4OELA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
367
structure length
281
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVLHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 77
structure length 281
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oelA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oelA02
3LFYA 3WXEA 1QMYA 3OVZA 2WBFX 1AYWA 1O0EA 4P6GA 3HD3A 2R9OA 2P7UA 1GCBA 1U9WA 1AU0A 1TU6A 3F5VA 2FTDA 2OP3A 3S3QA 1IWDA 4P6EA 4CDEA 4CDCB 2DC6A 1DEUA 5CHTA 4I05A 4CDFB 2DCDA 1VJVA 2E01A 4AXMA 2AU1A 4QRVA 4BPVA 4RY2A 3PNRA 1QXPA 2DCAA 1PPNA 1U9QX 4QBBA 2YJBA 2B1NA 5F02A 1F2CA 2JQFR 5FPWA 3D6SA 1CSBB 1AU3A 4YVAA 1ZIVA 1MEMA 2BDLA 3H8CA 1KFXL 1Y08A 2AIMA 3WXGA 2YJ2A 2DCCA 1PADA 1TL9A 1CJLA 1MEGA 4YYSA 1PPOA 2YJ8A 2XU5A 1EWOA 3USVA 4YYRA 4BS5A 1SP4B 4W4UA 3IMAA 3TNXA 4DMXA 2YJ9A 1EWLA 3PBHA 1GECE 1AECA 4QRGA 3O0UA 4YYVA 1BP4A 4MZOA 3BWKA 4XUIA 2DC9A 2DJGA 4PP1A 3QT4A 1ME3A 4FJCA 3NHEA 1BY8A 3K9MA 3K24A 1GLOA 1TLOA 2AUZA 3C9EA 1PPPA 2FO5A 3P5XA 2AVWA 3N3KA 3K8UA 4YYUA 1EF7A 3CH2X 2FRAA 3H8BA 4Q8HA 2NQGA 8PCHA 3ZUAA 2HHNA 4QRXA 1K3BB 3CBKA 2F7DA 3GCBA 4Q8GA 2E00A 4PP2E 2NQAA 3DF0A 2DZYA 5EF4A 2P86A 1NB5A 6PADA 5CVMA 4FK5A 1U9VA 2FUDA 1THEA 2XU1A 3MTNA 2DJFA 1CPJA 1CTEA 3IOQA 4I07A 4G54A 2DJGB 1F2AA 2XU3A 3N4CA 4BQVA 5CHVA 2R9NA 2C0YA 3IHPA 1AIMA 4X6JA 2Y6EA 1STFE 1JQPA 1U5IA 2NQDB 3N3GA 2FYEA 2GHUA 3RVVA 2PADA 2G7YA 4YV8A 4N79A 2R9CA 1YVBA 1ICFA 2G8EA 5PADA 1EWMA 3HWNA 3CBJA 4X6HA 5JA7A 3I3TA 1PBHA 3QJ3A 1F2BA 1KXRA 3KKUA 1NPZA 1HUCB 1CB5A 1POPA 1YT7A 2OZ2A 3OVXA 4CDEB 3BPMA 1X9YA 9PAPA 4XR7A 4W5CA 3PW3A 2IPPB 1GMYA 1BGOA 4ZUXU 1CVZA 1MS6A 2H7JA 2B1MA 2CB5A 5A24A 2P0RA 2AS8A 1KHQA 1AU2A 4OELA 1AYVA 5CVOB 1NLJA 4CDCA 4MSXA 3PDFA 1S4VA 4CDFA 3H89A 1U9XA 4N8WA 1XKGA 3KWBX 1YK7A 1YALA 3BOWA 3KFQA 5CVNB 2FRQA 1ATKA 4AXLA 2VHSA 2GFOA 1NB3A 2AYNA 1MIRA 3BCNA 2R6NA 2R9FA 3AI8A 5JH3A 1ME4A 1PXVA 1YK8A 3MORA 2Y5BA 1NQCA 4FIPA 4CDDA 2HXZA 1ITOA 4OEMA 3ERVA 3MHHA 3KX1A 2HD5A 2JQGR 5K16A 4BSQA 1M6DA 2E02A 3MHSA 3BPFA 2XU4A 2FT2A 3KWZA 3RVXA 3BC3A 3OISA 2FQ9A 3E1ZB 4X6IA 2F1GA 3P5WA 3B79A 3IV2A 3IEJA 2G8JA 4PI3A 2E03A 1BQIA 3V6CA 2OULA 2G6DA 2PREA 4BS6A 3IUTA 1KHPA 1EWPA 1QOLA 1MDWA 4YYQA 1CS8A 2YJCA 4W5BA 5J94A 1SNKA 1MHWA 3S3RA 3V6EA 3QSDA 1F29A 1K3BA 3U8EA 5EGWA 1FH0A 2DC7A 2DJFB 3WXFA 3F75A 2NQIA 1Y4HA 3HHAA 4CDDB 4DMYA 2DC8A 1DF0A 3HHIA 2VHFA 1KFUL 1A6RA 2ARYA 1Q6KA 3KW9A 4KLBA 2PNSA 1CV8A 2IBIA 3O1GA 2BDZA 3KSEA 3RVWA 4N4ZA 1ZCMA 4WA6A 3CH3X 7PCKA 3P5UA 1PE6A 1NL6A 1CQDA 4CZWA 4QH6A 4YYWA 3H7DA 4PADA 2O6XA 2ATOA 2R9MA 2HH5A 3H6SA 4I04A 2CIOA 1QDQA 3M99A 1AYUA 2PBHA 4MZSA 3OF8A 3P5VA 2AYOA 2AUXA 3LXSA 2ACTA 1PIPA 1PPDA 1PCIA 2DZZA 3OF9A 4HWYA 3I06A 4K7CA 1VSNA 1AU4A 2DCBA
chains in the Genus database with same CATH superfamily
1JYJA 1SLFB 5FAZA 2RTDB 3DSZA 2Y3FA 4GETA 3P6DA 1CJ5A 3VG4A 1WBIA 3FW5A 1GCBA 4QZUA 3GE2A 1TU6A 3F5VA 2FTDA 3S3QA 5D45A 1SXXA 4BOPA 3N91A 2NNQA 4RUUA 3FA9A 5CHTA 4I05A 5B5GA 4GUAA 2RTLA 2DCDA 2E01A 4YBUA 5D4AA 4QRVA 1Y9TA 1JJUA 5HAEA 5B5FA 3O2YA 4U46A 3ZWEA 3D6SA 4FGIB 4BGFA 1CSBB 1ZIVA 1LCVA 4NP1A 2OL7A 3UEVA 3H8CA 1ZNHA 1Y08A 2AIMA 4QGVA 1ZNLA 4ZFXA 2OVAA 4IAWA 1KL5A 1TL9A 1HMSA 1PPOA 1Y53X 4OVZA 1SWBA 2XU5A 3LV4A 4I95A 4W4UA 5EDBA 2YJ9A 3PBHA 1Y0GA 2AVIA 1GECE 3WZQA 4QRGA 5BVQA 4YYVA 3BWKA 2DC9A 2WQ9A 3PHXA 3QT4A 1ME3A 3B21A 4IB8A 2IZFB 5F7GA 2AT0X 1K24A 1BY8A 3K24A 1X8PA 2JTCA 2LFOA 1TLOA 2AUZA 1PPPA 5LJDA 1TOUA 4PJ2A 3N3KA 1N0SA 2HYSA 3UEXA 4QGWA 1EF7A 1MEPA 3H8BA 2IZEB 2LKKA 2OL6O 3ZUAA 1E06A 3VG5A 1X89A 1SRJA 3P02A 2JU8A 2FS7A 3VPJE 1DKIA 3NBXX 3JS1A 2E00A 1EW3A 4Y0RA 4AZQA 1DV9A 2FR2A 1YWAA 4PP2E 2NQAA 4YDAA 1VWDB 1N4JA 4IRWA 3E9SA 6PADA 3BLGA 5EPQA 2ANSA 2LB6A 1THEA 1N43A 2AH7X 4Z27A 2DJFA 1CPJA 1VWGB 3BU9A 2CBSA 1KT6A 1EALA 3S60A 2ACPX 5C0NA 5CHVA 2R9NA 1DZMA 3TZSA 5FQ7E 4YGHA 3IHPA 1AIMA 3VHIA 2W2FA 4O3XB 5HTEA 3CWKA 2OF9A 4IAXA 1NBXA 1JQPA 5IXGA 3BX8A 2PY1A 2RTIB 2FHNX 2MM3A 2IZJA 1SY0A 4NNSA 1VWJB 3MTVA 4DNEA 1STSB 4YCEA 1KOIA 4YV8A 3ZUIA 1NDJA 1O8VA 2RTNB 1ICFA 2G8EA 1I4UA 1QQSA 4AYHA 5PADA 2Q4NA 2HWKA 3PQUA 3CBJA 4RF1A 1KFFA 2KT4B 2WWPA 1SRGA 3I3TA 2Q39A 4XMDA 5EEEA 3WJEA 4HPAA 1F2BA 5HZ8A 1U0XA 2X32A 4ALOA 4BOUA 1GM6A 2UZ2A 2JN3A 4FBOA 1CB5A 1POPA 3WOVA 2OZ2A 1YWCA 2IZLB 3ZI8A 4CDEB 9PAPA 3P24A 2R74A 3PW3A 1BRQA 4YFQA 4AW8A 3T2XA 4ZUXU 2HNXA 3EBKA 3FIQA 2RA6A 3U9PC 4XMGA 1VWRB 4O3ZA 4A1YA 1PM1X 4OELA 4O3WA 1AYVA 1OBUA 4CDCA 2QO5A 4IBAA 3BBAA 3I17A 4NV8A 1MK5A 4CDFA 1GGLA 2RTEB 1YALA 4I3BA 5HA0A 2FRQA 2WQAE 4RNAA 3SZHA 5L3YA 2OY5O 1E5PA 2MHDA 4CV7A 2AYNA 2WUTA 1D3SA 1TXLA 1MIRA 2RTCB 3WBGA 1JYDA 1PXVA 1SREA 2BC3A 3WVMA 2C1SA 2Y5BA 1ITOA 3KZAA 4GJVA 1O1UA 4U8UM 4OEMA 3FIDA 3QQ2A 3ERVA 3MHHA 5K06A 1ERBA 5HZQA 1G74A 2YG2A 5CE4A 5IO6A 2MJIA 2NNEA 3OISA 2FQ9A 