;  1ZIV A;  4Y59 A;  3H89 A;  3VG4 A;  1ZCM A;  1BSO A;  4O4U A;  1KZX A;  2RTD B;  2IPP B;  3FID A;  4XMH A;  2BSZ A;  3JSQ A;  3T1D A;  4BOQ A;  2W2B A;  1VWK B;  4CPI A;  1PMP A;  2GTL O;  3PSE A;  1SWF A;  4O4O A;  4Z6J A;  2FQ9 A;  3CQR A;  5HWZ A;  4XMC A;  1QFT A;  3UEW A;  1E5P A;  4YMY A;  3C0R A;  4BOP A;  5F1E A;  4N4Z A;  2KD2 A;  1EI5 A;  5KIC A;  4Y0R A;  3LXS A;  1N9Y A;  4QNI A;  4FBR A;  2R9M A;  3VHM A;  3IA8 A;  1STS B;  2W2F A;  5LJH A;  1EWL A;  2Y3E A;  1O0E A;  3RDO A;  1E02 A;  1U18 A;  3E1Z B;  3L4R A;  3C78 X;  1CQD A;  1ADL A;  5KID A;  1PEE A;  1GM6 A;  1YIV A;  2JGS A;  4CPE A;  5HAE A;  3OF8 A;  4QRG A;  2ACP X;  1DF0 A;  3WJG A;  3NX2 A;  1SP4 B;  2EU7 X;  4GUZ A;  2IZD B;  4ODD A;  4Z2P A;  3PHX A;  2M4L A;  2L9C A;  1ME3 A;  4ID2 A;  1GLO A;  4LZU A;  1JJX A;  4I9R A;  1N0S A;  1N4J A;  4GGR A;  2Q2P A;  4U8U O;  1STP A;  2OFM X;  1ZRY A;  4HXD B;  3BX8 A;  2GTF X;  1BSY A;  4YDB A;  2A5C A;  1VWO B;  1FTP A;  4W5B A;  3NR3 A;  2FR3 A;  3VG3 A;  4YYR A;  1H91 A;  3EM0 A;  1TW4 A;  4AXL A;  2F09 A;  1VWP B;  2JW1 A;  1DZJ A;  2RTK A;  1NC9 A;  4D6A A;  2ALL X;  1NDJ A;  3RNV A;  2Q39 A;  4BS5 A;  1F2C A;  1YWB A;  4Y0Q A;  1VWF B;  1EQD A;  2DJG B;  4YKM A;  5PAD A;  1OPB A;  2NQA A;  2OY1 O;  4ZFX A;  1NQN A;  3RDS A;  4IUM A;  1SRJ A;  2IZL B;  1YWD A;  4Q8H A;  3VG6 A;  3KQ0 A;  1BSQ A;  3APW A;  1X8N A;  1MUP A;  3EBK A;  5CVO B;  1E00 A;  1HBP A;  1PBH A;  3VHI A;  1EII A;  2KTD A;  2ANS A;  1BY8 A;  4TJZ A;  1SMP I;  2E02 A;  1VWH B;  2WBF X;  3BC3 A;  1AEC A;  4BX7 B;  5HZ5 A;  5E6J A;  4GNY A;  1MDC A;  5D8J A;  1GT4 A;  2OY7 A;  2QO6 A;  2RTP B;  1I9H A;  5LJE A;  4JGL A;  2OY8 A;  1YUP A;  4IAW A;  2YJB A;  3F5V A;  1ERX A;  4AZQ A;  4CDF A;  2X8T A;  3FEN A;  3TRK A;  4YVB A;  3OQC A;  1BJ7 A;  3AEH A;  3VE1 A;  2K62 A;  4CSB A;  2FGS A;  1AU0 A;  5CVN B;  1DKI A;  4ORX A;  4CDC A;  1SXW A;  2B1N A;  3MP2 A;  1KL5 A;  1PVJ A;  1BLR