4OELA

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
367
structure length
281
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVLHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
total genus 77
structure length 281
sequence length 367
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 4oelA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4oelA02
5EGWA 2DCDA 2IPPB 4X6JA 1CV8A 1TLOA 3ERVA 3DF0A 2FRQA 1SP4B 4BS5A 4YYUA 3WXGA 3N3GA 2G8EA 2G6DA 2B1NA 1F2BA 1HUCB 3RVXA 2GHUA 2YJBA 2OP3A 2DC9A 4P6EA 1Y4HA 4AXLA 3BCNA 1M6DA 2AUZA 1QDQA 1PPNA 4YYWA 3K8UA 1GLOA 1Q6KA 1XKGA 2FTDA 4DMXA 3PBHA 4YV8A 2C0YA 3CBJA 1F29A 2FUDA 4KLBA 3CH3X 4XR7A 4BPVA 1KHPA 1PPDA 1GECE 1Y08A 2AIMA 1CS8A 3CH2X 1POPA 2DC7A 3H8BA 1U9XA 3PW3A 3RVWA 2AYNA 1MEGA 2H7JA 2JQFR 2DCAA 1MIRA 1VJVA 3P5XA 3V6CA 2WBFX 4N8WA 1DF0A 4PP1A 4QH6A 4CDCA 1U9WA 1EF7A 1F2CA 5J94A 3RVVA 3HHAA 2HD5A 5JH3A 3KWBX 3QT4A 3IHPA 1SNKA 3KX1A 1F2AA 2DCBA 2FYEA 2G8JA 3P5UA 1PPPA 7PCKA 4YVAA 5CHTA 3P5WA 3WXEA 3HD3A 1QXPA 2YJ2A 1QMYA 4QBBA 3IUTA 2DZYA 3MHHA 3BPFA 1YK7A 1AIMA 2G7YA 1PIPA 2P86A 4HWYA 1NPZA 1KHQA 2AS8A 2FO5A 1ZCMA 1YK8A 3KW9A 4BSQA 3U8EA 1GCBA 3BWKA 2E00A 2OULA 3M99A 2PREA 2OZ2A 3LFYA 3OISA 1S4VA 3E1ZB 4CDCB 2XU3A 3TNXA 1YALA 2DJGB 1BQIA 1JQPA 2P7UA 4AXMA 1ME3A 3OVZA 2CIOA 3CBKA 1EWLA 2YJ9A 2NQAA 1NQCA 4DMYA 2R9FA 3WXFA 3K24A 4K7CA 2IBIA 3H6SA 3IEJA 1KXRA 3F75A 2DCCA 3KKUA 1AU3A 2FT2A 1AU0A 5FPWA 5CVNB 4P6GA 8PCHA 2R6NA 3I3TA 2DZZA 3O1GA 6PADA 1NLJA 1MHWA 3D6SA 4MZOA 1NB5A 2AU1A 3LXSA 4Q8GA 1BGOA 3OF8A 3P5VA 5CVOB 2NQGA 1FH0A 3O0UA 1AU4A 2AYOA 5CHVA 3I06A 3N3KA 4I07A 3V6EA 1MS6A 1PBHA 9PAPA 1PPOA 3H7DA 4ZUXU 2GFOA 2DJGA 1KFUL 1YVBA 1A6RA 4X6HA 5EF4A 2FRAA 4WA6A 3KSEA 2O6XA 1ZIVA 1CVZA 2R9CA 4YYSA 5F02A 4MSXA 1CB5A 2DC6A 4OELA 1CQDA 2HXZA 1BP4A 1EWOA 2E01A 2B1MA 1PE6A 3IOQA 3C9EA 3S3QA 2ACTA 3H89A 3H8CA 2E02A 1PCIA 3NHEA 2ATOA 1NL6A 4XUIA 4Q8HA 4I05A 4X6IA 4W5CA 3PDFA 4RY2A 2ARYA 3OVXA 2P0RA 3BC3A 1O0EA 1NB3A 2XU1A 4FIPA 2NQDB 1KFXL 3N4CA 2BDLA 2AVWA 5PADA 1TU6A 3IV2A 2VHFA 1PXVA 1CTEA 2JQGR 3IMAA 2XU4A 3QSDA 4CDFB 4CDDB 1IWDA 3KWZA 3GCBA 4CDDA 4CDFA 4PADA 1EWMA 2AUXA 2E03A 3HHIA 3QJ3A 3AI8A 5JA7A 1U9QX 1AECA 2CB5A 3MHSA 1PADA 1MEMA 2XU5A 2HH5A 3HWNA 2FQ9A 1K3BA 1DEUA 5CVMA 4CZWA 1CSBB 4BQVA 4QRGA 1U5IA 3MORA 4W5BA 2DJFB 2R9NA 1K3BB 4BS6A 2BDZA 4N4ZA 3OF9A 5A24A 4PI3A 4OEMA 1TL9A 2DC8A 4MZSA 3KFQA 1U9VA 2NQIA 1GMYA 1AYWA 1EWPA 2F1GA 3F5VA 3USVA 2R9MA 1YT7A 2HHNA 2YJ8A 2Y5BA 3PNRA 4FK5A 4FJCA 3S3RA 1VSNA 4CDEA 1THEA 3MTNA 4I04A 4YYRA 1STFE 2PADA 4W4UA 5K16A 4QRVA 4CDEB 2YJCA 1ICFA 2PBHA 1AYVA 1AU2A 4YYVA 1BY8A 4PP2E 2R9OA 4YYQA 4QRXA 1CJLA 1QOLA 3ZUAA 1CPJA 1X9YA 1ATKA 1MDWA 1ME4A 3BOWA 1ITOA 2Y6EA 2F7DA 2VHSA 4G54A 3K9MA 3B79A 2PNSA 3BPMA 1AYUA 4N79A 2DJFA
chains in the Genus database with same CATH superfamily
5HA1A 1HMSA 2GTFX 2JN3A 4YCEA 1OSPO 4JHQA 3ZUOA 1TLOA 3BB7A 5HZ9A 2J7QA 4QQ1A 4BBOA 2BS6A 5EZ2A 5F2BA 4DQ4A 1ZNGA 1SY3A 1F2BA 3FA8A 1KL4A 2OL7A 2OP3A 2DC9A 2OY8A 3RDMA 4AXLA 3BCNA 4BX6B 1W6FA 2AUZA 5LJCA 4GUAA 1N4JA 3CBSA 5K67A 2IZBA 1ERXA 1SY0A 4GGTA 5AQ6A 4WFUA 1F29A 3LTWA 1AELA 4KLBA 4BPVA 1HY2A 2CBSA 1I05A 1PPDA 1GECE 4KH8A 4KC7A 4HFOA 4XMGA 1KXOA 1IIUA 2XSTA 4NP1A 1N7YA 4ORUA 1CRBA 3OJYC 1VWHB 1IW2A 2AYNA 1EW3A 4EDEA 3GE2A 2JQFR 4A60A 5AEOA 1MIRA 1VJVA 3P5XA 1I78A 2MO5A 1SLDB 2UZ2A 2HZQA 2KD2A 4PP1A 4CV7A 2Q4NA 4CDCA 1QFVA 4O4XA 3WZQA 3JSQA 3K3LA 3OE3A 2A2GA 1RAVA 1E2TA 1HBQA 4Z6JA 3P6FA 1NQNA 3T6FA 4QGXA 1JMXA 4IABA 2DCBA 4IP3A 1SRFA 3ZUIA 2G8JA 3PH5A 4IRWA 1DFVA 7PCKA 3RNVA 2WQ9A 1D3SA 2A2UA 1QMYA 1SLEB 3O65A 3IUTA 1X8NA 5IO7A 1CJ5A 2DZYA 2G7YA 2QO4A 1YWBA 2AS8A 2FO5A 4O3XB 1YK8A 5L8NA 4AZNA 1GCBA 5L8IA 3BWKA 2I5VO 4GJVA 3MM0A 2RTCB 3PK2A 2OULA 3FW4A 4XMFA 5H9LA 4FBRA 3OBLA 2Z4IA 2HYSA 4Y0RA 5B2AO 4A8ZA 3E1ZB 1EIIA 3VG5A 1PEEA 1BM5A 3WJDA 2JGSA 3BDRA 4MVKA 3UEXA 2XU3A 2DJGB 1JIWI 2RTBB 1BQIA 3OQCA 4ORWA 3BS2A 1L6MA 4LKTA 4AZMA 2VDFA 1QWDA 3AUMO 1TVQA 3ZNHA 4O49A 4RKXA 3KZAA 2YJ9A 5B27A 2IZKA 1NQCA 1LIFA 1RLBE 4DMYA 1VWEB 2Y3FA 3WXFA 3PECA 4ZGFA 5IRAA 4ZGUA 2IBIA 3IEJA 3FENA 2DCCA 1A18A 1AU3A 1BEBA 3U0DA 4A1HA 3I3TA 3VHHA 2K23A 6PADA 1GT5A 1NLJA 4ZHCA 3D6SA 2BS5A 1TXLA 1RBPA 2QO5A 3VG6A 4MEEA 3UEUA 3LXSA 4Q8GA 1BGOA 3P5VA 2X45A 3FIDA 3KVNA 3O0UA 1AU4A 2AYOA 3I06A 1PBHA 2GFOA 2DJGA 2QM9A 1YVBA 1A6RA 2DOSA 4X6HA 4ZCBA 1KT5A 2AF5A 3STKA 3C76X 4M7MA 2R9CA 5FQ7E 4YKOA 4D6AA 1CB5A 4ODDA 4YBPA 1VWIB 1CQDA 2HXZA 1BP4A 2OF9A 3BY0A 2FTBA 3IOQA 1P6PA 2RTRB 3RE6A 4R3DA 2ACTA 1Z24A 3CQRA 5F58A 4O9SA 4IB7A 4A5UA 2C1QA 1PCIA 3NHEA 2ATOA 1NL6A 4XUIA 3U03A 2OVDA 4RF0A 2BSZA 1VWGB 4Q8HA 1SXWA 3NR3A 1I06A 3TMPA 1MM9A 4RUUA 4ZH9A 1S2PA 2UYWA 1SWHA 2IZJA 2A5BA 2NQDB 1KFXL 1UREA 2AVWA 2JRIA 5PADA 1NGLA 3EM0A 2AT5X 1DZKA 1VWCB 1LCZA 2XU4A 3P6HA 