2LA7A 1YWBA 3ZQ3A 2FHLA 1SLGB 1U18A 3E1ZB 1DFVA 4X6IA 1SWRA 2F1GA 3P6CA 3E3CA 4QNIA 3IEJA 2IFBA 4PI3A 2E03A 3S5VA 5H9KA 2CM9A 3SAOA 1QWDA 2G6DA 3UAQA 3VG2A 4GRJA 5IRAA 3H3IA 1MDWA 1SY3A 5L8NA 3QKGA 1F29A 1K3BA 1SWUA 4OS8A 1FH0A 1PEEA 3VU1A 2RTRB 1Y4HA 2XKLA 4DMYA 2DC8A 3U03A 4TLJA 4QYPA 1A6RA 2G5LA 3TGCA 2BT9A 4ZHGA 3RNVA 4EDEA 1STRB 2BDZA 4N4ZA 3IA8A 1VWAB 1EPAA 4O3YA 1RXKA 4CZWA 1A57A 1FEMA 3H7DA 3NQ3A 4U8UN 2RTFB 3JSQA 2IZCB 2LBVA 2X46A 5LJKA 2CIOA 3HPEA 1Y9LA 3SOTA 1SWNA 5H9NA 1SXYA 4D8EA 3ZZVA 3OF8A 1VWNB 1TVQA 5AEOA 5LJEA 2AYOA 4BX7B 4KH8A 1PIPA 2N93A 3ZW0A 3OF9A 3I06A 2RTPB 3BS2A 1N9YA 1RAVA 1GT5A 3KFHA 3MP2A 3I0AA 5B2AO 2DCBA 3WXEA 4N7DA 1QMYA 2WBFX 4ZCBA 2IZBA 2W2BA 3FDCA 2ASNX 4I3CA 4JNJA 1AVGI 1U9WA 2LBAA 3FR5A 2UZJA 2OVSA 2AT6X 4P6EA 1LDOA 3FLLA 2G78A 1DZPA 5IRUA 2X55A 4MVLA 4MVEA 5B27A 4ZR2A 4Z2VA 4AXMA 4RY2A 5HA1A 1IKEA 1QXPA 2DCAA 5EZSA 4U8UO 3ZNHA 5F02A 2B1NA 3JQOA 5FPWA 1ICMA 4L3RA 2BTWB 3O22A 1BSQA 1AU3A 1DZKA 1T8VA 4NYQA 4I60A 4ZH9A 4ES7A 1JZUA 3ZW1B 1KFXL 1R0UA 1VYGA 2IZKA 4IUMA 2IZGB 2YJ2A 4HPCA 4TKHA 1CJLA 4GGZA 2YJ8A 1EWOA 1SRHA 3USVA 1X8QA 3OE3A 4YYRA 4BS5A 1CBSA 1EWLA 3EMMA 3SLOA 1AECA 3O0UA 4MZOA 4XUIA 2DJGA 5K68A 3T6FA 2F01A 1A2DA 2R56A 3FA6A 4FJCA 3WYQA 1DC9A 1HMTA 3K9MA 1GLOA 3APXA 2L9CA 2O62A 2FO5A 3CMPA 1SWDA 1CBQA 3U0DA 3BSZE 4ORRA 3FELA 1VYFA 1IIUA 4CPHB 2HHNA 5LJBA 1HMRA 3CBKA 5IO7A 2F7DA 4WURA 1L6MA 4L1NA 1LDQA 1KL3A 3B2JA 2P86A 3EYCA 2K62A 3C76X 3EM0A 5CVMA 1VWQB 4FK5A 3WJGA 4ID2A 4Y0PA 3EW2A 2HZQA 1Y52X 1AB0A 1VWCB 2FKJA 4D6BA 1W6FA 3WZOA 3CKGA 4X6JA 1GKAA 4M7MA 4MVKA 1STFE 5HZ9A 1BSYA 1U5IA 3X00A 4YKOA 3N3GA 1EQDA 4KT5A 3FR2A 4ZGFA 2WEWA 4WFVA 4CK4A 4LZUA 4TJZA 2Z4IA 2RTMA 2PADA 2G7YA 4N79A 5FFHA 5L8OA 5K67A 2RCTA 4FQBB 4ML7B 4OW0A 4AZPA 1UYNX 3QJ3A 4ORSA 5L8IA 4O49A 2CAMA 4Z28A 1NPZA 1HUCB 4QZTA 1YT7A 2GJ5A 5AJBA 3BPMA 4XR7A 3STMX 2OZQA 2RTKA 5H9LA 3BX7A 5LJCA 1SLDB 4YGGA 3CBSA 1JV4A 4IB9A 1OEKA 3W31A 2OFMX 2JOZA 1SWOA 5A24A 4HPBA 1S2PA 1FJ1E 3OJYC 3FA8A 1AU2A 3S5XA 3FA7A 2JW1A 4MSXA 3PDFA 1QY0A 1SWTA 3WZPA 1LELA 3NADA 3H89A 1U9XA 4N8WA 1XKGA 3KWBX 1VWFB 2Q9SA 4IABA 4BOZA 3BOWA 4ARHA 3BDRA 2GTLM 2RQ0A 1BRPA 5B10O 2ZSCA 2A8GA 3B2KA 1QG5A 2BS5A 4AXLA 2X56A 4MVIA 1KXOA 2IZIA 2GFOA 3PHUA 1NB3A 1U17A 2R6NA 1VWHB 5IO5A 4TKBA 1G5WA 3MORA 4FIPA 4QGXA 2OY7A 5H8TA 1S7DA 5B29A 1OBPA 4K19A 4GE1A 1XCAA 2C1QA 1EIIA 5HTDA 4TKJA 4ZGUA 2JQGR 3WXQA 2J7QC 3MHSA 4BQUA 1NP1A 1RSUB 3VG7A 1YWDA 1OSPO 4WHIA 5HCEC 1MM9A 5F1EA 4N7CA 4ORXA 1TW4A 4LQZA 3B79A 3IV2A 1H91A 4TNNA 1T68X 4HWMA 3FENA 2I5ZO 3V6CA 3CR6A 4WBKA 2OULA 5EZQA 1VWIB 1OPBA 2MF6A 2PREA 1BWYA 1ERXA 2OY1O 1KHPA 1EWPA 4MI7A 4W5BA 4HPDA 4OMXA 3KFGA 5J94A 3S3RA 3V6EA 3QSDA 5EGWA 1NGLA 3F75A 1RBPA 1KT5A 2NQIA 3HHAA 1NQMA 4CSBA 3PT2A 2A3FX 1DF0A 4YMYA 3HHIA 1BEBA 1ZNGA 2ARYA 1D2UA 2GTLN 1SWSA 1ZNDA 4BOEA 5HBSA 1HBQA 2L67A 1W5RA 3KW9A 2XSTA 4Y5DA 1GT3A 4Y0SA 3VG6A 5F58A 4AZOA 1SY1A 1PE6A 1LF7A 3RDXA 4QH6A 1NP4A 2HZRA 2QOMA 2R9MA 5JR8A 3H6SA 2PBHA 1X8NA 2ZAIA 1IW2A 1KZWA 5CYBA 2L68A 5HZ6A 3LXSA 4CPEA 3ELXA 1KT7A 3ZUOA 2BU3A 3STKA 1PPDA 1PCIA 1RSTB 4COTA 4AZRA 4K7CA 5EEDA 4EFGA 4YFRA 3KFFA 3PPTA 4GU8A 2RTBB 3SZJA 3OVZA 3PECA 4PSQA 3PSEA 1RXJA 1LFOA 1KQXA 3G7XA 3SLTA 1AYWA 5FQ8E 1MX8A 4P6GA 3HD3A 2R9OA 3VGWA 4P16A 4JGLA 1G7NA 2P7UA 2GTLO 4YKMA 2JGSA 1AU0A 4ALBA 1SXWA 3PH5A 2KTSA 2OP3A 1IWDA 2FGSA 4CDEA 3HWDA 1BM5A 3OBLA 4PT5A 4Z2OA 1DEUA 3FMZA 2CZUA 3D95A 2X8SA 2AU1A 5HCCC 4BPVA 1E2TA 2Q2PA 3PNRA 1U9QX 1CBIA 3FW4A 2G8CO 1I04A 5CHKA 1ALBA 3ZW0B 1AELA 3OQCA 4Y0QA 5D8JA 1OPAA 1SWAA 3WXGA 1DF8A 2DCCA 1MEGA 1I06A 4A8ZA 1Z24A 1GX9A 3RDMA 2Z4HA 3IMAA 3CQRA 3TNXA 5F6BA 2HMBA 1GX8A 1NC9A 4KCAA 2A2GA 2X8TA 4BX5B 4PP1A 3LHNA 4C5PA 2AKQA 4I9RA 4U9CA 5HCDC 5DG4A 3NHEA 1X8UA 5B3MO 5F2BA 3RKGA 1LIFA 4GJSA 3P5XA 3K8UA 4YYUA 4NV7A 4BBOA 2FRAA 4Q8HA 3BB7A 4QRXA 3KVNA 4DQ3A 1PBYA 2QCBA 4NYRA 1FELA 3BY0A 2IZDB 2IZHB 4MISA 2X45A 2X34A 1SWEA 1I05A 2A0AA 2FE8A 4R3DA 2WPUA 4GNYA 2QO4A 4KIIA 4UU3A 4ON1A 2FUDA 3MTNA 1G85A 1B56A 1CTEA 1BSOA 2BHVA 3APUA 5LKEA 4QAEA 2RTQB 2DJGB 1F2AA 2XU3A 3N4CA 4Z2PA 3F9DA 2FKGA 4ZH6A 2QO6A 4GH7A 4MM3B 2Y6EA 2X8FA 1HQQA 1SWGA 3HTYA 2I5VO 3PEDA 2FYEA 2GHUA 1W4TA 4D8BA 3C77X 2RTHB 1OEJA 2FLJA 1DZJA 2RTOB 2E4JA 5LJHA 4RF0A 4DCBA 1ML7A 1YVBA 4YBPA 4ZJ0A 2VFBA 3WJCA 4B55A 2AL0X 1EWMA 3HWNA 2QOSC 1JMXA 2P8GA 4INNA 3FR4A 4LKPA 4IB7A 4BX7A 1PTSA 1KT4A 2RTGB 1EUOA 4GUZA 1KXRA 1KQWA 1AVDA 2GH7A 4XMCA 1MX7A 1SY2A 3KKUA 2KD2A 1VWOB 1IFCA 1LIDA 3OVXA 3WJDA 1X9YA 4GNWA 2IPPB 1GMYA 2AT8X 1VWMB 1BGOA 5EZ2A 1CVZA 1MS6A 2H7JA 2B1MA 1SWLA 2FR3A 1S44A 1KGLA 2CB5A 1EPBA 2YMSA 3DTQA 2POAA 2P0RA 2AS8A 3FEPA 3O19A 1KHQA 2DOSA 4M6SA 5CVOB 1NLJA 4XZXA 4ZHDA 4GDZA 1YP7A 2Z84A 1S4VA 5FENA 4EQAC 3SZIA 4OMWA 1YK7A 2L5PA 1SMPI 4ORYA 1ZRYA 1QY2A 3Q6LA 4ORUA 5AJCA 1SWFA 