A;  1Q6K A;  1SWB A;  4FBO A;  3RE6 A;  3BPM A;  3QJ3 A;  2FO5 A;  2LFO A;  2AF5 A;  4A1H A;  4MVE A;  3E9S A;  1U17 A;  3T2W A;  2AS8 A;  3V6C A;  1EUO A;  3BLG A;  3STN A;  1DC9 A;  4FBV A;  1RLB E;  4PJ2 A;  1KXR A;  1PTS A;  3HWD A;  3I17 A;  1G7N A;  2IZK A;  3VHH A;  3PQS A;  2Y6E A;  2G8C O;  3BY0 A;  4ML7 B;  4BGF A;  2MM3 A;  3BDR A;  4X6J A;  2HMB A;  2HZQ A;  2A0A A;  1PAD A;  1JYD A;  3KVN A;  1KT4 A;  5EZ2 A;  7PCK A;  3Q34 A;  5FQ7 E;  3BOW A;  1I06 A;  2AMM X;  4BOE A;  4GK9 A;  3PEC A;  1E2T A;  3PK2 A;  1QDQ A;  3LHN A;  4ORR A;  1ALB A;  1SWO A;  3D4R A;  3STM X;  3IV2 A;  1R0U A;  2CAM A;  1PIP A;  1KT7 A;  3NP1 A;  4DQ4 A;  5B5G A;  4FK5 A;  1O1V A;  5KO3 A;  4ALB A;  4QRX A;  1LKE A;  1KT3 A;  1KHQ A;  4NW4 A;  2A8G A;  5LJD A;  2L67 A;  5J94 A;  2FTB A;  1Y52 X;  2C1Q A;  1KZW A;  4OEM A;  5EEE A;  3N91 A;  3ZW1 A;  1U5I A;  3KFQ A;  4IBA A;  3RKG A;  1VWE B;  2QCB A;  1VWB B;  1A3Y A;  1AVG I;  4QQ1 A;  5DG4 A;  3PPT A;  3MTV A;  4Y5D A;  5JZE A;  3F6Z B;  1T8V A;  1FH0 A;  4BJ8 A;  5LJC A;  4BX5 A;  3W31 A;  4U9C A;  2BTW A;  2C1S A;  4QZU A;  1JV4 A;  1X8Q A;  1I05 A;  4D6B A;  3OJY C;  4A60 A;  1OBU A;  1F2A A;  2ZAI A;  1JJU A;  4I3C A;  1BRQ A;  4NLJ A;  4CDE A;  3OIS A;  4ZUX U;  1LDQ A;  2GFO A;  2O62 A;  2MF6 A;  2OL8 O;  1MS6 A;  5IRA A;  2UZ2 A;  3FA9 A;  1SLD B;  1KOI A;  2G7Y A;  1FEN A;  2UYW A;  2MO5 A;  2Q2M A;  3WBG A;  3MHH A;  5F7G A;  1I4U A;  3F8A A;  4NNS A;  1AYV A;  2XU3 A;  5K67 A;  4KLB A;  4M6S A;  1YK8 A;  2RTF B;  3IEJ A;  1SRH A;  4Z28 A;  1DZK A;  5HA1 A;  2IZB A;  1KFF A;  1NL6 A;  4BQU A;  3ZUI A;  3T2X A;  3BBA A;  5HZ8 A;  2JTC A;  2MHD A;  5HZ6 A;  1AVD A;  2C0Y A;  5FEN A;  5KHP A;  2OF9 A;  1AU4 A;  5CVM A;  4FGI B;  5HTE A;  3TGC A;  2OFR X;  3P5X A;  3ZNH A;  1ZNL A;  2G78 A;  2BDZ A;  1VWC B;  2AIM A;  2DCD A;  4D8I A;  2ACO A;  2GJ5 A;  4QAE A;  3STK A;  3F75 A;  4BOZ A;  1EPB A;  2HWK A;  3WOV A;  4CDF B;  1AU3 