1MDCA 3N91A 3EW2A 4EQAC 2X8TA 4U9CA 1IWDA 3RDSA 1YP7A 3RBYA 3VG4A 3GCBA 2RCTA 4CDFA 4PADA 5F6BA 1QY0A 1EWMA 2FS6A 4NYRA 1SWAA 1YIVA 4O4UA 5IRWA 5EZQA 1PADA 3APWA 4JGLA 4DNEA 3WJCA 1ALBA 2FQ9A 2AMMX 2IZFB 3NADA 2C1SA 4BQVA 3MORA 4W5BA 1T0VA 2R9NA 4BS6A 2CBRA 3PT2A 1SWGA 4HWMA 4QNIA 3I17A 1S7DA 1JJXA 1RSUB 1KT4A 4K19A 3RY2A 4CSBA 1VWMB 3Q34A 5FQ6E 3AEHA 3HWEA 4Y59A 2L9CA 4ORSA 2R73A 2GTLM 3WBGA 1U9VA 3F5VA 1AYWA 3TF6A 2R9MA 1YT7A 2RTKA 3MG5A 1GKAA 1IFBA 1KL3A 1EALA 1VSNA 3VHMA 2NP1A 1HMRA 1SWSA 4QGWA 3VG2A 4MVEA 3W31A 1AYVA 1HMTA 3T1DA 2R9OA 3ZW0A 4FGIB 4YYQA 1KFFA 5F6ZA 1QOLA 2QCBA 3ZUAA 3BOWA 1MDWA 1ZNLA 3O22A 3CBCA 2Y6EA 3VHIA 2F7DA 3B2IA 3B79A 2PNSA 4WHIA 3FDCA 5F7GA 2JTCA 4N79A 3BU1A 2RTDB 4P16A 1W5RA 1VWRB 2IPPB 4NV7A 1EUOA 4X6JA 3H3IA 3ERVA 3RE5A 3RDUA 4OW0A 1SP4B 4BOEA 3ZW1B 1QABE 1FJ1E 4AW8A 1LIEA 1QFTA 1GM6A 1UZ2X 1ERBA 2GHUA 2YJBA 2X32A 1Y4HA 3C77X 1O1UA 3BRNA 2L67A 3S5VA 1B0OA 2OFMX 4OMWA 4YYWA 3K8UA 3ELZA 3MJ5A 1SLGB 1EXSA 3WJGA 3PBHA 2WR6A 5KIDA 4YV8A 1DZPA 4Y5DA 2FWVA 4AYHA 1SWNA 3CBJA 1G7NA 2FUDA 3APXA 3RDXA 1SWPA 2GTLN 2CZTA 2FKJA 1B8EA 3P02A 3MTVA 5IRUA 2FGSA 1LCVA 1LF7A 2DC7A 3PW3A 2ZSCA 3RVWA 1MEGA 5JZEA 1HQPA 3F8AA 2WBFX 5HZ6A 4ZHGA 4QH6A 5KO3A 5H9KA 3RVVA 2AT3X 4TNNA 3WZPA 3SOTA 1SWOA 5KHPA 1SNKA 3KX1A 3E9SA 2FYEA 1SWDA 5IO5A 2IZDB 1PPPA 4CPFA 4YVAA 1YUPA 5CHTA 3ZQ3A 3WXEA 3HD3A 4QAEA 2CZUA 4OKAA 1K24A 5BYPA 3BX8A 1SWTA 5B3MO 4ZH6A 4DQ3A 5CE4A 2MJIA 2RD7C 1PIPA 2P86A 4PT5A 3EC5A 1MK5A 3KW9A 2Y32A 1NDJA 4BSQA 3SZIA 1GT3A 3U8EA 2OY7A 3LV4A 5BVSA 5C0NA 1SXXA 4TLJA 2PREA 1KQWA 3FA7A 2LB6A 5L3YA 1EI5A 3OISA 2IZIA 4I3CA 2ANSA 4NV8A 4BGFA 1MEPA 1JQPA 4YGZA 2JU3A 1N0SA 2Q39A 4JNJA 2FE8A 1HBPA 1NP1A 3OVZA 4QRLA 3D4RA 1DZJA 2W2AA 3RDOA 1YWCA 3L4RA 1SRJA 5K68A 3K24A 3KKUA 1SWRA 3HWFA 4YCHA 5L8OA 3Q6LA 3PEDA 4YKMA 1KZWA 4P6GA 3WYQA 8PCHA 1VWAB 4GK9A 2DZZA 4OVZB 2OFRX 4MZOA 1A2DA 4UU3A 3O2YA 3PHUA 5B10O 2AU1A 2OVEA 3O19A 4TKJA 3PP6A 2XKLA 1QG5A 2W2FA 1FH0A 5HZ8A 3N3KA 1OEKA 4AZQA 3V6EA 1XKIA 1MS6A 1PPOA 3SZHA 1CBRA 5EF4A 4Z2PA 2MF6A 4WA6A 4Y0QA 4TJZA 2O6XA 2E4JA 1ZIVA 1GXAA 2RQ0A 1SA8A 4L1NA 4CPIA 3TGBA 3FR4A 1XCAA 1EWOA 1FELA 3RSWA 1PTSA 2IFBA 2WSJA 4XZXA 5BVQA 1DKIA 5IO6A 1VWQB 1PE6A 1B56A 1NC9A 4U46A 2AT6X 2GTLO 1OEJA 4I05A 4D8EA 4W5CA 1LNMA 4GKCA 1VWKB 3JQOA 3OVXA 5HAEA 3SLJA 4IMNA 3WJEA 2OFAA 4I9RA 1NB3A 4I9SA 4IB8A 3EBWA 1PVJA 4FIPA 5FENA 4QZTA 1YWAA 2BDLA 4ORXA 2EU7X 5EZSA 5B5FA 1TU6A 3SLTA 1VWBB 1SWCA 1CTEA 2JQGR 3IMAA 3QSDA 1LKEA 4HPBA 5H9AA 1DF8A 1X8QA 1G5WA 3HTYA 2F09A 4CDDA 1AVGI 2AUXA 2E03A 1S44A 3AI8A 1FDQA 2CAMA 4YDBA 2A3FX 3QKGA 3S26A 3UEWA 3BBAA 1MEMA 2HH5A 1JJUA 3WVMA 1Y0GA 1K3BA 1KGLA 1DEUA 5CVMA 1ICMA 1U5IA 2HWKA 4ZHFA 1I4UA 2W2BA 3BX7A 1G85A 4U8UN 4QGVA 1SY1A 3RWXA 1E5PA 1JJJA 1LCWA 3OF9A 5A24A 3ZW1A 1GX9A 4EXZA 1X71A 2OF8A 1KL5A 5IXGA 1TL9A 2RTPB 4I95A 1D2UA 2DC8A 1SXUA 3KFQA 1QY1A 2F1GA 3D97A 1FENA 4ZHDA 2YJ8A 2RTGB 1BRQA 3B21A 3PNRA 2RTEB 1LIDA 1GX8A 3S3RA 3MX7A 2FR2A 3F9DA 4YYRA 3I0AA 2WEWA 3G7XA 2IZAA 3ZW0B 4IMOA 2ZAGA 2AVIA 3JS1A 5FQ8E 2PBHA 2ALLX 1CBSA 4PP2E 1PBYA 3OD9A 2Q9SA 2F73A 3T2XA 1LUQA 1CPJA 1ATKA 4UU2A 4C5PA 2BHVA 4BX5A 3S60A 3BPMA 2OFBA 1AYUA 5HZQA 3NP1A 3FYFA 4IUMA 1UYNX 4BQUA 1CV8A 1BSYA 3NX1A 2FRQA 4BS5A 5F1EA 2X55A 3WXGA 1FEMA 2G8EA 2G6DA 2UZJA 1HUCB 5DPQA 3RVXA 4P6EA 3HWDA 3V8UA 4GNWA 5LJHA 1ZNDA 3AKMA 1VPRA 2RTFB 3PRPA 4ZJ0A 3D96A 5EEDA 4YFPA 2BC3A 1GLOA 1SRIA 4AZPA 3STNA 1UKFA 2OY5O 1AQBA 1GT4A 4YGGA 2P8GA 4OS3A 2C0YA 4O4OA 2WUTA 2X46A 4XR7A 5D48A 1KHPA 5HCCC 4B55A 2AIMA 3ZI8A 1EQDA 2JMBA 1CS8A 4GU8A 3T6LA 3BY4A 1BWYA 3KQ0A 4GE1A 1NP4A 2H7JA 4ZHHA 2DCAA 1KT6A 4O3ZA 1JYDA 3V6CA 3BSZE 3PHXA 3TGCA 5EEEA 1DF0A 1G74A 3B2KA 4FBVA 3EYCA 1EF7A 1F2CA 1B4MA 5J94A 2FRSA 4XMHA 4IBAA 5JH3A 5LKEA 3KFHA 4GDZA 3KWBX 3QT4A 1DC9A 1F2AA 3PRMA 3FA9A 1DV9A 3P5WA 2A13A 1QXPA 2YJ2A 4O3WA 2RN4A 1GX3A 4IAWA 4ZR2A 4QZUA 3FW5A 3BPFA 5D8JA 4IB9A 1AIMA 3APUA 4XMDA 1KHQA 1VWDB 1ZCMA 4OVZA 2FT9A 2RTIB 2QO6A 2E00A 2R56A 1X8UA 1SWKA 1LDOA 2FHLA 2K62A 2OZ2A 2KTSA 1TW4A 3WZOA 2RTLA 3ZWEA 1S4VA 4MISA 4MVLA 1SWEA 3TNXA 4OS0A 1YALA 4NW4A 5HTEA 2ACOA 3DTQA 1PBOA 1KT7A 4BOUA 5LKFA 4AXMA 4PJ2A 4O3YA 1ME3A 4GZVA 1VWLB 3CBKA 1EWLA 1WUBA 2O62A 1SRGA 2LA7A 3CWKA 1VWNB 2NQAA 4ORYA 2G7BA 5B5GA 2MWHA 2R9FA 4D8BA 1SWUA 5LJDA 3WOVA 4K7CA 1TOUA 1SXYA 5CYBA 3H6SA 1Y52X 3F75A 1OPAA 1AU0A 3VPJE 5CVNB 2BT9A 2WQAE 3FELA 4RNAA 3DSZA 1VWOB 3ZW2A 1SWBA 1MHWA 1R0UA 4QYNA 1U0XA 3KFIA 1KT3A 2R74A 5HTDA 1E06A 5HZ5A 4WURA 3ELXA 3C0RA 3EMMA 4I07A 9PAPA 3H7DA 4ZUXU 5D4AA 1KFUL 2MM3A 4OS8A 1H91A 2FRAA 2DM5A 3KSEA 3PPTA 4COTA 4O4SA 1ZNHA 1EPBA 1LPJA 5KICA 3RKGA 5F02A 1OBPA 1BSQA 3F6ZB 1SWQA 2DC6A 3VE2A 4GD9A 1JMZA 4M6SA 3PHWA 4YFQA 1A57A 3C9EA 3LHNA 1KQXA 1IKEA 2OY1O 3MVFA 2KTDA 4HPAA 3H89A 3H8CA 2E02A 4I3DA 1SREA 