2A5BA 4OVZB 2QMIA 3RE5A 3ZW1A 2RCQA 4D8IA 5JH3A 3PRMA 2ALLX 1LNMA 3VE1A 4GGRA 1MUPA 1NQCA 3AKNA 4CDDA 1UZ2X 3TMPA 3NQ9A 4A60A 4XMEA 1SWQA 3AEHA 1SWPA 1HN2A 2JMBA 1IKJA 3RDUA 4OS3A 3WJFA 2ZAGA 2HD5A 3PRPA 1SA8A 2IZAA 1SLEB 1EIOA 2OVDA 2E02A 1KZXA 3BPFA 2XU4A 2FT2A 3RVXA 1VWPB 3BC3A 2OFAA 3MM0A 2OL8O 3B2HA 1B8EA 2PI3O 3P5WA 3IFUA 5HWZA 1JBHA 3MJ5A 4BCSA 5BYPA 2AT5X 2FWVA 4QYNA 3NPOA 5KICA 3L4RA 1ZNKA 4O4OA 3MBTA 3AUMO 1CS8A 2YJCA 2JU3A 4CPHA 1SNKA 1MHWA 4TQ2A 1X71A 1BLRA 4YCHA 2DC7A 4BX6A 4IMNA 1O1VA 2DJFB 4O4UA 3WXFA 4EKVA 1N9MA 3RE6A 1GXAA 4BJ8A 3UEWA 2VHFA 2A13A 4XMFA 4U3QA 1KFUL 3F8AA 3STNA 4HXDB 1UYOX 5F6ZA 1TOWA 3PHWA 2CM4A 1VWEB 1N7YA 5BVTA 1LPJA 4KLBA 5HZ5A 2PNSA 1CV8A 1JJJA 2R73A 2IBIA 3O1GA 3KSEA 3RVWA 3PH6A 1ZCMA 3B2IA 4WA6A 3CH3X 4NLIA 1HY2A 2OF8A 2FT9A 3HOEA 2NP1A 4REZA 3P6HA 3W30A 4JHQA 4AZMA 1A18A 4PADA 2O6XA 2ATOA 3ELZA 2MWHA 2HH5A 3NP1A 4I04A 3P6FA 3HK1A 3TGAA 3FYFA 4MZSA 4O4XA 4KC7A 1OBQA 3P5VA 1OEEA 2AUXA 3RDQA 5JZEA 2DZZA 4HWYA 5EDCA 4WFUA 4YDBA 1MVGA 3T1DA 1QABE 4I9SA 1LCWA 5KO3A 4NLJA 3LFYA 4IP3A 3D4RA 1WUBA 3VHHA 1T0VA 4ZHFA 1IJ8A 1O0EA 3MVFA 3WZNA 2RD7C 4KC8A 1PVJA 4AZNA 1VWKB 3RZYA 3APWA 4CDCB 2DC6A 3SLJA 4CDFB 1VJVA 2C4IA 3UEUA 1E02A 2F09A 4MEEA 3C78X 2FRSA 1PPNA 4QBBA 2YJBA 1F2CA 2JQFR 5AQ6A 4NW4A 3B2LA 4BVMA 3PQSA 4GDAA 1FDQA 3RWXA 4RKXA 4YVAA 1MEMA 4O9SA 2AMMX 1KT3A 2BDLA 1JIWI 3NX1A 2GTFX 1PADA 4YYSA 5B11O 1P6PA 2ACOA 1SP4B 5BVSA 1VYOA 2JU7A 2M4LA 4CPIA 5KIDA 4DMXA 4LKTA 1DF3A 5LKFA 3MG5A 2BS6A 4CPFA 1BP4A 1LIBA 3HWFA 5FQ6E 3EC5A 2VDFA 1FENA 2QM9A 1IFBA 3RY1A 2OFBA 3C9EA 3EBWA 2AVWA 3S26A 4EEJA 3BY4A 5E6JA 3CH2X 1YUPA 2NQGA 1XKIA 8PCHA 4IB6A 4YFPA 3D9WA 2WEXA 4FBVA 1VWLB 4RUNA 3RBYA 3GAQA 1RLBE 1K3BB 1I9HA 3GCBA 1EI5A 3P6GA 1QFTA 4Q8GA 4A1HA 1ACDA 3P6EA 4M0WA 2AF5A 2Y32A 1RXHA 3DF0A 2DZYA 1YP6A 5EF4A 3CQNA 1NB5A 1UKFA 3O65A 3EW1A 3HOLA 1U9VA 1GT1A 4YGZA 1JJXA 2HLVA 2VFCA 2FTBA 2AGAA 4GK9A 2XU1A 3RSWA 4ZHCA 3RDSA 1STPA 3HWEA 2FS6A 3IOQA 4I07A 4G54A 2GC9A 2KTDA 5H9AA 4GGTA 4MIRA 4BQVA 2C0YA 4GZVA 3AKMA 2UYWA 1SWKA 3LTWA 4I6SA 1B4MA 2NQDB 3FEKA 3RVVA 2NNDA 1SXUA 4OKAA 2BLGA 2EU7X 3T2WA 1VPRA 5KHPA 4XMHA 2MO5A 3HWGA 2R9CA 1ADLA 1EXSA 4FBRA 4ZTBA 4X6HA 5JA7A 3MX7A 3WYPA 1YZBA 1PBHA 5JD2A 2KW1A 1PMPA 3VE2A 5CSEA 1LKEA 1YIVA 1MOYA 2WR6A 3KFIA 4A5UA 1LICA 1CBRA 4R0BA 3D96A 3TRKA 1E00A 1AVEA 4W5CA 2JRIA 4DQ4A 4I3DA 4QQ1A 4ORWA 5D48A 4JO6A 4GD9A 5D47A 1HBPA 3TF6A 1QY1A 1SWHA 1X8OA 1SWJA 4GKCA 1QFVA 1MDCA 1SRFA 1BJ7A 3V8UA 4BOSA 2WSJA 3OD9A 3VG3A 3KFQA 2F73A 5CVNB 1BBPA 2OY8A 2Y3EA 1ATKA 3K3LA 3D97A 3NX2A 2J7QA 2VHSA 1Y55X 3NR3A 3BCNA 2R9FA 1A3YA 2OFRX 3AI8A 1ME4A 2W2AA 1YK8A 3T6LA 1PBOA 2A5CA 2HXZA 5LJGA 1KL4A 1VWBB 3KX1A 2CZTA 2RN4A 5K16A 4BSQA 1LCZA 1M6DA 1SRIA 3RY2A 1HQPA 1LIEA 2OVEA 3WJBA 3CKFA 4ZHHA 4BX5A 1B0OA 3KWZA 1HXZA 4O4SA 3Q34A 3PP6A 1CRBA 2G8JA 2K23A 1BQIA 3APVA 4BS6A 3IUTA 4UU2A 1HXLA 4YYQA 1QOLA 1SWCA 4Y59A 3U8EA 3RDOA 3BU1A 1JMZA 4Z6JA 1I78A 2BSZA 2RTAA 4NNTA 4CDDB 1FTPA 4QRLA 1GT4A 2X4MA 4BOQA 3VHMA 1Q6KA 4EXZA 2A2UA 3ZW2A 1GKAB 2Q2MA 1ICNA 1FE3A 3F6ZB 7PCKA 3KQ0A 4HFOA 4D6AA 2CBRA 3BRNA 4ODDA 3TGBA 3P5UA 1NL6A 1CQDA 5IRWA 3C0RA 4YYWA 3PK2A 1UREA 2AT3X 3NQKA 3CBCA 2HKDA 2G79A 3IFBA 1QDQA 3M99A 1AYUA 4IMOA 2BTWA 1NQNA 2OYBO 1GX3A 2ACTA 2DM5A 5DPQA 1ZNEA 4BX6B 2G7BA 4YH0A 4YVBA 2RTJA 1VSNA 1LUQA 1AU4A 4LZVA 1AQBA 4OS0A
chains in the Genus database with same CATH topology
3LFYA 3WXEA 1QMYA 3OVZA 2WBFX 1AYWA 1O0EA 4P6GA 3HD3A 2R9OA 2P7UA 1GCBA 1U9WA 1AU0A 1TU6A 3F5VA 2FTDA 2OP3A 3S3QA 1IWDA 4P6EA 4CDEA 4CDCB 2DC6A 1DEUA 5CHTA 4I05A 4CDFB 2DCDA 1VJVA 2E01A 4AXMA 2AU1A 4QRVA 4BPVA 1E2TA 4RY2A 3PNRA 1QXPA 2DCAA 1PPNA 1U9QX 4QBBA 2YJBA 2B1NA 5F02A 1F2CA 2JQFR 5FPWA 3D6SA 4BGFA 1CSBB 1AU3A 4YVAA 1ZIVA 1MEMA 2BDLA 3H8CA 1KFXL 1Y08A 2AIMA 3WXGA 2YJ2A 2DCCA 1PADA 1TL9A 1CJLA 1MEGA 4YYSA 1PPOA 2YJ8A 2XU5A 1EWOA 3USVA 4YYRA 4BS5A 1SP4B 4W4UA 3IMAA 3TNXA 4DMXA 2YJ9A 1EWLA 3PBHA 1GECE 1AECA 4QRGA 3O0UA 4YYVA 1BP4A 4MZOA 3BWKA 4XUIA 2DC9A 2DJGA 4PP1A 4C5PA 3QT4A 1ME3A 4FJCA 3NHEA 1BY8A 3K9MA 3K24A 1GLOA 1TLOA 2AUZA 3C9EA 1PPPA 2FO5A 3P5XA 2AVWA 3N3KA 3K8UA 4YYUA 1EF7A 3CH2X 4NV7A 2FRAA 3H8BA 4Q8HA 2NQGA 8PCHA 3D9WA 3ZUAA 2HHNA 4QRXA 1K3BB 3CBKA 2F7DA 3GCBA 4Q8GA 2E00A 4PP2E 2NQAA 3DF0A 2DZYA 5EF4A 2P86A 1NB5A 6PADA 5CVMA 4FK5A 1U9VA 2FUDA 2VFCA 1THEA 2XU1A 3MTNA 2DJFA 1CPJA 1CTEA 3IOQA 4I07A 4G54A 2DJGB 1F2AA 2XU3A 3N4CA 4BQVA 5CHVA 2R9NA 1W6FA 2C0YA 3IHPA 1AIMA 4X6JA 2Y6EA 3LTWA 1STFE 1JQPA 1U5IA 2NQDB 3N3GA 2FYEA 2GHUA 1W4TA 3RVVA 2PADA 2G7YA 4YV8A 4N79A 2R9CA 1YVBA 1ICFA 2G8EA 2VFBA 5PADA 4B55A 1EWMA 3HWNA 3CBJA 4X6HA 5JA7A 3I3TA 1PBHA 3QJ3A 1F2BA 4GUZA 1KXRA 3KKUA 1NPZA 1HUCB 1CB5A 1POPA 1YT7A 2OZ2A 3OVXA 4CDEB 3BPMA 1X9YA 9PAPA 4XR7A 4W5CA 3PW3A 2IPPB 1GMYA 1BGOA 4ZUXU 1CVZA 1MS6A 2H7JA 