A;  1DF8 A;  5H9A A;  4RNA A;  2LB6 A;  4G54 A;  2AT3 X;  2F73 A;  2F7D A;  2GTL N;  3GCB A;  2WPU A;  4DMX A;  1SWC A;  3C77 X;  2HYS A;  4WHI A;  1MHW A;  1VWM B;  4ES7 A;  4MSX A;  4HWY A;  4CDC B;  1NBX A;  2R6N A;  4EEJ A;  4YH0 A;  3WYQ A;  5L3Y A;  2KTS A;  5C0N A;  4MZO A;  4RUN A;  4CPF A;  3P02 A;  2OVD A;  3PT2 A;  1S44 A;  1BM5 A;  1MX7 A;  2FR2 A;  1KT6 A;  1SWS A;  4HPB A;  4K19 A;  4YCH A;  4ZGF A;  2BLG A;  2XST A;  3NQK A;  4YV8 A;  4CV7 A;  2FLJ A;  3B21 A;  3RE5 A;  3SZI A;  2R74 A;  3WZQ A;  3B2L A;  1MDW A;  4X6I A;  4NNT A;  2E4J A;  5CHK A;  2PI3 O;  5H9L A;  4INN A;  3WXQ A;  2RCQ A;  4U8U N;  8PCH A;  1NP4 A;  4OS3 A;  4D8E A;  1ACD A;  3HWE A;  4QYP A;  3BX7 A;  2VFB A;  4PT5 A;  3NQ3 A;  2AT0 X;  5LJB A;  2X55 A;  4RKX A;  2QOS C;  4UU2 A;  3ZWE A;  3O22 A;  1SXU A;  3B2H A;  3CR6 A;  1VWG B;  1AYW A;  1AYU A;  2AKQ A;  1U9V A;  1VYO A;  5F6B A;  2DC6 A;  3HK1 A;  4U3Q A;  1VWN B;  4QZT A;  3U0D A;  3FDC A;  4YFP A;  3U03 A;  3MHS A;  4O4S A;  3H8C A;  3I3T A;  2R9O A;  3HPE A;  4AXM A;  4I95 A;  5L8I A;  2X56 A;  3EW2 A;  1U9Q X;  2CZT A;  3OVZ A;  3ZW1 B;  4QGV A;  3LTW A;  4GD9 A;  1SWR A;  2J7Q C;  2OVA A;  4HPA A;  3PED A;  3KFG A;  4YYV A;  3ZZV A;  4BX5 B;  4ZCB A;  3VG7 A;  2BTW B;  1DZM A;  3AI8 A;  3O0U A;  3APU A;  1BP4 A;  4ORU A;  5AJB A;  4AZM A;  2JN3 A;  1EWM A;  1ZND A;  3P5U A;  1ZNK A;  1P6P A;  1U9W A;  4KC8 A;  3H6S A;  4CDE B;  3QQ2 A;  4GKC A;  1L6M A;  3T6L A;  2AVW A;  3BU1 A;  5CHV A;  2G6D A;  1PM1 X;  1KQW A;  4JNJ A;  5F6Z A;  1A57 A;  2Q9S A;  1ZNH A;  2QO5 A;  3NPO A;  5A24 A;  1G74 A;  3FR4 A;  4N7C A;  4IRW A;  1EXS A;  2HHN A;  5FPW A;  4DNE A;  4KCA A;  2IZJ A;  2RTO B;  1VWQ B;  2BHV A;  4TKJ A;  1NPZ A;  2OL7 A;  4EDE A;  2LKK A;  5K06 A;  3HHI A;  2IZI A;  4BOU A;  2YMS A;  3RDM A;  3QT4 A;  2IFB A;  3D6S A;  2RTL A;  1MEM A;  2RCT A;  4XME A;  3SAO A;  5L8N A;  3P5V A;  3SZJ A;  1PCI A;  4YBU A;  2G8J A;  5IXG