4D6BA 2JOZA 4KT5A 2KT4B 3PDFA 1NBXA 2ARYA 2WWPA 4I6SA 1SY2A 3HOEA 2P0RA 2NNDA 1PMPA 5H9NA 4IB6A 2ASNX 3BC3A 4TKBA 1O0EA 1SMPI 4WFVA 4PSQA 1Y53X 3CMPA 3VU1A 3FR5A 2RTAA 2OL6O 4I3BA 1N9YA 3IFBA 2VHFA 3UEVA 1TOWA 1PXVA 4INNA 4CDFB 1MVGA 2QMIA 3S5XA 4LKPA 4ALOA 3C78X 2CM9A 4ID2A 5JA7A 4GNYA 4R0BA 4BCSA 1SLFB 2HLVA 2BLGA 1AECA 2CB5A 3CKGA 4XMCA 4YGHA 2A5CA 2YMSA 2BTWB 3E3CA 1LIBA 4YVBA 2F01A 2WPUA 2AT8X 3MBTA 1X89A 3VE1A 2FR3A 4BVMA 4MM3B 5H8TA 1CSBB 4QRGA 1VYGA 5FAZA 1RXHA 2VFCA 4FBOA 1VWFB 1FE3A 1T68X 1MOYA 3VGWA 4GGZA 2BDZA 1GT1A 1KZXA 1RXJA 3CR6A 5AJCA 2X8SA 2G79A 1KOIA 1W4TA 4N4ZA 1WBIA 2RTQB 3NPOA 4GETA 4OEMA 3UAQA 3FR2A 4N7CA 1YP6A 4WBKA 2RCQA 3D9WA 3P6GA 2Q2PA 1AVDA 1EIOA 4BOSA 1GKAB 2NQIA 1EPAA 1GMYA 1EWPA 4Z2OA 5HCEC 2Y5BA 1QY2A 4HXDB 2OL8O 3APVA 1I9HA 4FJCA 1LELA 3FMZA 2IZLB 1THEA 4ZFXA 4I04A 5E6JA 4W4UA 4CDEB 2LBVA 2YJCA 1E02A 5LJGA 1ICFA 1ML7A 2MHDA 1AU2A 4EKVA 4BJ8A 3NQ3A 2Z84A 5LJEA 4L3RA 5EDBA 3W30A 4Z28A 2FLJA 1ADLA 4NNTA 4BX5B 3WJFA 1X9YA 2N93A 1ME4A 3B2JA 4TKHA 2VHSA 1JYJA 5D45A 4G54A 1NQMA 3EBKA 4EFGA 4GDAA 1BSOA 5FFHA 5EGWA 2DCDA 1CBQA 3NX2A 2Y3EA 3P24A 1O1VA 2C4IA 4Y0SA 3DF0A 1JV4A 4YFRA 3GAQA 4I60A 4YYUA 4MVIA 3N3GA 2B1NA 1STRB 2AGAA 2FKGA 4Z27A 2Z4HA 5K06A 1M6DA 2HMBA 2M4LA 4MIRA 2IZHB 2GJ5A 1QDQA 1PPNA 1SRHA 2AH7X 5HCDC 1Q6KA 2JU7A 1XKGA 2FTDA 4LZVA 4DMXA 4YMYA 2G5LA 2CM4A 3CH3X 3TRKA 3WZNA 3NQKA 1Y08A 1X8PA 3WJBA 1JZUA 3CH2X 1POPA 5HA0A 2HZRA 2X8FA 3H8BA 1U9XA 1BLRA 2FS7A 3RDQA 1IJ8A 1RSTB 2OYBO 4N8WA 1UYOX 4YH0A 1U9WA 1MX8A 3HHAA 2HD5A 3WXQA 1Y9LA 1BBPA 4ALBA 3IHPA 1T8VA 4N7DA 1U18A 4BX6A 2OZQA 4REZA 4CPEA 4YBUA 3P5UA 4AZOA 1IKJA 2A0AA 2BU3A 1LFOA 3FEPA 1LDQA 5B11O 4QBBA 1GGLA 3STMX 2X4MA 4AZRA 3MHHA 1YK7A 1HQQA 2X56A 4HWYA 1NPZA 5CSEA 3RZYA 3AKNA 3NBXX 3D95A 1HXZA 3P6DA 2YG2A 4YDAA 2QOSC 4DCBA 3BU9A 1VWPB 3M99A 3EW1A 2KW1A 2QOMA 4HPCA 3LFYA 3KFFA 3FEKA 3FLLA 4GGRA 4A1YA 2RTMA 4CDCB 4LZUA 3MP2A 2PY1A 4GJSA 3FA6A 1ZNKA 3IFUA 4NNSA 2P7UA 3TGAA 2RTJA 2X34A 4ES7A 2CIOA 1IFCA 3SZJA 2PI3O 4U8UO 5HBSA 4D8IA 4ON1A 4JO6A 3ZZVA 4CK4A 2JU8A 3B2HA 1A3YA 1YWDA 2ZAIA 1KXRA 3VG3A 2FT2A 3NQ9A 4KIIA 2RTOB 1OEEA 3IA8A 5FPWA 2R6NA 2LFOA 1Y55X 5HWZA 4OMXA 1STSB 3O1GA 1O8VA 3KFGA 5CHKA 2AKQA 1NB5A 1SWLA 3PQUA 5EPQA 3HOLA 3OF8A 5CVOB 3HPEA 2VFBA 2NQGA 1STPA 1OBUA 4BOPA 4EEJA 5CHVA 4LQZA 2IZGB 4M0WA 4RF1A 4TQ2A 2L5PA 4IAXA 4NLIA 5DG4A 4GUZA 4QYPA 2FHNX 1CVZA 4YYSA 1RXKA 4CPHA 2HNXA 1E00A 2RTNB 5EDCA 2GC9A 5D47A 4MSXA 1X8OA 4OELA 4U8UM 1I04A 2E01A 2B1MA 1QQSA 1DZMA 4GRJA 2G78A 2LKKA 2BTWA 3TZSA 3S3QA 5LJBA 4NYQA 3PSEA 2ACPX 2RTHB 5AJBA 2HKDA 4ARHA 5JR8A 1N9MA 4X6IA 1ICNA 2J7QC 4RY2A 3HK1A 3RY1A 4XMEA 3PQSA 4KC8A 3VG7A 4U3QA 2AT0X 1BRPA 2XU1A 1LICA 5BVTA 3N4CA 3T2WA 3QQ2A 3IV2A 4BX7A 3PH6A 4CDDB 3CKFA 1MX7A 4CPHB 3KWZA 2A8GA 4BOQA 1HXLA 4BOZA 3HHIA 1VWJB 3QJ3A 1SWFA 2IZEB 4MI7A 1U9QX 4RUNA 4Y0PA 1Y9TA 3MHSA 4ORRA 2XU5A 1JBHA 4GH7A 3X00A 1ACDA 1YZBA 1ZRYA 3HWNA 3SLOA 2JW1A 4CZWA 3CQNA 2AL0X 2DJFB 1K3BB 3P6EA 2NNEA 1AB0A 2POAA 1AVEA 2I5ZO 2GH7A 4PI3A 2RA6A 1U17A 4Z2VA 2OVSA 2L68A 3WYPA 4NLJA 4MZSA 2Q2MA 1MUPA 1N43A 3U9PC 5B29A 2G8CO 4BX7B 3USVA 2HHNA 2NNQA 4FK5A 4ML7B 4CDEA 3MTNA 4KCAA 1BJ7A 1STFE 3FIQA 2PADA 2WEXA 5JD2A 2IZCB 4QRVA 5K16A 3P6CA 5LJKA 1VYFA 4FQBB 4YYVA 1OPBA 1BY8A 3B2LA 1FTPA 1ZNEA 4QRXA 1HN2A 1OBQA 1CJLA 4HPDA 1VYOA 2OVAA 1DF3A 1ITOA 3BLGA 1CBIA 3SAOA 3K9MA 3HWGA 4ZTBA 1PM1X 2LBAA 1SWJA 2DJFA
chains in the Genus database with same CATH topology
5EGWA 2DCDA 1W5RA 2IPPB 4NV7A 4X6JA 1CV8A 1TLOA 3ERVA 3DF0A 2FRQA 1SP4B 4BS5A 4YYUA 3WXGA 3N3GA 2G8EA 2G6DA 2B1NA 1F2BA 1HUCB 3RVXA 2GHUA 2YJBA 2OP3A 2DC9A 4P6EA 1Y4HA 4AXLA 3BCNA 1M6DA 1W6FA 2AUZA 1QDQA 1PPNA 4YYWA 3K8UA 1GLOA 1Q6KA 1XKGA 2FTDA 4DMXA 3PBHA 4YV8A 2C0YA 3CBJA 1F29A 2FUDA 3LTWA 4KLBA 3CH3X 4XR7A 4BPVA 1KHPA 1PPDA 1GECE 4B55A 1Y08A 2AIMA 1CS8A 3CH2X 1POPA 2DC7A 3H8BA 1U9XA 3PW3A 3RVWA 2AYNA 1MEGA 2H7JA 2JQFR 2DCAA 1MIRA 1VJVA 3P5XA 3V6CA 2WBFX 4N8WA 1DF0A 4PP1A 4QH6A 4CDCA 1U9WA 1EF7A 1F2CA 5J94A 3RVVA 3HHAA 2HD5A 5JH3A 3KWBX 1E2TA 3QT4A 3IHPA 1SNKA 3KX1A 1F2AA 2DCBA 2FYEA 2G8JA 3P5UA 1PPPA 7PCKA 4YVAA 5CHTA 3P5WA 3WXEA 3HD3A 1QXPA 2YJ2A 1QMYA 1GX3A 4QBBA 3IUTA 2DZYA 3MHHA 3BPFA 1YK7A 1AIMA 2G7YA 1PIPA 2P86A 4HWYA 1NPZA 1KHQA 2AS8A 2FO5A 1ZCMA 1YK8A 3KW9A 4BSQA 3U8EA 1GCBA 3BWKA 2E00A 2OULA 3M99A 2PREA 2OZ2A 3LFYA 3OISA 1S4VA 3E1ZB 4CDCB 2XU3A 3TNXA 1YALA 2DJGB 4NV8A 1BQIA 4BGFA 1JQPA 2P7UA 4AXMA 1ME3A 3OVZA 2CIOA 3CBKA 1EWLA 2YJ9A 2NQAA 1NQCA 4DMYA 2R9FA 3WXFA 3K24A 4K7CA 2IBIA 3H6SA 3IEJA 1KXRA 3F75A 2DCCA 3KKUA 1AU3A 2FT2A 1AU0A 5FPWA 5CVNB 4P6GA 8PCHA 2R6NA 3I3TA 2DZZA 3O1GA 6PADA 1NLJA 1MHWA 3D6SA 4MZOA 1NB5A 2AU1A 3LXSA 4Q8GA 1BGOA 3OF8A 3P5VA 5CVOB 2NQGA 2VFBA 1FH0A 3O0UA 1AU4A 2AYOA 5CHVA 3I06A 3N3KA 4I07A 3V6EA 1MS6A 1PBHA 9PAPA 