2B1MA 2CB5A 5A24A 2P0RA 2AS8A 1KHQA 1AU2A 4OELA 1AYVA 5CVOB 1NLJA 4CDCA 4MSXA 3PDFA 1S4VA 4NV8A 4CDFA 3H89A 1U9XA 4N8WA 1XKGA 3KWBX 1YK7A 1YALA 3BOWA 3KFQA 5CVNB 2FRQA 1ATKA 4AXLA 2VHSA 2GFOA 1NB3A 2AYNA 1MIRA 3BCNA 2R6NA 2R9FA 3AI8A 5JH3A 1ME4A 1PXVA 1YK8A 3MORA 2Y5BA 1NQCA 4FIPA 4CDDA 2HXZA 1ITOA 4OEMA 3ERVA 3MHHA 3KX1A 2HD5A 2JQGR 5K16A 4BSQA 1M6DA 2E02A 3MHSA 3BPFA 2XU4A 2FT2A 3KWZA 3RVXA 3BC3A 3OISA 2FQ9A 3E1ZB 4X6IA 2F1GA 3P5WA 3B79A 3IV2A 3IEJA 2G8JA 4PI3A 2E03A 1BQIA 3V6CA 2OULA 2G6DA 2PREA 4BS6A 3IUTA 1KHPA 1EWPA 1QOLA 1MDWA 4YYQA 1CS8A 2YJCA 4W5BA 5J94A 1SNKA 1MHWA 3S3RA 3V6EA 3QSDA 1F29A 1K3BA 3U8EA 5EGWA 1FH0A 2DC7A 2DJFB 3WXFA 3F75A 2BSZA 2NQIA 1Y4HA 3HHAA 4CDDB 4DMYA 2DC8A 1DF0A 3HHIA 2VHFA 1KFUL 1A6RA 2ARYA 1Q6KA 1W5RA 3KW9A 4KLBA 2PNSA 1CV8A 2IBIA 3O1GA 2BDZA 3KSEA 3RVWA 4N4ZA 1ZCMA 4WA6A 3CH3X 7PCKA 3P5UA 1PE6A 1NL6A 1CQDA 4CZWA 4QH6A 4YYWA 3H7DA 4PADA 2O6XA 2ATOA 2R9MA 2HH5A 3H6SA 4I04A 2CIOA 1QDQA 3M99A 1AYUA 2PBHA 4MZSA 3OF8A 3P5VA 1GX3A 2AYOA 2AUXA 3LXSA 2ACTA 1PIPA 1PPDA 1PCIA 2DZZA 3OF9A 4HWYA 3I06A 4K7CA 1VSNA 1AU4A 2DCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LFY A;  3WXE A;  1QMY A;  3OVZ A;  2WBF X;  1AYW A;  1O0E A;  4P6G A;  3HD3 A;  2R9O A;  2P7U A;  1GCB A;  1U9W A;  1AU0 A;  1TU6 A;  3F5V A;  2FTD A;  2OP3 A;  3S3Q A;  1IWD A;  4P6E A;  4CDE A;  4CDC B;  2DC6 A;  1DEU A;  5CHT A;  4I05 A;  4CDF B;  2DCD A;  1VJV A;  2E01 A;  4AXM A;  2AU1 A;  4QRV A;  4BPV A;  4RY2 A;  3PNR A;  1QXP A;  2DCA A;  1PPN A;  1U9Q X;  4QBB A;  2YJB A;  2B1N A;  5F02 A;  1F2C A;  2JQF R;  5FPW A;  3D6S A;  1CSB B;  1AU3 A;  4YVA A;  1ZIV A;  1MEM A;  2BDL A;  3H8C A;  1KFX L;  1Y08 A;  2AIM A;  3WXG A;  2YJ2 A;  2DCC A;  1PAD A;  1TL9 A;  1CJL A;  1MEG A;  4YYS A;  1PPO A;  2YJ8 A;  2XU5 A;  1EWO A;  3USV A;  4YYR A;  4BS5 A;  1SP4 B;  4W4U A;  3IMA A;  3TNX A;  4DMX A;  2YJ9 A;  1EWL A;  3PBH A;  1GEC E;  1AEC A;  4QRG A;  3O0U A;  4YYV A;  1BP4 A;  4MZO A;  3BWK A;  4XUI A;  2DC9 A;  2DJG A;  4PP1 A;  3QT4 A;  1ME3 A;  4FJC A;  3NHE A;  1BY8 A;  3K9M A;  3K24 A;  1GLO A;  1TLO A;  2AUZ A;  3C9E A;  1PPP A;  2FO5 A;  3P5X A;  2AVW A;  3N3K A;  3K8U A;  4YYU A;  1EF7 A;  3CH2 X;  2FRA A;  3H8B A;  4Q8H A;  2NQG A;  8PCH A;  3ZUA A;  2HHN A;  4QRX A;  1K3B B;  3CBK A;  2F7D A;  3GCB A;  4Q8G A;  2E00 A;  4PP2 E;  2NQA A;  3DF0 A;  2DZY A;  5EF4 A;  2P86 A;  1NB5 A;  6PAD A;  5CVM A;  4FK5 A;  1U9V A;  2FUD A;  1THE A;  2XU1 A;  3MTN A;  2DJF A;  1CPJ A;  1CTE A;  3IOQ A;  4I07 A;  4G54 A;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4BQV A;  5CHV A;  2R9N A;  2C0Y A;  3IHP A;  1AIM A;  4X6J A;  2Y6E A;  1STF E;  1JQP A;  1U5I A;  2NQD B;  3N3G A;  2FYE A;  2GHU A;  3RVV A;  2PAD A;  2G7Y A;  4YV8 A;  4N79 A;  2R9C A;  1YVB A;  1ICF A;  2G8E A;  5PAD A;  1EWM A;  3HWN A;  3CBJ A;  4X6H A;  5JA7 A;  3I3T A;  1PBH A;  3QJ3 A;  1F2B A;  1KXR A;  3KKU A;  1NPZ A;  1HUC B;  1CB5 A;  1POP A;  1YT7 A;  2OZ2 A;  3OVX A;  4CDE B;  3BPM A;  1X9Y A;  9PAP A;  4XR7 A;  4W5C A;  3PW3 A;  2IPP B;  1GMY A;  1BGO A;  4ZUX U;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  2CB5 A;  5A24 A;  2P0R A;  2AS8 A;  1KHQ A;  1AU2 A;  4OEL A;  1AYV A;  5CVO B;  1NLJ A;  4CDC A;  4MSX A;  3PDF A;  1S4V A;  4CDF A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  3KWB X;  1YK7 A;  1YAL A;  3BOW A;  3KFQ A;  5CVN B;  2FRQ A;  1ATK A;  4AXL A;  2VHS A;  2GFO A;  1NB3 A;  2AYN A;  1MIR A;  3BCN A;  2R6N A;  2R9F A;  3AI8 A;  5JH3 A;  1ME4 A;  1PXV A;  1YK8 A;  3MOR A;  2Y5B A;  1NQC A;  4FIP A;  4CDD A;  2HXZ A;  1ITO A;  4OEM A;  3ERV A;  3MHH A;  3KX1 A;  2HD5 A;  2JQG R;  5K16 A;  4BSQ A;  1M6D A;  2E02 A;  3MHS A;  3BPF A;  2XU4 A;  2FT2 A;  3KWZ A;  3RVX A;  3BC3 A;  3OIS A;  2FQ9 A;  3E1Z B;  4X6I A;  2F1G A;  3P5W A;  3B79 A;  3IV2 A;  3IEJ A;  2G8J A;  4PI3 A;  2E03 A;  1BQI A;  3V6C A;  2OUL A;  2G6D A;  2PRE A;  4BS6 A;  3IUT A;  1KHP A;  1EWP A;  1QOL A;  1MDW A;  4YYQ A;  1CS8 A;  2YJC A;  4W5B A;  5J94 A;  1SNK A;  1MHW A;  3S3R A;  3V6E A;  3QSD A;  1F29 A;  1K3B A;  3U8E A;  5EGW A;  1FH0 A;  2DC7 A;  2DJF B;  3WXF A;  3F75 A;  2NQI A;  1Y4H A;  3HHA A;  4CDD B;  4DMY A;  2DC8 A;  1DF0 A;  3HHI A;  2VHF A;  1KFU L;  1A6R A;  2ARY A;  1Q6K A;  3KW9 A;  4KLB A;  2PNS A;  1CV8 A;  2IBI A;  3O1G A;  2BDZ A;  3KSE A;  3RVW A;  4N4Z A;  1ZCM A;  4WA6 A;  3CH3 X;  7PCK A;  3P5U A;  1PE6 A;  1NL6 A;  1CQD A;  4CZW A;  4QH6 A;  4YYW A;  3H7D A;  4PAD A;  2O6X A;  2ATO A;  2R9M A;  2HH5 A;  3H6S A;  4I04 A;  2CIO A;  1QDQ A;  3M99 A;  1AYU A;  2PBH A;  4MZS A;  3OF8 A;  3P5V A;  2AYO A;  2AUX A;  3LXS A;  2ACT A;  1PIP A;  1PPD A;  1PCI A;  2DZZ A;  3OF9 A;  4HWY A;  3I06 A;  4K7C A;  1VSN A;  1AU4 A;  2DCB A; 