A;  4LQZ A;  5DPQ A;  1AVE A;  5F58 A;  3S5V A;  1I04 A;  4XMD A;  2WUT A;  4QBB A;  4X6H A;  1HQP A;  2FYE A;  2N93 A;  1GT5 A;  5B11 O;  3M99 A;  2WEX A;  4I3B A;  3D95 A;  1GMY A;  3B79 A;  3C9E A;  2AH7 X;  1SXY A;  2Y3F A;  1SWL A;  1PBY A;  1HN2 A;  3K9M A;  3HOE A;  4CK4 A;  3MOR A;  5AQ6 A;  4AZR A;  1QY0 A;  2RA6 A;  1GX8 A;  3FEP A;  4K7C A;  3IOQ A;  1VWA B;  1XCA A;  1EWP A;  4KC7 A;  4MVL A;  3TGB A;  1SWA A;  1QY2 A;  1W4T A;  3X00 A;  5AJC A;  2R73 A;  2BS5 A;  1GCB A;  1PPO A;  2FRQ A;  2BC3 A;  3N3K A;  4YYQ A;  2CZU A;  2XU1 A;  4ZHH A;  2XU4 A;  3BY4 A;  2C4I A;  4NV8 A;  2JMB A;  1N43 A;  1OBP A;  1WBI A;  5FQ8 E;  1TOW A;  2YJC A;  3CH2 X;  1OEK A;  3WJD A;  3C76 X;  4M0W A;  1QXP A;  2QO4 A;  1UYO X;  3MX7 A;  2FRS A;  2JRI A;  5H9K A;  3P6C A;  2X4M A;  2P86 A;  3P24 A;  5BVT A;  1BWY A;  2CM9 A;  2BS6 A;  2RTC B;  3WXF A;  1PPP A;  1QG5 A;  5CE4 A;  3OBL A;  4MM3 B;  5B27 A;  4CZW A;  2AYO A;  2OYB O;  3WJF A;  4IB7 A;  3S3Q A;  1EIO A;  1ICM A;  4YVA A;  2J7Q A;  4WUR A;  4GGZ A;  5JD2 A;  2GC9 A;  1GXA A;  2IZA A;  4QYN A;  2WQ9 A;  2NNE A;  3RSW A;  1RBP A;  1O1U A;  9PAP A;  4KT5 A;  2WSJ A;  4FIP A;  1THE A;  1DZP A;  3CWK A;  2E03 A;  3S3R A;  2A13 A;  2DC7 A;  1TVQ A;  3ZQ3 A;  4LKP A;  5B29 A;  3PNR A;  3HWN A;  5EZQ A;  4IMO A;  3JQO A;  1S2P A;  1SY2 A;  3CKG A;  2VFC A;  1SWQ A;  2E01 A;  3KZA A;  1BEB A;  1SLE B;  2AT6 X;  1SWN A;  4A1Y A;  1A6R A;  5IO7 A;  1Y08 A;  4B55 A;  1MX8 A;  4BS6 A;  2VDF A;  2AL0 X;  2XU5 A;  1AEL A;  4CPH A;  4COT A;  4O4X A;  1HMR A;  3IFB A;  2NP1 A;  5BVS A;  1LIE A;  5IRW A;  4O49 A;  4EQA C;  1SWK A;  3UEV A;  1CS8 A;  1DF3 A;  3GE2 A;  2WQA E;  2DZY A;  1XKI A;  2QOM A;  2HKD A;  1HUC B;  2FKG A;  2JU8 A;  2K23 A;  4FJC A;  4IP3 A;  3SLT A;  2PNS A;  2MJI A;  3DF0 A;  1UKF A;  3ZW2 A;  3H8B A;  3N3G A;  3HWG A;  2Z84 A;  1DFV A;  1O8V A;  2P0R A;  4HWM A;  2GH7 A;  4RY2 A;  5EF4 A;  5H9N A;  3G7X A;  