1PPOA 3H7DA 4ZUXU 2GFOA 2DJGA 1KFUL 1YVBA 1A6RA 4X6HA 5EF4A 2FRAA 4WA6A 3KSEA 2O6XA 4GUZA 1ZIVA 1CVZA 2R9CA 4YYSA 5F02A 4MSXA 1CB5A 2DC6A 4OELA 1CQDA 2HXZA 1BP4A 1EWOA 2E01A 2B1MA 1PE6A 3IOQA 3C9EA 3S3QA 2ACTA 3H89A 3H8CA 2E02A 1PCIA 3NHEA 2ATOA 1NL6A 4XUIA 2BSZA 4Q8HA 4I05A 4X6IA 4W5CA 3PDFA 4RY2A 2ARYA 3OVXA 2P0RA 3BC3A 1O0EA 1NB3A 2XU1A 4FIPA 2NQDB 1KFXL 3N4CA 2BDLA 2AVWA 5PADA 1TU6A 3IV2A 2VHFA 1PXVA 1CTEA 2JQGR 3IMAA 2XU4A 3QSDA 4CDFB 4CDDB 1IWDA 3KWZA 3GCBA 4CDDA 4CDFA 4PADA 1EWMA 2AUXA 2E03A 3HHIA 3QJ3A 3AI8A 5JA7A 1U9QX 1AECA 2CB5A 3MHSA 1PADA 1MEMA 2XU5A 2HH5A 3HWNA 2FQ9A 1K3BA 1DEUA 5CVMA 4CZWA 1CSBB 4BQVA 4QRGA 1U5IA 3MORA 2VFCA 4W5BA 2DJFB 2R9NA 1K3BB 4BS6A 2BDZA 1W4TA 4N4ZA 3OF9A 5A24A 4PI3A 4OEMA 1TL9A 2DC8A 3D9WA 4MZSA 3KFQA 1U9VA 2NQIA 1GMYA 1AYWA 1EWPA 2F1GA 3F5VA 3USVA 2R9MA 1YT7A 2HHNA 2YJ8A 2Y5BA 3PNRA 4FK5A 4FJCA 3S3RA 1VSNA 4CDEA 1THEA 3MTNA 4I04A 4YYRA 1STFE 2PADA 4W4UA 5K16A 4QRVA 4CDEB 2YJCA 1ICFA 2PBHA 1AYVA 1AU2A 4YYVA 1BY8A 4PP2E 2R9OA 4YYQA 4QRXA 1CJLA 1QOLA 3ZUAA 1CPJA 1X9YA 1ATKA 1MDWA 1ME4A 3BOWA 1ITOA 2Y6EA 2F7DA 2VHSA 4C5PA 4G54A 3K9MA 3B79A 2PNSA 3BPMA 1AYUA 4N79A 2DJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EGW A;  2DCD A;  2IPP B;  4X6J A;  1CV8 A;  1TLO A;  3ERV A;  3DF0 A;  2FRQ A;  1SP4 B;  4BS5 A;  4YYU A;  3WXG A;  3N3G A;  2G8E A;  2G6D A;  2B1N A;  1F2B A;  1HUC B;  3RVX A;  2GHU A;  2YJB A;  2OP3 A;  2DC9 A;  4P6E A;  1Y4H A;  4AXL A;  3BCN A;  1M6D A;  2AUZ A;  1QDQ A;  1PPN A;  4YYW A;  3K8U A;  1GLO A;  1Q6K A;  1XKG A;  2FTD A;  4DMX A;  3PBH A;  4YV8 A;  2C0Y A;  3CBJ A;  1F29 A;  2FUD A;  4KLB A;  3CH3 X;  4XR7 A;  4BPV A;  1KHP A;  1PPD A;  1GEC E;  1Y08 A;  2AIM A;  1CS8 A;  3CH2 X;  1POP A;  2DC7 A;  3H8B A;  1U9X A;  3PW3 A;  3RVW A;  2AYN A;  1MEG A;  2H7J A;  2JQF R;  2DCA A;  1MIR A;  1VJV A;  3P5X A;  3V6C A;  2WBF X;  4N8W A;  1DF0 A;  4PP1 A;  4QH6 A;  4CDC A;  1U9W A;  1EF7 A;  1F2C A;  5J94 A;  3RVV A;  3HHA A;  2HD5 A;  5JH3 A;  3KWB X;  3QT4 A;  3IHP A;  1SNK A;  3KX1 A;  1F2A A;  2DCB A;  2FYE A;  2G8J A;  3P5U A;  1PPP A;  7PCK A;  4YVA A;  5CHT A;  3P5W A;  3WXE A;  3HD3 A;  1QXP A;  2YJ2 A;  1QMY A;  4QBB A;  3IUT A;  2DZY A;  3MHH A;  3BPF A;  1YK7 A;  1AIM A;  2G7Y A;  1PIP A;  2P86 A;  4HWY A;  1NPZ A;  1KHQ A;  2AS8 A;  2FO5 A;  1ZCM A;  1YK8 A;  3KW9 A;  4BSQ A;  3U8E A;  1GCB A;  3BWK A;  2E00 A;  2OUL A;  3M99 A;  2PRE A;  2OZ2 A;  3LFY A;  3OIS A;  1S4V A;  3E1Z B;  4CDC B;  2XU3 A;  3TNX A;  1YAL A;  2DJG B;  1BQI A;  1JQP A;  2P7U A;  4AXM A;  1ME3 A;  3OVZ A;  2CIO A;  3CBK A;  1EWL A;  2YJ9 A;  2NQA A;  1NQC A;  4DMY A;  2R9F A;  3WXF A;  3K24 A;  4K7C A;  2IBI A;  3H6S A;  3IEJ A;  1KXR A;  3F75 A;  2DCC A;  3KKU A;  1AU3 A;  2FT2 A;  1AU0 A;  5FPW A;  5CVN B;  4P6G A;  8PCH A;  2R6N A;  3I3T A;  2DZZ A;  3O1G A;  6PAD A;  1NLJ A;  1MHW A;  3D6S A;  4MZO A;  1NB5 A;  2AU1 A;  3LXS A;  4Q8G A;  1BGO A;  3OF8 A;  3P5V A;  5CVO B;  2NQG A;  1FH0 A;  3O0U A;  1AU4 A;  2AYO A;  5CHV A;  3I06 A;  3N3K A;  4I07 A;  3V6E A;  1MS6 A;  1PBH A;  9PAP A;  1PPO A;  3H7D A;  4ZUX U;  2GFO A;  2DJG A;  1KFU L;  1YVB A;  1A6R A;  4X6H A;  5EF4 A;  2FRA A;  4WA6 A;  3KSE A;  2O6X A;  1ZIV A;  1CVZ A;  2R9C A;  4YYS A;  5F02 A;  4MSX A;  1CB5 A;  2DC6 A;  4OEL A;  1CQD A;  2HXZ A;  1BP4 A;  1EWO A;  2E01 A;  2B1M A;  1PE6 A;  3IOQ A;  3C9E A;  3S3Q A;  2ACT A;  3H89 A;  3H8C A;  2E02 A;  1PCI A;  3NHE A;  2ATO A;  1NL6 A;  4XUI A;  4Q8H A;  4I05 A;  4X6I A;  4W5C A;  3PDF A;  4RY2 A;  2ARY A;  3OVX A;  2P0R A;  3BC3 A;  1O0E A;  1NB3 A;  2XU1 A;  4FIP A;  2NQD B;  1KFX L;  3N4C A;  2BDL A;  2AVW A;  5PAD A;  1TU6 A;  3IV2 A;  2VHF A;  1PXV A;  1CTE A;  2JQG R;  3IMA A;  2XU4 A;  3QSD A;  4CDF B;  4CDD B;  1IWD A;  3KWZ A;  3GCB A;  4CDD A;  4CDF A;  4PAD A;  1EWM A;  2AUX A;  2E03 A;  3HHI A;  3QJ3 A;  3AI8 A;  5JA7 A;  1U9Q X;  1AEC A;  2CB5 A;  3MHS A;  1PAD A;  1MEM A;  2XU5 A;  2HH5 A;  3HWN A;  2FQ9 A;  1K3B A;  1DEU A;  5CVM A;  4CZW A;  1CSB B;  4BQV A;  4QRG A;  1U5I A;  3MOR A;  4W5B A;  2DJF B;  2R9N A;  1K3B B;  4BS6 A;  2BDZ A;  4N4Z A;  3OF9 A;  5A24 A;  4PI3 A;  4OEM A;  1TL9 A;  2DC8 A;  4MZS A;  3KFQ A;  1U9V A;  2NQI A;  1GMY A;  1AYW A;  1EWP A;  2F1G A;  3F5V A;  3USV A;  2R9M A;  1YT7 A;  2HHN A;  2YJ8 A;  2Y5B A;  3PNR A;  4FK5 A;  4FJC A;  3S3R A;  1VSN A;  4CDE A;  1THE A;  3MTN A;  4I04 A;  4YYR A;  1STF E;  2PAD A;  4W4U A;  5K16 A;  4QRV A;  4CDE B;  2YJC A;  1ICF A;  2PBH A;  1AYV A;  1AU2 A;  4YYV A;  1BY8 A;  4PP2 E;  2R9O A;  4YYQ A;  4QRX A;  1CJL A;  1QOL A;  3ZUA A;  1CPJ A;  1X9Y A;  1ATK A;  1MDW A;  1ME4 A;  3BOW A;  1ITO A;  2Y6E A;  2F7D A;  2VHS A;  4G54 A;  3K9M A;  3B79 A;  2PNS A;  3BPM A;  1AYU A;  4N79 A;  2DJF A; 