#chains in the Genus database with same CATH topology
 1JYJ A;  1SLF B;  5FAZ A;  2RTD B;  3DSZ A;  2Y3F A;  4GET A;  3P6D A;  1CJ5 A;  3VG4 A;  1WBI A;  3FW5 A;  1GCB A;  4QZU A;  3GE2 A;  1TU6 A;  3F5V A;  2FTD A;  3S3Q A;  5D45 A;  1SXX A;  4BOP A;  3N91 A;  2NNQ A;  4RUU A;  3FA9 A;  5CHT A;  4I05 A;  5B5G A;  4GUA A;  2RTL A;  2DCD A;  2E01 A;  4YBU A;  5D4A A;  4QRV A;  1Y9T A;  1JJU A;  5HAE A;  5B5F A;  3O2Y A;  4U46 A;  3ZWE A;  3D6S A;  4FGI B;  4BGF A;  1CSB B;  1ZIV A;  1LCV A;  4NP1 A;  2OL7 A;  3UEV A;  3H8C A;  1ZNH A;  1Y08 A;  2AIM A;  4QGV A;  1ZNL A;  4ZFX A;  2OVA A;  4IAW A;  1KL5 A;  1TL9 A;  1HMS A;  1PPO A;  1Y53 X;  4OVZ A;  1SWB A;  2XU5 A;  3LV4 A;  4I95 A;  4W4U A;  5EDB A;  2YJ9 A;  3PBH A;  1Y0G A;  2AVI A;  1GEC E;  3WZQ A;  4QRG A;  5BVQ A;  4YYV A;  3BWK A;  2DC9 A;  2WQ9 A;  3PHX A;  3QT4 A;  1ME3 A;  3B21 A;  4IB8 A;  2IZF B;  5F7G A;  2AT0 X;  1K24 A;  1BY8 A;  3K24 A;  1X8P A;  2JTC A;  2LFO A;  1TLO A;  2AUZ A;  1PPP A;  5LJD A;  1TOU A;  4PJ2 A;  3N3K A;  1N0S A;  2HYS A;  3UEX A;  4QGW A;  1EF7 A;  1MEP A;  3H8B A;  2IZE B;  2LKK A;  2OL6 O;  3ZUA A;  1E06 A;  3VG5 A;  1X89 A;  1SRJ A;  3P02 A;  2JU8 A;  2FS7 A;  3VPJ E;  1DKI A;  3NBX X;  3JS1 A;  2E00 A;  1EW3 A;  4Y0R A;  4AZQ A;  1DV9 A;  2FR2 A;  1YWA A;  4PP2 E;  2NQA A;  4YDA A;  1VWD B;  1N4J A;  4IRW A;  3E9S A;  6PAD A;  3BLG A;  5EPQ A;  2ANS A;  2LB6 A;  1THE A;  1N43 A;  2AH7 X;  4Z27 A;  2DJF A;  1CPJ A;  1VWG B;  3BU9 A;  2CBS A;  1KT6 A;  1EAL A;  3S60 A;  2ACP X;  5C0N A;  5CHV A;  2R9N A;  1DZM A;  3TZS A;  5FQ7 E;  4YGH A;  3IHP A;  1AIM A;  3VHI A;  2W2F A;  4O3X B;  5HTE A;  3CWK A;  2OF9 A;  4IAX A;  1NBX A;  1JQP A;  5IXG A;  3BX8 A;  2PY1 A;  2RTI B;  2FHN X;  2MM3 A;  2IZJ A;  1SY0 A;  4NNS A;  1VWJ B;  3MTV A;  4DNE A;  1STS B;  4YCE A;  1KOI A;  4YV8 A;  3ZUI A;  1NDJ A;  1O8V A;  2RTN B;  1ICF A;  2G8E A;  1I4U A;  1QQS A;  4AYH A;  5PAD A;  2Q4N A;  2HWK A;  3PQU A;  3CBJ A;  4RF1 A;  1KFF A;  2KT4 B;  2WWP A;  1SRG A;  3I3T A;  2Q39 A;  4XMD A;  5EEE A;  3WJE A;  4HPA A;  1F2B A;  5HZ8 A;  1U0X A;  2X32 A;  4ALO A;  4BOU A;  1GM6 A;  2UZ2 A;  2JN3 A;  4FBO A;  1CB5 A;  1POP A;  3WOV A;  2OZ2 A;  1YWC A;  2IZL B;  3ZI8 A;  4CDE B;  9PAP A;  3P24 A;  2R74 A;  3PW3 A;  1BRQ A;  4YFQ A;  4AW8 A;  3T2X A;  4ZUX U;  2HNX A;  3EBK A;  3FIQ A;  2RA6 A;  3U9P C;  4XMG A;  1VWR B;  4O3Z A;  4A1Y A;  1PM1 X;  4OEL A;  4O3W A;  1AYV A;  1OBU A;  4CDC A;  2QO5 A;  4IBA A;  3BBA A;  3I17 A;  4NV8 A;  1MK5 A;  4CDF A;  1GGL A;  2RTE B;  1YAL A;  4I3B A;  5HA0 A;  2FRQ A;  2WQA E;  4RNA A;  3SZH A;  5L3Y A;  2OY5 O;  1E5P A;  2MHD A;  4CV7 A;  2AYN A;  2WUT A;  1D3S A;  1TXL A;  1MIR A;  2RTC B;  3WBG A;  1JYD A;  1PXV A;  1SRE A;  2BC3 A;  3WVM A;  2C1S A;  2Y5B A;  1ITO A;  3KZA A;  4GJV A;  1O1U A;  4U8U M;  4OEM A;  3FID A;  3QQ2 A;  3ERV A;  3MHH A;  5K06 A;  1ERB A;  5HZQ A;  1G74 A;  2YG2 A;  5CE4 A;  5IO6 A;  2MJI A;  2NNE A;  3OIS A;  2FQ9 A;  2LA7 A;  1YWB A;  3ZQ3 A;  2FHL A;  1SLG B;  1U18 A;  3E1Z B;  1DFV A;  4X6I A;  1SWR A;  2F1G A;  3P6C A;  3E3C A;  4QNI A;  3IEJ A;  2IFB A;  4PI3 A;  2E03 A;  3S5V A;  5H9K A;  2CM9 A;  3SAO A;  1QWD A;  2G6D A;  3UAQ A;  3VG2 A;  4GRJ A;  5IRA A;  3H3I A;  1MDW A;  1SY3 A;  5L8N A;  3QKG A;  1F29 A;  1K3B A;  1SWU A;  4OS8 A;  1FH0 A;  1PEE A;  3VU1 A;  2RTR B;  1Y4H A;  2XKL A;  4DMY A;  2DC8 A;  3U03 A;  4TLJ A;  4QYP A;  1A6R A;  2G5L A;  3TGC A;  2BT9 A;  4ZHG A;  3RNV A;  4EDE A;  1STR B;  2BDZ A;  4N4Z A;  3IA8 A;  1VWA B;  1EPA A;  4O3Y A;  1RXK A;  4CZW A;  1A57 A;  1FEM A;  3H7D A;  3NQ3 A;  4U8U N;  2RTF B;  3JSQ A;  2IZC B;  2LBV A;  2X46 A;  5LJK A;  2CIO A;  3HPE A;  1Y9L A;  3SOT A;  1SWN A;  5H9N A;  1SXY A;  4D8E A;  3ZZV A;  3OF8 A;  1VWN B;  1TVQ A;  5AEO A;  5LJE A;  2AYO A;  4BX7 B;  4KH8 A;  1PIP A;  2N93 A;  3ZW0 A;  3OF9 A;  3I06 A;  2RTP B;  3BS2 A;  1N9Y A;  1RAV A;  1GT5 A;  3KFH A;  3MP2 A;  3I0A A;  5B2A O;  2DCB A;  3WXE A;  4N7D A;  1QMY A;  2WBF X;  4ZCB A;  2IZB A;  2W2B A;  3FDC A;  2ASN X;  4I3C A;  4JNJ A;  1AVG I;  1U9W A;  2LBA A;  3FR5 A;  2UZJ A;  2OVS A;  2AT6 X;  4P6E A;  1LDO A;  3FLL A;  2G78 A;  1DZP A;  5IRU A;  2X55 A;  4MVL A;  4MVE A;  5B27 A;  4ZR2 A;  4Z2V A;  4AXM A;  4RY2 A;  5HA1 A;  1IKE A;  1QXP A;  2DCA A;  5EZS A;  4U8U O;  3ZNH A;  5F02 A;  2B1N A;  3JQO A;  5FPW A;  1ICM A;  4L3R A;  2BTW B;  3O22 A;  1BSQ A;  1AU3 A;  1DZK A;  1T8V A;  4NYQ A;  4I60 A;  4ZH9 A;  4ES7 A;  1JZU A;  3ZW1 B;  1KFX L;  1R0U A;  1VYG A;  2IZK A;  4IUM A;  2IZG B;  2YJ2 A;  4HPC A;  4TKH A;  1CJL A;  4GGZ A;  2YJ8 A;  1EWO A;  1SRH A;  3USV A;  1X8Q A;  3OE3 A;  4YYR A;  4BS5 A;  1CBS A;  1EWL A;  3EMM A;  