3BS2 A;  3CBC A;  3N4C A;  4W5C A;  2LBV A;  2FHN X;  3PRM A;  4C5P A;  1X71 A;  4N79 A;  1LEL A;  3PHW A;  4MI7 A;  1SY3 A;  2DZZ A;  1MK5 A;  1VSN A;  1LNM A;  1CV8 A;  2WR6 A;  3NBX X;  1K3B A;  1YP7 A;  1STR B;  1S4V A;  2DM5 A;  2XKL A;  4L1N A;  4Y0S A;  4O3W A;  2ARY A;  3MJ5 A;  3DTQ A;  4CDD A;  2FS6 A;  5EPQ A;  1HY2 A;  2X8S A;  3FMZ A;  1E06 A;  2A2G A;  2FS7 A;  3SLO A;  2CBR A;  1CPJ A;  3BWK A;  2W2A A;  1X8P A;  3CMP A;  3MTN A;  2BDL A;  1NP1 A;  5H8T A;  1AU2 A;  1Z24 A;  1STF E;  2PAD A;  2ASN X;  1LCV A;  2VHS A;  2HLV A;  3RY1 A;  2OUL A;  4NYQ A;  2IZG B;  4WA6 A;  2Z4I A;  3V8U A;  3I0A A;  1SRF A;  3FA8 A;  1LIF A;  3O19 A;  2NQI A;  2R9F A;  4I07 A;  4FQB B;  3HWF A;  1Y9T A;  3K24 A;  3KW9 A;  2G79 A;  4EKV A;  2DC9 A;  2AU1 A;  4OVZ A;  1Y4H A;  3WZO A;  1PPD A;  3ELX A;  4DMY A;  1HQQ A;  3T6F A;  1JMZ A;  4ZH9 A;  2CB5 A;  2AUX A;  3VG2 A;  2P7U A;  3IMA A;  3ZI8 A;  4BVM A;  4OW0 A;  1Y0G A;  1CBI A;  2JQF R;  3KWB X;  2UZJ A;  1RXJ A;  1SWU A;  2VHF A;  4ORS A;  1A18 A;  1JMX A;  5HBS A;  2YJ2 A;  1ATK A;  4XR7 A;  2MWH A;  2Y32 A;  1EPA A;  2OFA A;  1VPR A;  1GX9 A;  4OMX A;  2RTH B;  3UEU A;  1GEC E;  3RVV A;  2RTI B;  3O65 A;  2OY5 O;  1AB0 A;  1B8E A;  2YJ9 A;  2Q4N A;  3ZUA A;  1NQM A;  1BBP A;  1CVZ A;  3KX1 A;  2A2U A;  1SWT A;  2RTM A;  3P5W A;  1LIB A;  4BPV A;  1G85 A;  1LIC A;  3AUM O;  2DOS A;  3P6F A;  2B1M A;  2NQD B;  5K68 A;  2GTL M;  3KFI A;  2RTR B;  1IFC A;  3MBT A;  4MZS A;  5D4A A;  5EDB A;  2PY1 A;  2AGA A;  3BB7 A;  3ZW0 A;  2IZH B;  1RXK A;  3E3C A;  3S60 A;  1IIU A;  4P6E A;  4HPD A;  4ZH6 A;  4YDA A;  3SZH A;  1CB5 A;  3SLJ A;  4ZTB A;  4I04 A;  5JR8 A;  4GU8 A;  2RTB B;  4CPH B;  3U9P C;  1SWP A;  1GGL A;  1OPA A;  1UZ2 X;  4DQ3 A;  1YWC A;  1ERB A;  1KL4 A;  3BSZ E;  4YCE A;  4Z27 A;  4MIR A;  4YYW A;  1TOU A;  3RBY A;  1IJ8 A;  3K3L A;  3EYC A;  3FW5 A;  1QOL A;  2GHU A;  6PAD A;  4PP2 E;  2OFB A;  1YWA A;  3W30 A;  