#chains in the Genus database with same CATH topology
 5HA1 A;  1HMS A;  2GTF X;  2JN3 A;  4YCE A;  1OSP O;  4JHQ A;  3ZUO A;  1TLO A;  3BB7 A;  5HZ9 A;  2J7Q A;  4QQ1 A;  4BBO A;  2BS6 A;  5EZ2 A;  5F2B A;  4DQ4 A;  1ZNG A;  1SY3 A;  1F2B A;  3FA8 A;  1KL4 A;  2OL7 A;  2OP3 A;  2DC9 A;  2OY8 A;  3RDM A;  4AXL A;  3BCN A;  4BX6 B;  1W6F A;  2AUZ A;  5LJC A;  4GUA A;  1N4J A;  3CBS A;  5K67 A;  2IZB A;  1ERX A;  1SY0 A;  4GGT A;  5AQ6 A;  4WFU A;  1F29 A;  3LTW A;  1AEL A;  4KLB A;  4BPV A;  1HY2 A;  2CBS A;  1I05 A;  1PPD A;  1GEC E;  4KH8 A;  4KC7 A;  4HFO A;  4XMG A;  1KXO A;  1IIU A;  2XST A;  4NP1 A;  1N7Y A;  4ORU A;  1CRB A;  3OJY C;  1VWH B;  1IW2 A;  2AYN A;  1EW3 A;  4EDE A;  3GE2 A;  2JQF R;  4A60 A;  5AEO A;  1MIR A;  1VJV A;  3P5X A;  1I78 A;  2MO5 A;  1SLD B;  2UZ2 A;  2HZQ A;  2KD2 A;  4PP1 A;  4CV7 A;  2Q4N A;  4CDC A;  1QFV A;  4O4X A;  3WZQ A;  3JSQ A;  3K3L A;  3OE3 A;  2A2G A;  1RAV A;  1E2T A;  1HBQ A;  4Z6J A;  3P6F A;  1NQN A;  3T6F A;  4QGX A;  1JMX A;  4IAB A;  2DCB A;  4IP3 A;  1SRF A;  3ZUI A;  2G8J A;  3PH5 A;  4IRW A;  1DFV A;  7PCK A;  3RNV A;  2WQ9 A;  1D3S A;  2A2U A;  1QMY A;  1SLE B;  3O65 A;  3IUT A;  1X8N A;  5IO7 A;  1CJ5 A;  2DZY A;  2G7Y A;  2QO4 A;  1YWB A;  2AS8 A;  2FO5 A;  4O3X B;  1YK8 A;  5L8N A;  4AZN A;  1GCB A;  5L8I A;  3BWK A;  2I5V O;  4GJV A;  3MM0 A;  2RTC B;  3PK2 A;  2OUL A;  3FW4 A;  4XMF A;  5H9L A;  4FBR A;  3OBL A;  2Z4I A;  2HYS A;  4Y0R A;  5B2A O;  4A8Z A;  3E1Z B;  1EII A;  3VG5 A;  1PEE A;  1BM5 A;  3WJD A;  2JGS A;  3BDR A;  4MVK A;  3UEX A;  2XU3 A;  2DJG B;  1JIW I;  2RTB B;  1BQI A;  3OQC A;  4ORW A;  3BS2 A;  1L6M A;  4LKT A;  4AZM A;  2VDF A;  1QWD A;  3AUM O;  1TVQ A;  3ZNH A;  4O49 A;  4RKX A;  3KZA A;  2YJ9 A;  5B27 A;  2IZK A;  1NQC A;  1LIF A;  1RLB E;  4DMY A;  1VWE B;  2Y3F A;  3WXF A;  3PEC A;  4ZGF A;  5IRA A;  4ZGU A;  2IBI A;  3IEJ A;  3FEN A;  2DCC A;  1A18 A;  1AU3 A;  1BEB A;  3U0D A;  4A1H A;  3I3T A;  3VHH A;  2K23 A;  6PAD A;  1GT5 A;  1NLJ A;  4ZHC A;  3D6S A;  2BS5 A;  1TXL A;  1RBP A;  2QO5 A;  3VG6 A;  4MEE A;  3UEU A;  3LXS A;  4Q8G A;  1BGO A;  3P5V A;  2X45 A;  3FID A;  3KVN A;  3O0U A;  1AU4 A;  2AYO A;  3I06 A;  1PBH A;  2GFO A;  2DJG A;  2QM9 A;  1YVB A;  1A6R A;  2DOS A;  4X6H A;  4ZCB A;  1KT5 A;  2AF5 A;  3STK A;  3C76 X;  4M7M A;  2R9C A;  5FQ7 E;  4YKO A;  4D6A A;  1CB5 A;  4ODD A;  4YBP A;  1VWI B;  1CQD A;  2HXZ A;  1BP4 A;  2OF9 A;  3BY0 A;  2FTB A;  3IOQ A;  1P6P A;  2RTR B;  3RE6 A;  4R3D A;  2ACT A;  1Z24 A;  3CQR A;  5F58 A;  4O9S A;  4IB7 A;  4A5U A;  2C1Q A;  1PCI A;  3NHE A;  2ATO A;  1NL6 A;  4XUI A;  3U03 A;  2OVD A;  4RF0 A;  2BSZ A;  1VWG B;  4Q8H A;  1SXW A;  3NR3 A;  1I06 A;  3TMP A;  1MM9 A;  4RUU A;  4ZH9 A;  1S2P A;  2UYW A;  1SWH A;  2IZJ A;  2A5B A;  2NQD B;  1KFX L;  1URE A;  2AVW A;  2JRI A;  5PAD A;  1NGL A;  3EM0 A;  2AT5 X;  1DZK A;  1VWC B;  1LCZ A;  2XU4 A;  3P6H A;  1MDC A;  3N91 A;  3EW2 A;  4EQA C;  2X8T A;  4U9C A;  1IWD A;  3RDS A;  1YP7 A;  3RBY A;  3VG4 A;  3GCB A;  2RCT A;  4CDF A;  4PAD A;  5F6B A;  1QY0 A;  1EWM A;  2FS6 A;  4NYR A;  1SWA A;  1YIV A;  4O4U A;  5IRW A;  5EZQ A;  1PAD A;  3APW A;  4JGL A;  4DNE A;  3WJC A;  1ALB A;  2FQ9 A;  2AMM X;  2IZF B;  3NAD A;  2C1S A;  4BQV A;  3MOR A;  4W5B A;  1T0V A;  2R9N A;  4BS6 A;  2CBR A;  3PT2 A;  1SWG A;  4HWM A;  4QNI A;  3I17 A;  1S7D A;  1JJX A;  1RSU B;  1KT4 A;  4K19 A;  3RY2 A;  4CSB A;  1VWM B;  3Q34 A;  5FQ6 E;  3AEH A;  3HWE A;  4Y59 A;  2L9C A;  4ORS A;  2R73 A;  2GTL M;  3WBG A;  1U9V A;  3F5V A;  1AYW A;  3TF6 A;  2R9M A;  1YT7 A;  2RTK A;  3MG5 A;  1GKA A;  1IFB A;  1KL3 A;  1EAL A;  1VSN A;  3VHM A;  2NP1 A;  1HMR A;  1SWS A;  4QGW A;  3VG2 A;  4MVE A;  3W31 A;  1AYV A;  1HMT A;  3T1D A;  2R9O A;  3ZW0 A;  4FGI B;  4YYQ A;  1KFF A;  5F6Z A;  1QOL A;  2QCB A;  3ZUA A;  3BOW A;  1MDW A;  1ZNL A;  3O22 A;  3CBC A;  2Y6E A;  3VHI A;  2F7D A;  3B2I A;  3B79 A;  2PNS A;  4WHI A;  3FDC A;  5F7G A;  2JTC A;  4N79 A;  3BU1 A;  2RTD B;  4P16 A;  1W5R A;  1VWR B;  2IPP B;  4NV7 A;  1EUO A;  4X6J A;  3H3I A;  3ERV A;  3RE5 A;  3RDU A;  4OW0 A;  1SP4 B;  4BOE A;  3ZW1 B;  1QAB E;  1FJ1 E;  4AW8 A;  1LIE A;  1QFT A;  1GM6 A;  1UZ2 X;  1ERB A;  2GHU A;  2YJB A;  2X32 A;  1Y4H A;  3C77 X;  1O1U A;  3BRN A;  2L67 A;  3S5V A;  1B0O A;  2OFM X;  4OMW A;  4YYW A;  3K8U A;  3ELZ A;  3MJ5 A;  1SLG B;  1EXS A;  3WJG A;  3PBH A;  2WR6 A;  5KID A;  4YV8 A;  1DZP A;  4Y5D A;  2FWV A;  4AYH A;  1SWN A;  3CBJ A;  1G7N A;  2FUD A;  3APX A;  3RDX A;  1SWP A;  2GTL N;  2CZT A;  2FKJ A;  1B8E A;  3P02 A;  3MTV A;  5IRU A;  2FGS A;  1LCV A;  1LF7 A;  2DC7 A;  3PW3 A;  2ZSC A;  3RVW A;  1MEG A;  5JZE A;  