3SLO A;  1AEC A;  3O0U A;  4MZO A;  4XUI A;  2DJG A;  5K68 A;  3T6F A;  2F01 A;  1A2D A;  2R56 A;  3FA6 A;  4FJC A;  3WYQ A;  1DC9 A;  1HMT A;  3K9M A;  1GLO A;  3APX A;  2L9C A;  2O62 A;  2FO5 A;  3CMP A;  1SWD A;  1CBQ A;  3U0D A;  3BSZ E;  4ORR A;  3FEL A;  1VYF A;  1IIU A;  4CPH B;  2HHN A;  5LJB A;  1HMR A;  3CBK A;  5IO7 A;  2F7D A;  4WUR A;  1L6M A;  4L1N A;  1LDQ A;  1KL3 A;  3B2J A;  2P86 A;  3EYC A;  2K62 A;  3C76 X;  3EM0 A;  5CVM A;  1VWQ B;  4FK5 A;  3WJG A;  4ID2 A;  4Y0P A;  3EW2 A;  2HZQ A;  1Y52 X;  1AB0 A;  1VWC B;  2FKJ A;  4D6B A;  1W6F A;  3WZO A;  3CKG A;  4X6J A;  1GKA A;  4M7M A;  4MVK A;  1STF E;  5HZ9 A;  1BSY A;  1U5I A;  3X00 A;  4YKO A;  3N3G A;  1EQD A;  4KT5 A;  3FR2 A;  4ZGF A;  2WEW A;  4WFV A;  4CK4 A;  4LZU A;  4TJZ A;  2Z4I A;  2RTM A;  2PAD A;  2G7Y A;  4N79 A;  5FFH A;  5L8O A;  5K67 A;  2RCT A;  4FQB B;  4ML7 B;  4OW0 A;  4AZP A;  1UYN X;  3QJ3 A;  4ORS A;  5L8I A;  4O49 A;  2CAM A;  4Z28 A;  1NPZ A;  1HUC B;  4QZT A;  1YT7 A;  2GJ5 A;  5AJB A;  3BPM A;  4XR7 A;  3STM X;  2OZQ A;  2RTK A;  5H9L A;  3BX7 A;  5LJC A;  1SLD B;  4YGG A;  3CBS A;  1JV4 A;  4IB9 A;  1OEK A;  3W31 A;  2OFM X;  2JOZ A;  1SWO A;  5A24 A;  4HPB A;  1S2P A;  1FJ1 E;  3OJY C;  3FA8 A;  1AU2 A;  3S5X A;  3FA7 A;  2JW1 A;  4MSX A;  3PDF A;  1QY0 A;  1SWT A;  3WZP A;  1LEL A;  3NAD A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  3KWB X;  1VWF B;  2Q9S A;  4IAB A;  4BOZ A;  3BOW A;  4ARH A;  3BDR A;  2GTL M;  2RQ0 A;  1BRP A;  5B10 O;  2ZSC A;  2A8G A;  3B2K A;  1QG5 A;  2BS5 A;  4AXL A;  2X56 A;  4MVI A;  1KXO A;  2IZI A;  2GFO A;  3PHU A;  1NB3 A;  1U17 A;  2R6N A;  1VWH B;  5IO5 A;  4TKB A;  1G5W A;  3MOR A;  4FIP A;  4QGX A;  2OY7 A;  5H8T A;  1S7D A;  5B29 A;  1OBP A;  4K19 A;  4GE1 A;  1XCA A;  2C1Q A;  1EII A;  5HTD A;  4TKJ A;  4ZGU A;  2JQG R;  3WXQ A;  2J7Q C;  3MHS A;  4BQU A;  1NP1 A;  1RSU B;  3VG7 A;  1YWD A;  1OSP O;  4WHI A;  5HCE C;  1MM9 A;  5F1E A;  4N7C A;  4ORX A;  1TW4 A;  4LQZ A;  3B79 A;  3IV2 A;  1H91 A;  4TNN A;  1T68 X;  4HWM A;  3FEN A;  2I5Z O;  3V6C A;  3CR6 A;  4WBK A;  2OUL A;  5EZQ A;  1VWI B;  1OPB A;  2MF6 A;  2PRE A;  1BWY A;  1ERX A;  2OY1 O;  1KHP A;  1EWP A;  4MI7 A;  4W5B A;  4HPD A;  4OMX A;  3KFG A;  5J94 A;  3S3R A;  3V6E A;  3QSD A;  5EGW A;  1NGL A;  3F75 A;  1RBP A;  1KT5 A;  2NQI A;  3HHA A;  1NQM A;  4CSB A;  3PT2 A;  2A3F X;  1DF0 A;  4YMY A;  3HHI A;  1BEB A;  1ZNG A;  2ARY A;  1D2U A;  2GTL N;  1SWS A;  1ZND A;  4BOE A;  5HBS A;  1HBQ A;  2L67 A;  1W5R A;  3KW9 A;  2XST A;  4Y5D A;  1GT3 A;  4Y0S A;  3VG6 A;  5F58 A;  4AZO A;  1SY1 A;  1PE6 A;  1LF7 A;  3RDX A;  4QH6 A;  1NP4 A;  2HZR A;  2QOM A;  2R9M A;  5JR8 A;  3H6S A;  2PBH A;  1X8N A;  2ZAI A;  1IW2 A;  1KZW A;  5CYB A;  2L68 A;  5HZ6 A;  3LXS A;  4CPE A;  3ELX A;  1KT7 A;  3ZUO A;  2BU3 A;  3STK A;  1PPD A;  1PCI A;  1RST B;  4COT A;  4AZR A;  4K7C A;  5EED A;  4EFG A;  4YFR A;  3KFF A;  3PPT A;  4GU8 A;  2RTB B;  3SZJ A;  3OVZ A;  3PEC A;  4PSQ A;  3PSE A;  1RXJ A;  1LFO A;  1KQX A;  3G7X A;  3SLT A;  1AYW A;  5FQ8 E;  1MX8 A;  4P6G A;  3HD3 A;  2R9O A;  3VGW A;  4P16 A;  4JGL A;  1G7N A;  2P7U A;  2GTL O;  4YKM A;  2JGS A;  1AU0 A;  4ALB A;  1SXW A;  3PH5 A;  2KTS A;  2OP3 A;  1IWD A;  2FGS A;  4CDE A;  3HWD A;  1BM5 A;  3OBL A;  4PT5 A;  4Z2O A;  1DEU A;  3FMZ A;  2CZU A;  3D95 A;  2X8S A;  2AU1 A;  5HCC C;  4BPV A;  1E2T A;  2Q2P A;  3PNR A;  1U9Q X;  1CBI A;  3FW4 A;  2G8C O;  1I04 A;  5CHK A;  1ALB A;  3ZW0 B;  1AEL A;  3OQC A;  4Y0Q A;  5D8J A;  1OPA A;  1SWA A;  3WXG A;  1DF8 A;  2DCC A;  1MEG A;  1I06 A;  4A8Z A;  1Z24 A;  1GX9 A;  3RDM A;  2Z4H A;  3IMA A;  3CQR A;  3TNX A;  5F6B A;  2HMB A;  1GX8 A;  1NC9 A;  4KCA A;  2A2G A;  2X8T A;  4BX5 B;  4PP1 A;  3LHN A;  4C5P A;  2AKQ A;  4I9R A;  4U9C A;  5HCD C;  5DG4 A;  3NHE A;  1X8U A;  5B3M O;  5F2B A;  3RKG A;  1LIF A;  4GJS A;  3P5X A;  3K8U A;  4YYU A;  4NV7 A;  4BBO A;  2FRA A;  4Q8H A;  3BB7 A;  4QRX A;  3KVN A;  4DQ3 A;  1PBY A;  2QCB A;  4NYR A;  1FEL A;  3BY0 A;  2IZD B;  2IZH B;  4MIS A;  2X45 A;  2X34 A;  1SWE A;  1I05 A;  2A0A A;  2FE8 A;  4R3D A;  2WPU A;  4GNY A;  2QO4 A;  4KII A;  4UU3 A;  4ON1 A;  2FUD A;  3MTN A;  1G85 A;  1B56 A;  1CTE A;  1BSO A;  2BHV A;  3APU A;  5LKE A;  4QAE A;  2RTQ B;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4Z2P A;  3F9D A;  2FKG A;  4ZH6 A;  2QO6 A;  4GH7 A;  4MM3 B;  2Y6E A;  2X8F A;  1HQQ A;  1SWG A;  3HTY A;  2I5V O;  3PED A;  2FYE A;  2GHU A;  1W4T A;  4D8B A;  3C77 X;  2RTH B;  1OEJ A;  2FLJ A;  1DZJ A;  2RTO B;  2E4J A;  5LJH A;  4RF0 A;  4DCB A;  1ML7 A;  1YVB A;  4YBP A;  4ZJ0 A;  2VFB A;  3WJC A;  4B55 A;  2AL0 X;  1EWM A;  3HWN A;  2QOS C;  1JMX A;  2P8G A;  4INN