1FE3 A;  1SRG A;  3B2K A;  4GE1 A;  2I5V O;  3NX1 A;  2G5L A;  5HCE C;  3AKN A;  2DCB A;  2RTG B;  1B0O A;  3FLL A;  5L8O A;  1EAL A;  1IWD A;  1HMT A;  1CBQ A;  3UAQ A;  1TL9 A;  4U8U M;  4R0B A;  3FYF A;  5HZQ A;  2X32 A;  4ZHF A;  5FQ6 E;  2JQG R;  5D48 A;  2X8F A;  1X9Y A;  2POA A;  4PSQ A;  1MOY A;  1RST B;  3FA6 A;  1K3B B;  2JU7 A;  1PE6 A;  3D97 A;  1QQS A;  3PH6 A;  3VGW A;  1QMY A;  1SWJ A;  1KQX A;  5CSE A;  2CM4 A;  5BYP A;  4MEE A;  4CDD B;  4NLI A;  2HZR A;  3RDX A;  4EFG A;  1N7Y A;  4AZO A;  3WYP A;  1X89 A;  3VE2 A;  4PP1 A;  1CBR A;  1IW2 A;  4XMF A;  3TZS A;  1JQP A;  2BU3 A;  3JS1 A;  1QFV A;  3IHP A;  2RD7 C;  2QM9 A;  2X46 A;  2ZAG A;  4GDZ A;  1CRB A;  3ELZ A;  4I60 A;  4XUI A;  3EBW A;  1SLG B;  3NAD A;  4LKT A;  2O6X A;  5JA7 A;  3KWZ A;  1KL3 A;  3FW4 A;  3PRP A;  1FEM A;  3LV4 A;  2WWP A;  2CBS A;  3DSZ A;  2PRE A;  3BCN A;  4N7D A;  3HHA A;  4ARH A;  5B2A O;  1NLJ A;  4OVZ B;  3RZY A;  3GAQ A;  1SA8 A;  4IMN A;  3RY2 A;  1VYG A;  1ITO A;  4YGG A;  2LBA A;  4IB8 A;  3D9W A;  4ZHD A;  4KII A;  3PP6 A;  3ERV A;  3HTY A;  3CH3 X;  3WZN A;  4BQV A;  2FKJ A;  2RTQ B;  4W4U A;  2I5Z O;  1CSB B;  2JU3 A;  2FHL A;  1RXH A;  4YFR A;  1SY1 A;  1FEL A;  1URE A;  1GKA A;  3FEL A;  4GZV A;  2DC8 A;  3OE3 A;  3B2J A;  4NV7 A;  3V6E A;  1FDQ A;  2OZ2 A;  4O3Z A;  2LA7 A;  4YKO A;  3PH5 A;  1MVG A;  3I06 A;  4UU3 A;  1KFU L;  1W6F A;  1NB5 A;  5D45 A;  3P6H A;  1AQB A;  3BRN A;  1RSU B;  1CTE A;  3WJB A;  1GT3 A;  4JO6 A;  3CBS A;  1KT5 A;  1OEJ A;  4YYU A;  3RWX A;  3OD9 A;  4EXZ A;  1GT1 A;  2IZE B;  4A5U A;  4OEL A;  5IO6 A;  3B2I A;  2F01 A;  1PBO A;  3CBK A;  2BT9 A;  2Y5B A;  4QGW A;  1RAV A;  3PQU A;  4ZHC A;  5HTD A;  2F1G A;  2X45 A;  4Q8G A;  4GET A;  4XZX A;  1DEU A;  5B3M O;  1B4M A;  3H3I A;  4RUU A;  1YK7 A;  2L5P A;  3FEK A;  4ZGU A;  4QGX A;  1TU6 A;  3ZW0 B;  1ZNE A;  4GJS A;  4RF0 A;  3EW1 A;  1VJV A;  3P6D A;  4O9S A;  1Y53 X;  4GH7 A;  1JJJ A;  2A3F X;  2YJ8 A;  1JBH A;  4IAX A;  3USV A;  1LDO A;  5FAZ A;  4TKH A;  2CIO A;  3QSD A;  1UYN X;  1VWD B;  2Z4H A; 