1HQP A;  3F8A A;  2WBF X;  5HZ6 A;  4ZHG A;  4QH6 A;  5KO3 A;  5H9K A;  3RVV A;  2AT3 X;  4TNN A;  3WZP A;  3SOT A;  1SWO A;  5KHP A;  1SNK A;  3KX1 A;  3E9S A;  2FYE A;  1SWD A;  5IO5 A;  2IZD B;  1PPP A;  4CPF A;  4YVA A;  1YUP A;  5CHT A;  3ZQ3 A;  3WXE A;  3HD3 A;  4QAE A;  2CZU A;  4OKA A;  1K24 A;  5BYP A;  3BX8 A;  1SWT A;  5B3M O;  4ZH6 A;  4DQ3 A;  5CE4 A;  2MJI A;  2RD7 C;  1PIP A;  2P86 A;  4PT5 A;  3EC5 A;  1MK5 A;  3KW9 A;  2Y32 A;  1NDJ A;  4BSQ A;  3SZI A;  1GT3 A;  3U8E A;  2OY7 A;  3LV4 A;  5BVS A;  5C0N A;  1SXX A;  4TLJ A;  2PRE A;  1KQW A;  3FA7 A;  2LB6 A;  5L3Y A;  1EI5 A;  3OIS A;  2IZI A;  4I3C A;  2ANS A;  4NV8 A;  4BGF A;  1MEP A;  1JQP A;  4YGZ A;  2JU3 A;  1N0S A;  2Q39 A;  4JNJ A;  2FE8 A;  1HBP A;  1NP1 A;  3OVZ A;  4QRL A;  3D4R A;  1DZJ A;  2W2A A;  3RDO A;  1YWC A;  3L4R A;  1SRJ A;  5K68 A;  3K24 A;  3KKU A;  1SWR A;  3HWF A;  4YCH A;  5L8O A;  3Q6L A;  3PED A;  4YKM A;  1KZW A;  4P6G A;  3WYQ A;  8PCH A;  1VWA B;  4GK9 A;  2DZZ A;  4OVZ B;  2OFR X;  4MZO A;  1A2D A;  4UU3 A;  3O2Y A;  3PHU A;  5B10 O;  2AU1 A;  2OVE A;  3O19 A;  4TKJ A;  3PP6 A;  2XKL A;  1QG5 A;  2W2F A;  1FH0 A;  5HZ8 A;  3N3K A;  1OEK A;  4AZQ A;  3V6E A;  1XKI A;  1MS6 A;  1PPO A;  3SZH A;  1CBR A;  5EF4 A;  4Z2P A;  2MF6 A;  4WA6 A;  4Y0Q A;  4TJZ A;  2O6X A;  2E4J A;  1ZIV A;  1GXA A;  2RQ0 A;  1SA8 A;  4L1N A;  4CPI A;  3TGB A;  3FR4 A;  1XCA A;  1EWO A;  1FEL A;  3RSW A;  1PTS A;  2IFB A;  2WSJ A;  4XZX A;  5BVQ A;  1DKI A;  5IO6 A;  1VWQ B;  1PE6 A;  1B56 A;  1NC9 A;  4U46 A;  2AT6 X;  2GTL O;  1OEJ A;  4I05 A;  4D8E A;  4W5C A;  1LNM A;  4GKC A;  1VWK B;  3JQO A;  3OVX A;  5HAE A;  3SLJ A;  4IMN A;  3WJE A;  2OFA A;  4I9R A;  1NB3 A;  4I9S A;  4IB8 A;  3EBW A;  1PVJ A;  4FIP A;  5FEN A;  4QZT A;  1YWA A;  2BDL A;  4ORX A;  2EU7 X;  5EZS A;  5B5F A;  1TU6 A;  3SLT A;  1VWB B;  1SWC A;  1CTE A;  2JQG R;  3IMA A;  3QSD A;  1LKE A;  4HPB A;  5H9A A;  1DF8 A;  1X8Q A;  1G5W A;  3HTY A;  2F09 A;  4CDD A;  1AVG I;  2AUX A;  2E03 A;  1S44 A;  3AI8 A;  1FDQ A;  2CAM A;  4YDB A;  2A3F X;  3QKG A;  3S26 A;  3UEW A;  3BBA A;  1MEM A;  2HH5 A;  1JJU A;  3WVM A;  1Y0G A;  1K3B A;  1KGL A;  1DEU A;  5CVM A;  1ICM A;  1U5I A;  2HWK A;  4ZHF A;  1I4U A;  2W2B A;  3BX7 A;  1G85 A;  4U8U N;  4QGV A;  1SY1 A;  3RWX A;  1E5P A;  1JJJ A;  1LCW A;  3OF9 A;  5A24 A;  3ZW1 A;  1GX9 A;  4EXZ A;  1X71 A;  2OF8 A;  1KL5 A;  5IXG A;  1TL9 A;  2RTP B;  4I95 A;  1D2U A;  2DC8 A;  1SXU A;  3KFQ A;  1QY1 A;  2F1G A;  3D97 A;  1FEN A;  4ZHD A;  2YJ8 A;  2RTG B;  1BRQ A;  3B21 A;  3PNR A;  2RTE B;  1LID A;  1GX8 A;  3S3R A;  3MX7 A;  2FR2 A;  3F9D A;  4YYR A;  3I0A A;  2WEW A;  3G7X A;  2IZA A;  3ZW0 B;  4IMO A;  2ZAG A;  2AVI A;  3JS1 A;  5FQ8 E;  2PBH A;  2ALL X;  1CBS A;  4PP2 E;  1PBY A;  3OD9 A;  2Q9S A;  2F73 A;  3T2X A;  1LUQ A;  1CPJ A;  1ATK A;  4UU2 A;  4C5P A;  2BHV A;  4BX5 A;  3S60 A;  3BPM A;  2OFB A;  1AYU A;  5HZQ A;  3NP1 A;  3FYF A;  4IUM A;  1UYN X;  4BQU A;  1CV8 A;  1BSY A;  3NX1 A;  2FRQ A;  4BS5 A;  5F1E A;  2X55 A;  3WXG A;  1FEM A;  2G8E A;  2G6D A;  2UZJ A;  1HUC B;  5DPQ A;  3RVX A;  4P6E A;  3HWD A;  3V8U A;  4GNW A;  5LJH A;  1ZND A;  3AKM A;  1VPR A;  2RTF B;  3PRP A;  4ZJ0 A;  3D96 A;  5EED A;  4YFP A;  2BC3 A;  1GLO A;  1SRI A;  4AZP A;  3STN A;  1UKF A;  2OY5 O;  1AQB A;  1GT4 A;  4YGG A;  2P8G A;  4OS3 A;  2C0Y A;  4O4O A;  2WUT A;  2X46 A;  4XR7 A;  5D48 A;  1KHP A;  5HCC C;  4B55 A;  2AIM A;  3ZI8 A;  1EQD A;  2JMB A;  1CS8 A;  4GU8 A;  3T6L A;  3BY4 A;  1BWY A;  3KQ0 A;  4GE1 A;  1NP4 A;  2H7J A;  4ZHH A;  2DCA A;  1KT6 A;  4O3Z A;  1JYD A;  3V6C A;  3BSZ E;  3PHX A;  3TGC A;  5EEE A;  1DF0 A;  1G74 A;  3B2K A;  4FBV A;  3EYC A;  1EF7 A;  1F2C A;  1B4M A;  5J94 A;  2FRS A;  4XMH A;  4IBA A;  5JH3 A;  5LKE A;  3KFH A;  4GDZ A;  3KWB X;  3QT4 A;  1DC9 A;  1F2A A;  3PRM A;  3FA9 A;  1DV9 A;  3P5W A;  2A13 A;  1QXP A;  2YJ2 A;  4O3W A;  2RN4 A;  1GX3 A;  4IAW A;  4ZR2 A;  4QZU A;  3FW5 A;  3BPF A;  5D8J A;  4IB9 A;  1AIM A;  3APU A;  4XMD A;  1KHQ A;  1VWD B;  1ZCM A;  4OVZ A;  2FT9 A;  2RTI B;  2QO6 A;  2E00 A;  2R56 A;  1X8U A;  1SWK A;  1LDO A;  2FHL A;  2K62 A;  2OZ2 A;  2KTS A;  1TW4 A;  3WZO A;  2RTL A;  3ZWE A;  1S4V A;  4MIS A;  4MVL A;  1SWE A;  3TNX A;  4OS0 A;  1YAL A;  4NW4 A;  5HTE A;  2ACO A;  3DTQ A;  1PBO A;  1KT7 A;  4BOU A;  5LKF A;  4AXM A;  4PJ2 A;  4O3Y A;  1ME3 A;  4GZV A;  1VWL B;  3CBK A;  1EWL A;  1WUB A;  2O62 A;  1SRG A;  2LA7 A;  3CWK A;  1VWN B;  2NQA A;  4ORY A;  2G7B A;  5B5G A;  2MWH A;  2R9F A;  4D8B A;  1SWU A;  5LJD A;  3WOV A;  4K7C A;  1TOU A;  1SXY A;  5CYB A;  3H6S A;  1Y52 X;  3F75 A;  1OPA A;  1AU0 A;  3VPJ E;  5CVN B;  2BT9 A;  2WQA E;  3FEL A;  4RNA