A;  3FR4 A;  4LKP A;  4IB7 A;  4BX7 A;  1PTS A;  1KT4 A;  2RTG B;  1EUO A;  4GUZ A;  1KXR A;  1KQW A;  1AVD A;  2GH7 A;  4XMC A;  1MX7 A;  1SY2 A;  3KKU A;  2KD2 A;  1VWO B;  1IFC A;  1LID A;  3OVX A;  3WJD A;  1X9Y A;  4GNW A;  2IPP B;  1GMY A;  2AT8 X;  1VWM B;  1BGO A;  5EZ2 A;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  1SWL A;  2FR3 A;  1S44 A;  1KGL A;  2CB5 A;  1EPB A;  2YMS A;  3DTQ A;  2POA A;  2P0R A;  2AS8 A;  3FEP A;  3O19 A;  1KHQ A;  2DOS A;  4M6S A;  5CVO B;  1NLJ A;  4XZX A;  4ZHD A;  4GDZ A;  1YP7 A;  2Z84 A;  1S4V A;  5FEN A;  4EQA C;  3SZI A;  4OMW A;  1YK7 A;  2L5P A;  1SMP I;  4ORY A;  1ZRY A;  1QY2 A;  3Q6L A;  4ORU A;  5AJC A;  1SWF A;  2A5B A;  4OVZ B;  2QMI A;  3RE5 A;  3ZW1 A;  2RCQ A;  4D8I A;  5JH3 A;  3PRM A;  2ALL X;  1LNM A;  3VE1 A;  4GGR A;  1MUP A;  1NQC A;  3AKN A;  4CDD A;  1UZ2 X;  3TMP A;  3NQ9 A;  4A60 A;  4XME A;  1SWQ A;  3AEH A;  1SWP A;  1HN2 A;  2JMB A;  1IKJ A;  3RDU A;  4OS3 A;  3WJF A;  2ZAG A;  2HD5 A;  3PRP A;  1SA8 A;  2IZA A;  1SLE B;  1EIO A;  2OVD A;  2E02 A;  1KZX A;  3BPF A;  2XU4 A;  2FT2 A;  3RVX A;  1VWP B;  3BC3 A;  2OFA A;  3MM0 A;  2OL8 O;  3B2H A;  1B8E A;  2PI3 O;  3P5W A;  3IFU A;  5HWZ A;  1JBH A;  3MJ5 A;  4BCS A;  5BYP A;  2AT5 X;  2FWV A;  4QYN A;  3NPO A;  5KIC A;  3L4R A;  1ZNK A;  4O4O A;  3MBT A;  3AUM O;  1CS8 A;  2YJC A;  2JU3 A;  4CPH A;  1SNK A;  1MHW A;  4TQ2 A;  1X71 A;  1BLR A;  4YCH A;  2DC7 A;  4BX6 A;  4IMN A;  1O1V A;  2DJF B;  4O4U A;  3WXF A;  4EKV A;  1N9M A;  3RE6 A;  1GXA A;  4BJ8 A;  3UEW A;  2VHF A;  2A13 A;  4XMF A;  4U3Q A;  1KFU L;  3F8A A;  3STN A;  4HXD B;  1UYO X;  5F6Z A;  1TOW A;  3PHW A;  2CM4 A;  1VWE B;  1N7Y A;  5BVT A;  1LPJ A;  4KLB A;  5HZ5 A;  2PNS A;  1CV8 A;  1JJJ A;  2R73 A;  2IBI A;  3O1G A;  3KSE A;  3RVW A;  3PH6 A;  1ZCM A;  3B2I A;  4WA6 A;  3CH3 X;  4NLI A;  1HY2 A;  2OF8 A;  2FT9 A;  3HOE A;  2NP1 A;  4REZ A;  3P6H A;  3W30 A;  4JHQ A;  4AZM A;  1A18 A;  4PAD A;  2O6X A;  2ATO A;  3ELZ A;  2MWH A;  2HH5 A;  3NP1 A;  4I04 A;  3P6F A;  3HK1 A;  3TGA A;  3FYF A;  4MZS A;  4O4X A;  4KC7 A;  1OBQ A;  3P5V A;  1OEE A;  2AUX A;  3RDQ A;  5JZE A;  2DZZ A;  4HWY A;  5EDC A;  4WFU A;  4YDB A;  1MVG A;  3T1D A;  1QAB E;  4I9S A;  1LCW A;  5KO3 A;  4NLJ A;  3LFY A;  4IP3 A;  3D4R A;  1WUB A;  3VHH A;  1T0V A;  4ZHF A;  1IJ8 A;  1O0E A;  3MVF A;  3WZN A;  2RD7 C;  4KC8 A;  1PVJ A;  4AZN A;  1VWK B;  3RZY A;  3APW A;  4CDC B;  2DC6 A;  3SLJ A;  4CDF B;  1VJV A;  2C4I A;  3UEU A;  1E02 A;  2F09 A;  4MEE A;  3C78 X;  2FRS A;  1PPN A;  4QBB A;  2YJB A;  1F2C A;  2JQF R;  5AQ6 A;  4NW4 A;  3B2L A;  4BVM A;  3PQS A;  4GDA A;  1FDQ A;  3RWX A;  4RKX A;  4YVA A;  1MEM A;  4O9S A;  2AMM X;  1KT3 A;  2BDL A;  1JIW I;  3NX1 A;  2GTF X;  1PAD A;  4YYS A;  5B11 O;  1P6P A;  2ACO A;  1SP4 B;  5BVS A;  1VYO A;  2JU7 A;  2M4L A;  4CPI A;  5KID A;  4DMX A;  4LKT A;  1DF3 A;  5LKF A;  3MG5 A;  2BS6 A;  4CPF A;  1BP4 A;  1LIB A;  3HWF A;  5FQ6 E;  3EC5 A;  2VDF A;  1FEN A;  2QM9 A;  1IFB A;  3RY1 A;  2OFB A;  3C9E A;  3EBW A;  2AVW A;  3S26 A;  4EEJ A;  3BY4 A;  5E6J A;  3CH2 X;  1YUP A;  2NQG A;  1XKI A;  8PCH A;  4IB6 A;  4YFP A;  3D9W A;  2WEX A;  4FBV A;  1VWL B;  4RUN A;  3RBY A;  3GAQ A;  1RLB E;  1K3B B;  1I9H A;  3GCB A;  1EI5 A;  3P6G A;  1QFT A;  4Q8G A;  4A1H A;  1ACD A;  3P6E A;  4M0W A;  2AF5 A;  2Y32 A;  1RXH A;  3DF0 A;  2DZY A;  1YP6 A;  5EF4 A;  3CQN A;  1NB5 A;  1UKF A;  3O65 A;  3EW1 A;  3HOL A;  1U9V A;  1GT1 A;  4YGZ A;  1JJX A;  2HLV A;  2VFC A;  2FTB A;  2AGA A;  4GK9 A;  2XU1 A;  3RSW A;  4ZHC A;  3RDS A;  1STP A;  3HWE A;  2FS6 A;  3IOQ A;  4I07 A;  4G54 A;  2GC9 A;  2KTD A;  5H9A A;  4GGT A;  4MIR A;  4BQV A;  2C0Y A;  4GZV A;  3AKM A;  2UYW A;  1SWK A;  3LTW A;  4I6S A;  1B4M A;  2NQD B;  3FEK A;  3RVV A;  2NND A;  1SXU A;  4OKA A;  2BLG A;  2EU7 X;  3T2W A;  1VPR A;  5KHP A;  4XMH A;  2MO5 A;  3HWG A;  2R9C A;  1ADL A;  1EXS A;  4FBR A;  4ZTB A;  4X6H A;  5JA7 A;  3MX7 A;  3WYP A;  1YZB A;  1PBH A;  5JD2 A;  2KW1 A;  1PMP A;  3VE2 A;  5CSE A;  1LKE A;  1YIV A;  1MOY A;  2WR6 A;  3KFI A;  4A5U A;  1LIC A;  1CBR A;  4R0B A;  3D96 A;  3TRK A;  1E00 A;  1AVE A;  4W5C A;  2JRI A;  4DQ4 A;  4I3D A;  4QQ1 A;  4ORW A;  5D48 A;  4JO6 A;  4GD9 A;  5D47 A;  1HBP A;  3TF6 A;  1QY1 A;  1SWH A;  1X8O A;  1SWJ A;  4GKC A;  1QFV A;  1MDC A;  1SRF A;  1BJ7 A;  3V8U A;  4BOS A;  2WSJ A;  3OD9 A;  3VG3 A;  3KFQ A;  2F73 A;  5CVN B;  1BBP A;  2OY8 A;  2Y3E A;  1ATK A;  3K3L A;  3D97 A;  3NX2 A;  2J7Q A;  2VHS A;  1Y55 X;  3NR3 A;  3BCN A;  2R9F A;  1A3Y A;  2OFR X;  3AI8 A;  1ME4 A;  2W2A A;  1YK8 A;  3T6L A;  1PBO A;  2A5C A;  2HXZ A;  5LJG A;  1KL4 A;  1VWB B;  3KX1 A;  2CZT A;  2RN4 A;  5K16 A;  4BSQ A;  