#chains in the Genus database with same CATH homology
 1YVB A;  3OF8 A;  1NQC A;  4QRG A;  1DF0 A;  1CPJ A;  1MDW A;  4X6I A;  1SP4 B;  3BWK A;  4GUZ A;  3MTN A;  2BDL A;  1AU2 A;  1STF E;  1ME3 A;  2PAD A;  1GLO A;  8PCH A;  3OF9 A;  2VHS A;  1EWO A;  1MIR A;  2VFB A;  2OUL A;  4WA6 A;  4QRV A;  2NQI A;  3KKU A;  4W5B A;  3HD3 A;  4YYR A;  2R9F A;  4I07 A;  1AYW A;  1AYU A;  1U9V A;  1MEG A;  2DJF A;  2DC6 A;  4AXL A;  3K24 A;  3KW9 A;  3K8U A;  5JH3 A;  2DC9 A;  2AU1 A;  3WXE A;  1Y4H A;  3MHS A;  1PPD A;  3I3T A;  3H8C A;  4DMY A;  2R9O A;  4AXM A;  4BS5 A;  1F2C A;  1U9Q X;  2CB5 A;  3OVZ A;  2NQG A;  2DJG B;  2AUX A;  2DCC A;  3LTW A;  5PAD A;  1BQI A;  2NQA A;  2FRA A;  4YYS A;  3IMA A;  2P7U A;  3KSE A;  4YYV A;  4Q8H A;  2JQF R;  3AI8 A;  3O0U A;  3KWB X;  1BP4 A;  5CVO B;  1EWM A;  1PBH A;  3P5U A;  1U9W A;  5EGW A;  3H6S A;  1BY8 A;  2E02 A;  2VHF A;  4CDE B;  2YJ2 A;  2WBF X;  1ATK A;  3BC3 A;  1AEC A;  2AVW A;  3O1G A;  4XR7 A;  2HD5 A;  5CHV A;  2G6D A;  1SNK A;  2PBH A;  5K16 A;  5A24 A;  1PXV A;  3F5V A;  2YJB A;  2HHN A;  2AYN A;  4CDF A;  5FPW A;  2H7J A;  1GEC E;  1NPZ A;  3RVV A;  2YJ9 A;  3ZUA A;  1YAL A;  3HHI A;  1CVZ A;  3KX1 A;  3QT4 A;  3D6S A;  1MEM A;  3P5W A;  2ACT A;  4QH6 A;  3RVW A;  1AU0 A;  4I05 A;  3P5V A;  4BPV A;  1PCI A;  5CVN B;  4CDC A;  2G8J A;  2B1N A;  2B1M A;  2NQD B;  1Q6K A;  4MZS A;  3BPM A;  3QJ3 A;  1M6D A;  2FO5 A;  4QBB A;  4X6H A;  2FYE A;  4P6E A;  2AS8 A;  3V6C A;  2G8E A;  1CB5 A;  2HXZ A;  3M99 A;  4I04 A;  1W5R A;  1GMY A;  1KXR A;  3B79 A;  1U9X A;  3C9E A;  1GX3 A;  2Y6E A;  3K9M A;  1YT7 A;  4YYW A;  3MOR A;  4BGF A;  1QOL A;  2GHU A;  6PAD A;  4PP2 E;  4X6J A;  3U8E A;  1PAD A;  7PCK A;  2DCB A;  2HH5 A;  4K7C A;  3IOQ A;  3BOW A;  1ICF A;  1PPN A;  3RVX A;  1EWP A;  1E2T A;  1IWD A;  1QDQ A;  5F02 