A;  3DSZ A;  1VWO B;  3ZW2 A;  1SWB A;  1MHW A;  1R0U A;  4QYN A;  1U0X A;  3KFI A;  1KT3 A;  2R74 A;  5HTD A;  1E06 A;  5HZ5 A;  4WUR A;  3ELX A;  3C0R A;  3EMM A;  4I07 A;  9PAP A;  3H7D A;  4ZUX U;  5D4A A;  1KFU L;  2MM3 A;  4OS8 A;  1H91 A;  2FRA A;  2DM5 A;  3KSE A;  3PPT A;  4COT A;  4O4S A;  1ZNH A;  1EPB A;  1LPJ A;  5KIC A;  3RKG A;  5F02 A;  1OBP A;  1BSQ A;  3F6Z B;  1SWQ A;  2DC6 A;  3VE2 A;  4GD9 A;  1JMZ A;  4M6S A;  3PHW A;  4YFQ A;  1A57 A;  3C9E A;  3LHN A;  1KQX A;  1IKE A;  2OY1 O;  3MVF A;  2KTD A;  4HPA A;  3H89 A;  3H8C A;  2E02 A;  4I3D A;  1SRE A;  4D6B A;  2JOZ A;  4KT5 A;  2KT4 B;  3PDF A;  1NBX A;  2ARY A;  2WWP A;  4I6S A;  1SY2 A;  3HOE A;  2P0R A;  2NND A;  1PMP A;  5H9N A;  4IB6 A;  2ASN X;  3BC3 A;  4TKB A;  1O0E A;  1SMP I;  4WFV A;  4PSQ A;  1Y53 X;  3CMP A;  3VU1 A;  3FR5 A;  2RTA A;  2OL6 O;  4I3B A;  1N9Y A;  3IFB A;  2VHF A;  3UEV A;  1TOW A;  1PXV A;  4INN A;  4CDF B;  1MVG A;  2QMI A;  3S5X A;  4LKP A;  4ALO A;  3C78 X;  2CM9 A;  4ID2 A;  5JA7 A;  4GNY A;  4R0B A;  4BCS A;  1SLF B;  2HLV A;  2BLG A;  1AEC A;  2CB5 A;  3CKG A;  4XMC A;  4YGH A;  2A5C A;  2YMS A;  2BTW B;  3E3C A;  1LIB A;  4YVB A;  2F01 A;  2WPU A;  2AT8 X;  3MBT A;  1X89 A;  3VE1 A;  2FR3 A;  4BVM A;  4MM3 B;  5H8T A;  1CSB B;  4QRG A;  1VYG A;  5FAZ A;  1RXH A;  2VFC A;  4FBO A;  1VWF B;  1FE3 A;  1T68 X;  1MOY A;  3VGW A;  4GGZ A;  2BDZ A;  1GT1 A;  1KZX A;  1RXJ A;  3CR6 A;  5AJC A;  2X8S A;  2G79 A;  1KOI A;  1W4T A;  4N4Z A;  1WBI A;  2RTQ B;  3NPO A;  4GET A;  4OEM A;  3UAQ A;  3FR2 A;  4N7C A;  1YP6 A;  4WBK A;  2RCQ A;  3D9W A;  3P6G A;  2Q2P A;  1AVD A;  1EIO A;  4BOS A;  1GKA B;  2NQI A;  1EPA A;  1GMY A;  1EWP A;  4Z2O A;  5HCE C;  2Y5B A;  1QY2 A;  4HXD B;  2OL8 O;  3APV A;  1I9H A;  4FJC A;  1LEL A;  3FMZ A;  2IZL B;  1THE A;  4ZFX A;  4I04 A;  5E6J A;  4W4U A;  4CDE B;  2LBV A;  2YJC A;  1E02 A;  5LJG A;  1ICF A;  1ML7 A;  2MHD A;  1AU2 A;  4EKV A;  4BJ8 A;  3NQ3 A;  2Z84 A;  5LJE A;  4L3R A;  5EDB A;  3W30 A;  4Z28 A;  2FLJ A;  1ADL A;  4NNT A;  4BX5 B;  3WJF A;  1X9Y A;  2N93 A;  1ME4 A;  3B2J A;  4TKH A;  2VHS A;  1JYJ A;  5D45 A;  4G54 A;  1NQM A;  3EBK A;  4EFG A;  4GDA A;  1BSO A;  5FFH A;  5EGW A;  2DCD A;  1CBQ A;  3NX2 A;  2Y3E A;  3P24 A;  1O1V A;  2C4I A;  4Y0S A;  3DF0 A;  1JV4 A;  4YFR A;  3GAQ A;  4I60 A;  4YYU A;  4MVI A;  3N3G A;  2B1N A;  1STR B;  2AGA A;  2FKG A;  4Z27 A;  2Z4H A;  5K06 A;  1M6D A;  2HMB A;  2M4L A;  4MIR A;  2IZH B;  2GJ5 A;  1QDQ A;  1PPN A;  1SRH A;  2AH7 X;  5HCD C;  1Q6K A;  2JU7 A;  1XKG A;  2FTD A;  4LZV A;  4DMX A;  4YMY A;  2G5L A;  2CM4 A;  3CH3 X;  3TRK A;  3WZN A;  3NQK A;  1Y08 A;  1X8P A;  3WJB A;  1JZU A;  3CH2 X;  1POP A;  5HA0 A;  2HZR A;  2X8F A;  3H8B A;  1U9X A;  1BLR A;  2FS7 A;  3RDQ A;  1IJ8 A;  1RST B;  2OYB O;  4N8W A;  1UYO X;  4YH0 A;  1U9W A;  1MX8 A;  3HHA A;  2HD5 A;  3WXQ A;  1Y9L A;  1BBP A;  4ALB A;  3IHP A;  1T8V A;  4N7D A;  1U18 A;  4BX6 A;  2OZQ A;  4REZ A;  4CPE A;  4YBU A;  3P5U A;  4AZO A;  1IKJ A;  2A0A A;  2BU3 A;  1LFO A;  3FEP A;  1LDQ A;  5B11 O;  4QBB A;  1GGL A;  3STM X;  2X4M A;  4AZR A;  3MHH A;  1YK7 A;  1HQQ A;  2X56 A;  4HWY A;  1NPZ A;  5CSE A;  3RZY A;  3AKN A;  3NBX X;  3D95 A;  1HXZ A;  3P6D A;  2YG2 A;  4YDA A;  2QOS C;  4DCB A;  3BU9 A;  1VWP B;  3M99 A;  3EW1 A;  2KW1 A;  2QOM A;  4HPC A;  3LFY A;  3KFF A;  3FEK A;  3FLL A;  4GGR A;  4A1Y A;  2RTM A;  4CDC B;  4LZU A;  3MP2 A;  2PY1 A;  4GJS A;  3FA6 A;  1ZNK A;  3IFU A;  4NNS A;  2P7U A;  3TGA A;  2RTJ A;  2X34 A;  4ES7 A;  2CIO A;  1IFC A;  3SZJ A;  2PI3 O;  4U8U O;  5HBS A;  4D8I A;  4ON1 A;  4JO6 A;  3ZZV A;  4CK4 A;  2JU8 A;  3B2H A;  1A3Y A;  1YWD A;  2ZAI A;  1KXR A;  3VG3 A;  2FT2 A;  3NQ9 A;  4KII A;  2RTO B;  1OEE A;  3IA8 A;  5FPW A;  2R6N A;  2LFO A;  1Y55 X;  5HWZ A;  4OMX A;  1STS B;  3O1G A;  1O8V A;  3KFG A;  5CHK A;  2AKQ A;  1NB5 A;  1SWL A;  3PQU A;  5EPQ A;  3HOL A;  3OF8 A;  5CVO B;  3HPE A;  2VFB A;  2NQG A;  1STP A;  1OBU A;  4BOP A;  4EEJ A;  5CHV A;  4LQZ A;  2IZG B;  4M0W A;  4RF1 A;  4TQ2 A;  2L5P A;  4IAX A;  4NLI A;  5DG4 A;  4GUZ A;  4QYP A;  2FHN X;  1CVZ A;  4YYS A;  1RXK A;  4CPH A;  2HNX A;  1E00 A;  2RTN B;  5EDC A;  2GC9 A;  5D47 A;  4MSX A;  1X8O A;  4OEL A;  4U8U M;  1I04 A;  2E01 A;  2B1M A;  1QQS A;  1DZM A;  4GRJ A;  2G78 A;  2LKK A;  2BTW A;  3TZS A;  3S3Q A;  5LJB A;  4NYQ A;  3PSE A;  2ACP X;  2RTH B;  5AJB A;  2HKD A;  4ARH A;  5JR8 A;  1N9M A;  4X6I A;  1ICN A;  2J7Q C;  4RY2 A;  3HK1 A;  3RY1 A;  4XME A;  3PQS A;  4KC8 A;  3VG7 A;  4U3Q A;  2AT0 X;  1BRP A;  2XU1 A;  1LIC A;  5BVT A;  3N4C A;  3T2W A;  3QQ2 A;  3IV2 A;  4BX7 A;  3PH6 A;  4CDD B;  3CKF A;  1MX7 A;  4CPH B;  3KWZ A;  2A8G A;  