1LCZ A;  1M6D A;  1SRI A;  3RY2 A;  1HQP A;  1LIE A;  2OVE A;  3WJB A;  3CKF A;  4ZHH A;  4BX5 A;  1B0O A;  3KWZ A;  1HXZ A;  4O4S A;  3Q34 A;  3PP6 A;  1CRB A;  2G8J A;  2K23 A;  1BQI A;  3APV A;  4BS6 A;  3IUT A;  4UU2 A;  1HXL A;  4YYQ A;  1QOL A;  1SWC A;  4Y59 A;  3U8E A;  3RDO A;  3BU1 A;  1JMZ A;  4Z6J A;  1I78 A;  2BSZ A;  2RTA A;  4NNT A;  4CDD B;  1FTP A;  4QRL A;  1GT4 A;  2X4M A;  4BOQ A;  3VHM A;  1Q6K A;  4EXZ A;  2A2U A;  3ZW2 A;  1GKA B;  2Q2M A;  1ICN A;  1FE3 A;  3F6Z B;  7PCK A;  3KQ0 A;  4HFO A;  4D6A A;  2CBR A;  3BRN A;  4ODD A;  3TGB A;  3P5U A;  1NL6 A;  1CQD A;  5IRW A;  3C0R A;  4YYW A;  3PK2 A;  1URE A;  2AT3 X;  3NQK A;  3CBC A;  2HKD A;  2G79 A;  3IFB A;  1QDQ A;  3M99 A;  1AYU A;  4IMO A;  2BTW A;  1NQN A;  2OYB O;  1GX3 A;  2ACT A;  2DM5 A;  5DPQ A;  1ZNE A;  4BX6 B;  2G7B A;  4YH0 A;  4YVB A;  2RTJ A;  1VSN A;  1LUQ A;  1AU4 A;  4LZV A;  1AQB A;  4OS0 A; 
#chains in the Genus database with same CATH homology
 3LFY A;  3WXE A;  1QMY A;  3OVZ A;  2WBF X;  1AYW A;  1O0E A;  4P6G A;  3HD3 A;  2R9O A;  2P7U A;  1GCB A;  1U9W A;  1AU0 A;  1TU6 A;  3F5V A;  2FTD A;  2OP3 A;  3S3Q A;  1IWD A;  4P6E A;  4CDE A;  4CDC B;  2DC6 A;  1DEU A;  5CHT A;  4I05 A;  4CDF B;  2DCD A;  1VJV A;  2E01 A;  4AXM A;  2AU1 A;  4QRV A;  4BPV A;  1E2T A;  4RY2 A;  3PNR A;  1QXP A;  2DCA A;  1PPN A;  1U9Q X;  4QBB A;  2YJB A;  2B1N A;  5F02 A;  1F2C A;  2JQF R;  5FPW A;  3D6S A;  4BGF A;  1CSB B;  1AU3 A;  4YVA A;  1ZIV A;  1MEM A;  2BDL A;  3H8C A;  1KFX L;  1Y08 A;  2AIM A;  3WXG A;  2YJ2 A;  2DCC A;  1PAD A;  1TL9 A;  1CJL A;  1MEG A;  4YYS A;  1PPO A;  2YJ8 A;  2XU5 A;  1EWO A;  3USV A;  4YYR A;  4BS5 A;  1SP4 B;  4W4U A;  3IMA A;  3TNX A;  4DMX A;  2YJ9 A;  1EWL A;  3PBH A;  1GEC E;  1AEC A;  4QRG A;  3O0U A;  4YYV A;  1BP4 A;  4MZO A;  3BWK A;  4XUI A;  2DC9 A;  2DJG A;  4PP1 A;  4C5P A;  3QT4 A;  1ME3 A;  4FJC A;  3NHE A;  1BY8 A;  3K9M A;  3K24 A;  1GLO A;  1TLO A;  2AUZ A;  3C9E A;  1PPP A;  2FO5 A;  3P5X A;  2AVW A;  3N3K A;  3K8U A;  4YYU A;  1EF7 A;  3CH2 X;  4NV7 A;  2FRA A;  3H8B A;  4Q8H A;  2NQG A;  8PCH A;  3D9W A;  3ZUA A;  2HHN A;  4QRX A;  1K3B B;  3CBK A;  2F7D A;  3GCB A;  4Q8G A;  2E00 A;  4PP2 E;  2NQA A;  3DF0 A;  2DZY A;  5EF4 A;  2P86 A;  1NB5 A;  6PAD A;  5CVM A;  4FK5 A;  1U9V A;  2FUD A;  2VFC A;  1THE A;  2XU1 A;  3MTN A;  2DJF A;  1CPJ A;  1CTE A;  3IOQ A;  4I07 A;  4G54 A;  2DJG B;  1F2A A;  2XU3 A;  3N4C A;  4BQV A;  5CHV A;  2R9N A;  1W6F A;  2C0Y A;  3IHP A;  1AIM A;  4X6J A;  2Y6E A;  3LTW A;  1STF E;  1JQP A;  1U5I A;  2NQD B;  3N3G A;  2FYE A;  2GHU A;  1W4T A;  3RVV A;  2PAD A;  2G7Y A;  4YV8 A;  4N79 A;  2R9C A;  1YVB A;  1ICF A;  2G8E A;  2VFB A;  5PAD A;  4B55 A;  1EWM A;  3HWN A;  3CBJ A;  4X6H A;  5JA7 A;  3I3T A;  1PBH A;  3QJ3 A;  1F2B A;  4GUZ A;  1KXR A;  3KKU A;  1NPZ A;  1HUC B;  1CB5 A;  1POP A;  1YT7 A;  2OZ2 A;  3OVX A;  4CDE B;  3BPM A;  1X9Y A;  9PAP A;  4XR7 A;  4W5C A;  3PW3 A;  2IPP B;  1GMY A;  1BGO A;  4ZUX U;  1CVZ A;  1MS6 A;  2H7J A;  2B1M A;  2CB5 A;  5A24 A;  2P0R A;  2AS8 A;  1KHQ A;  1AU2 A;  4OEL A;  1AYV A;  5CVO B;  1NLJ A;  4CDC A;  4MSX A;  3PDF A;  1S4V A;  4NV8 A;  4CDF A;  3H89 A;  1U9X A;  4N8W A;  1XKG A;  3KWB X;  1YK7 A;  1YAL A;  3BOW A;  3KFQ A;  5CVN B;  2FRQ A;  1ATK A;  4AXL A;  2VHS A;  2GFO A;  1NB3 A;  2AYN A;  1MIR A;  3BCN A;  2R6N A;  2R9F A;  3AI8 A;  5JH3 A;  1ME4 A;  1PXV A;  1YK8 A;  3MOR A;  2Y5B A;  1NQC A;  4FIP A;  4CDD A;  2HXZ A;  1ITO A;  4OEM A;  3ERV A;  3MHH A;  3KX1 A;  2HD5 A;  2JQG R;  5K16 A;  4BSQ A;  1M6D A;  2E02 A;  3MHS A;  3BPF A;  2XU4 A;  2FT2 A;  3KWZ A;  3RVX A;  3BC3 A;  3OIS A;  2FQ9 A;  3E1Z B;  4X6I A;  2F1G A;  3P5W A;  3B79 A;  3IV2 A;  3IEJ A;  2G8J A;  4PI3 A;  2E03 A;  1BQI A;  3V6C A;  2OUL A;  2G6D A;  2PRE A;  4BS6 A;  3IUT A;  1KHP A;  1EWP A;  1QOL A;  1MDW A;  4YYQ A;  1CS8 A;  2YJC A;  4W5B A;  5J94 A;  1SNK A;  1MHW A;  3S3R A;  3V6E A;  3QSD A;  1F29 A;  1K3B A;  3U8E A;  5EGW A;  1FH0 A;  2DC7 A;  2DJF B;  3WXF A;  3F75 A;  2BSZ A;  2NQI A;  1Y4H A;  3HHA A;  4CDD B;  4DMY A;  2DC8 A;  1DF0 A;  3HHI A;  2VHF A;  1KFU L;  1A6R A;  2ARY A;  1Q6K A;  1W5R A;  3KW9 A;  4KLB A;  2PNS A;  1CV8 A;  2IBI A;  3O1G A;  2BDZ A;  3KSE A;  3RVW A;  4N4Z A;  1ZCM A;  4WA6 A;  3CH3 X;  7PCK A;  3P5U A;  1PE6 A;  1NL6 A;  1CQD A;  4CZW A;  4QH6 A;  4YYW A;  3H7D A;  4PAD A;  2O6X A;  2ATO A;  2R9M A;  2HH5 A;  3H6S A;  4I04 A;  2CIO A;  1QDQ A;  3M99 A;  1AYU A;  2PBH A;  4MZS A;  3OF8 A;  3P5V A;  1GX3 A;  2AYO A;  2AUX A;  3LXS A;  2ACT A;  1PIP A;  1PPD A;  1PCI A;  2DZZ A;  3OF9 A;  4HWY A;  3I06 A;  4K7C A;  1VSN A;  1AU4 A;  2DCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...