A;  1W4T A;  1TL9 A;  1GCB A;  1PPO A;  2FRQ A;  3IV2 A;  1KHP A;  1XKG A;  1PIP A;  2JQG R;  2R9C A;  4PI3 A;  1X9Y A;  3N3K A;  4FK5 A;  4QRX A;  4YYQ A;  2XU1 A;  3LFY A;  1K3B B;  1KHQ A;  2XU4 A;  3OVX A;  4NV8 A;  1PE6 A;  5J94 A;  1QMY A;  2YJC A;  4OEM A;  2OP3 A;  3CH2 X;  2DJG A;  1U5I A;  3KFQ A;  2E00 A;  3PBH A;  1QXP A;  4CDD B;  1TLO A;  1FH0 A;  2R9N A;  4PP1 A;  2P86 A;  1JQP A;  1F2A A;  4P6G A;  3WXF A;  1PPP A;  2IBI A;  3IHP A;  1NB3 A;  1BGO A;  4CDE A;  3OIS A;  4ZUX U;  2AUZ A;  4CZW A;  2AYO A;  2GFO A;  3S3Q A;  4YVA A;  1MS6 A;  3NHE A;  4XUI A;  4N8W A;  4BSQ A;  1POP A;  2O6X A;  5JA7 A;  3KWZ A;  2G7Y A;  2DJF B;  5CHT A;  3H7D A;  9PAP A;  2PRE A;  1EF7 A;  3BCN A;  3HHA A;  3MHH A;  1NLJ A;  4FIP A;  1THE A;  1AYV A;  2XU3 A;  4KLB A;  2E03 A;  1ITO A;  1YK8 A;  3S3R A;  1CJL A;  2DC7 A;  1ME4 A;  3D9W A;  2DCA A;  3PNR A;  3HWN A;  3IEJ A;  3ERV A;  3CH3 X;  4BQV A;  1F29 A;  4W4U A;  1NL6 A;  1CSB B;  2VFC A;  3BPF A;  2ATO A;  2E01 A;  3IUT A;  1KFX L;  2C0Y A;  2DC8 A;  1A6R A;  1F2B A;  1AU4 A;  1Y08 A;  4NV7 A;  5CVM A;  3V6E A;  4B55 A;  3WXG A;  4BS6 A;  2OZ2 A;  3PDF A;  3PW3 A;  2FUD A;  4PAD A;  3I06 A;  1AIM A;  2FTD A;  1KFU L;  2XU5 A;  3P5X A;  1W6F A;  2FT2 A;  1NB5 A;  2BDZ A;  2AIM A;  2DCD A;  3TNX A;  1CS8 A;  3F75 A;  2DZY A;  1CTE A;  3CBJ A;  4CDF B;  1AU3 A;  1HUC B;  4FJC A;  2PNS A;  3DF0 A;  1ZIV A;  4G54 A;  4YYU A;  3H8B A;  3H89 A;  1ZCM A;  3N3G A;  2F7D A;  2IPP B;  3GCB A;  4OEL A;  2BSZ A;  2P0R A;  3CBK A;  4DMX A;  2Y5B A;  4RY2 A;  5EF4 A;  1MHW A;  3N4C A;  2F1G A;  4MSX A;  4HWY A;  4W5C A;  4CDC B;  4Q8G A;  2FQ9 A;  2R6N A;  1DEU A;  4C5P A;  4N79 A;  1YK7 A;  4MZO A;  2DZZ A;  4N4Z A;  1TU6 A;  3LXS A;  1VSN A;  1VJV A;  2R9M A;  1CV8 A;  1O0E A;  1EWL A;  1K3B A;  2YJ8 A;  1S4V A;  3USV A;  3E1Z B;  2ARY A;  2CIO A;  3QSD A;  4YV8 A;  1CQD A;  4CDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...