4BOQ A;  1HXL A;  4BOZ A;  3HHI A;  1VWJ B;  3QJ3 A;  1SWF A;  2IZE B;  4MI7 A;  1U9Q X;  4RUN A;  4Y0P A;  1Y9T A;  3MHS A;  4ORR A;  2XU5 A;  1JBH A;  4GH7 A;  3X00 A;  1ACD A;  1YZB A;  1ZRY A;  3HWN A;  3SLO A;  2JW1 A;  4CZW A;  3CQN A;  2AL0 X;  2DJF B;  1K3B B;  3P6E A;  2NNE A;  1AB0 A;  2POA A;  1AVE A;  2I5Z O;  2GH7 A;  4PI3 A;  2RA6 A;  1U17 A;  4Z2V A;  2OVS A;  2L68 A;  3WYP A;  4NLJ A;  4MZS A;  2Q2M A;  1MUP A;  1N43 A;  3U9P C;  5B29 A;  2G8C O;  4BX7 B;  3USV A;  2HHN A;  2NNQ A;  4FK5 A;  4ML7 B;  4CDE A;  3MTN A;  4KCA A;  1BJ7 A;  1STF E;  3FIQ A;  2PAD A;  2WEX A;  5JD2 A;  2IZC B;  4QRV A;  5K16 A;  3P6C A;  5LJK A;  1VYF A;  4FQB B;  4YYV A;  1OPB A;  1BY8 A;  3B2L A;  1FTP A;  1ZNE A;  4QRX A;  1HN2 A;  1OBQ A;  1CJL A;  4HPD A;  1VYO A;  2OVA A;  1DF3 A;  1ITO A;  3BLG A;  1CBI A;  3SAO A;  3K9M A;  3HWG A;  4ZTB A;  1PM1 X;  2LBA A;  1SWJ A;  2DJF A; 
#chains in the Genus database with same CATH homology
 5EGW A;  2DCD A;  1W5R A;  2IPP B;  4NV7 A;  4X6J A;  1CV8 A;  1TLO A;  3ERV A;  3DF0 A;  2FRQ A;  1SP4 B;  4BS5 A;  4YYU A;  3WXG A;  3N3G A;  2G8E A;  2G6D A;  2B1N A;  1F2B A;  1HUC B;  3RVX A;  2GHU A;  2YJB A;  2OP3 A;  2DC9 A;  4P6E A;  1Y4H A;  4AXL A;  3BCN A;  1M6D A;  1W6F A;  2AUZ A;  1QDQ A;  1PPN A;  4YYW A;  3K8U A;  1GLO A;  1Q6K A;  1XKG A;  2FTD A;  4DMX A;  3PBH A;  4YV8 A;  2C0Y A;  3CBJ A;  1F29 A;  2FUD A;  3LTW A;  4KLB A;  3CH3 X;  4XR7 A;  4BPV A;  1KHP A;  1PPD A;  1GEC E;  4B55 A;  1Y08 A;  2AIM A;  1CS8 A;  3CH2 X;  1POP A;  2DC7 A;  3H8B A;  1U9X A;  3PW3 A;  3RVW A;  2AYN A;  1MEG A;  2H7J A;  2JQF R;  2DCA A;  1MIR A;  1VJV A;  3P5X A;  3V6C A;  2WBF X;  4N8W A;  1DF0 A;  4PP1 A;  4QH6 A;  4CDC A;  1U9W A;  1EF7 A;  1F2C A;  5J94 A;  3RVV A;  3HHA A;  2HD5 A;  5JH3 A;  3KWB X;  1E2T A;  3QT4 A;  3IHP A;  1SNK A;  3KX1 A;  1F2A A;  2DCB A;  2FYE A;  2G8J A;  3P5U A;  1PPP A;  7PCK A;  4YVA A;  5CHT A;  3P5W A;  3WXE A;  3HD3 A;  1QXP A;  2YJ2 A;  1QMY A;  1GX3 A;  4QBB A;  3IUT A;  2DZY A;  3MHH A;  3BPF A;  1YK7 A;  1AIM A;  2G7Y A;  1PIP A;  2P86 A;  4HWY A;  1NPZ A;  1KHQ A;  2AS8 A;  2FO5 A;  1ZCM A;  1YK8 A;  3KW9 A;  4BSQ A;  3U8E A;  1GCB A;  3BWK A;  2E00 A;  2OUL A;  3M99 A;  2PRE A;  2OZ2 A;  3LFY A;  3OIS A;  1S4V A;  3E1Z B;  4CDC B;  2XU3 A;  3TNX A;  1YAL A;  2DJG B;  4NV8 A;  1BQI A;  4BGF A;  1JQP A;  2P7U A;  4AXM A;  1ME3 A;  3OVZ A;  2CIO A;  3CBK A;  1EWL A;  2YJ9 A;  2NQA A;  1NQC A;  4DMY A;  2R9F A;  3WXF A;  3K24 A;  4K7C A;  2IBI A;  3H6S A;  3IEJ A;  1KXR A;  3F75 A;  2DCC A;  3KKU A;  1AU3 A;  2FT2 A;  1AU0 A;  5FPW A;  5CVN B;  4P6G A;  8PCH A;  2R6N A;  3I3T A;  2DZZ A;  3O1G A;  6PAD A;  1NLJ A;  1MHW A;  3D6S A;  4MZO A;  1NB5 A;  2AU1 A;  3LXS A;  4Q8G A;  1BGO A;  3OF8 A;  3P5V A;  5CVO B;  2NQG A;  2VFB A;  1FH0 A;  3O0U A;  1AU4 A;  2AYO A;  5CHV A;  3I06 A;  3N3K A;  4I07 A;  3V6E A;  1MS6 A;  1PBH A;  9PAP A;  1PPO A;  3H7D A;  4ZUX U;  2GFO A;  2DJG A;  1KFU L;  1YVB A;  1A6R A;  4X6H A;  5EF4 A;  2FRA A;  4WA6 A;  3KSE A;  2O6X A;  4GUZ A;  1ZIV A;  1CVZ A;  2R9C A;  4YYS A;  5F02 A;  4MSX A;  1CB5 A;  2DC6 A;  4OEL A;  1CQD A;  2HXZ A;  1BP4 A;  1EWO A;  2E01 A;  2B1M A;  1PE6 A;  3IOQ A;  3C9E A;  3S3Q A;  2ACT A;  3H89 A;  3H8C A;  2E02 A;  1PCI A;  3NHE A;  2ATO A;  1NL6 A;  4XUI A;  2BSZ A;  4Q8H A;  4I05 A;  4X6I A;  4W5C A;  3PDF A;  4RY2 A;  2ARY A;  3OVX A;  2P0R A;  3BC3 A;  1O0E A;  1NB3 A;  2XU1 A;  4FIP A;  2NQD B;  1KFX L;  3N4C A;  2BDL A;  2AVW A;  5PAD A;  1TU6 A;  3IV2 A;  2VHF A;  1PXV A;  1CTE A;  2JQG R;  3IMA A;  2XU4 A;  3QSD A;  4CDF B;  4CDD B;  1IWD A;  3KWZ A;  3GCB A;  4CDD A;  4CDF A;  4PAD A;  1EWM A;  2AUX A;  2E03 A;  3HHI A;  3QJ3 A;  3AI8 A;  5JA7 A;  1U9Q X;  1AEC A;  2CB5 A;  3MHS A;  1PAD A;  1MEM A;  2XU5 A;  2HH5 A;  3HWN A;  2FQ9 A;  1K3B A;  1DEU A;  5CVM A;  4CZW A;  1CSB B;  4BQV A;  4QRG A;  1U5I A;  3MOR A;  2VFC A;  4W5B A;  2DJF B;  2R9N A;  1K3B B;  4BS6 A;  2BDZ A;  1W4T A;  4N4Z A;  3OF9 A;  5A24 A;  4PI3 A;  4OEM A;  1TL9 A;  2DC8 A;  3D9W A;  4MZS A;  3KFQ A;  1U9V A;  2NQI A;  1GMY A;  1AYW A;  1EWP A;  2F1G A;  3F5V A;  3USV A;  2R9M A;  1YT7 A;  2HHN A;  2YJ8 A;  2Y5B A;  3PNR A;  4FK5 A;  4FJC A;  3S3R A;  1VSN A;  4CDE A;  1THE A;  3MTN A;  4I04 A;  4YYR A;  1STF E;  2PAD A;  4W4U A;  5K16 A;  4QRV A;  4CDE B;  2YJC A;  1ICF A;  2PBH A;  1AYV A;  1AU2 A;  4YYV A;  1BY8 A;  4PP2 E;  2R9O A;  4YYQ A;  4QRX A;  1CJL A;  1QOL A;  3ZUA A;  1CPJ A;  1X9Y A;  1ATK A;  1MDW A;  1ME4 A;  3BOW A;  1ITO A;  2Y6E A;  2F7D A;  2VHS A;  4C5P A;  4G54 A;  3K9M A;  3B79 A;  2PNS A;  3BPM A;  1AYU A;  4N79 A;  2DJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...