2JMBA

Solution structure of the protein atu4866 from agrobacterium tumefaciens
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
MQHPYVGIWVTADGRIRQELLPNGRYDEARGNRKSAYQGRYEVRGAHINYWDDTGFTADGDFVSANELHHGGMTFYREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Atu4866
publication title Solution structure of the protein Atu4866 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11512 Atu4866 Agrobacterium tumefaciens protein Atu4866
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.290 Mainly Beta Beta Barrel Lipocalin Lipocalin 2jmbA00
2JMBA
chains in the Genus database with same CATH superfamily
4UU2A 5HTEA 1VYOA 5H9AA 1GM6A 3B2JA 3TZSA 3S26A 2R56A 3UEWA 2AVIA 2IZLB 2IZAA 4MEEA 2RTEB 4HWMA 4R0BA 4ZR2A 5IRUA 3H3IA 4CDEA 1CJ5A 4BJ8A 2RA6A 2X32A 5BVTA 1KZXA 1DF8A 4I3BA 3KFHA 2Q2PA 1DFVA 4OS0A 2FR2A 4YFPA 3EW2A 4GJVA 1FELA 4QAEA 2CZTA 2HKDA 1E2TA 1EXSA 2FWVA 1I05A 1QFTA 5B3MO 3WJCA 2A0AA 1HBQA 4Y59A 2ASNX 4ZH6A 1KL4A 5LJCA 1JV4A 5L8OA 4Y0SA 3NX1A 2BC3A 4JHQA 3EBWA 1GX3A 2OY8A 1X71A 1ZNLA 4CDDA 1A2DA 2EU7X 3FR5A 1BM5A 3RSWA 1N43A 1OBQA 2AF5A 4OMXA 1ALBA 1ML7A 1DZPA 1K24A 3LHNA 5F6BA 3WYPA 3WYQA 1ICNA 1DV9A 3T2XA 3RDXA 2G78A 1RSTB 3VE1A 5KHPA 4DQ4A 1MOYA 3RDMA 4U3QA 3PQSA 2IZFB 2CBSA 1NP4A 1AVEA 1LUQA 4GGTA 4XMGA 1S2PA 1X8OA 3BS2A 3VG2A 4ZHHA 2K23A 1G5WA 1KOIA 1E00A 1IFCA 1MX7A 2QO5A 4ML7B 5EDBA 3RY1A 1LIBA 1JJJA 5HZ9A 2MHDA 5FQ8E 1LPJA 4ZCBA 1N9MA 1DZMA 1EUOA 2XSTA 1SWEA 2CAMA 2CM4A 2OVDA 4RUNA 4YDBA 3UEXA 3UEVA 4AYHA 3AKNA 4BX7A 4ZHDA 2G5LA 4XMFA 1YWAA 3F8AA 2OVEA 2X8TA 4OS8A 2DM5A 2GJ5A 3WVMA 4LZVA 4LKTA 1ZRYA 4WFVA 2RTJA 3BU9A 4FBVA 2LBVA 1VWRB 4ON1A 4A8ZA 2OL8O 3VU1A 3PH6A 1UYNX 2X8FA 1SY3A 1GKAB 4Z28A 4KT5A 3HOLA 1SXXA 3VHHA 1BEBA 2RTAA 5F58A 4INNA 1VWIB 3U0DA 4O4OA 4ORUA 1EW3A 2X4MA 1VPRA 1R0UA 2OZQA 3APVA 2FT9A 4QGWA 1N9YA 4WHIA 4Y0RA 4Y5DA 5HZ5A 5HZQA 3TGBA 1KL5A 1SWAA 2Y3FA 4GK9A 3ZW0A 1SWDA 1HN2A 3HWDA 3OD9A 1HMRA 1OPAA 2WQ9A 3B2IA 3FIDA 5KICA 3APUA 2JW1A 2FS7A 1SWKA 1I4UA 4QZTA 1DZKA 5LKFA 1CBSA 2RTDB 2UZ2A 3BSZE 4GDZA 4IB6A 3KFGA 1A57A 3STKA 2OVSA 2RTPB 4FBRA 1RBPA 1Z24A 4BX6B 1CRBA 3FA7A 3FENA 2OFBA 3MM0A 5K06A 2PY1A 3X00A 4IAWA 1T0VA 2WSJA 3NP1A 1IW2A 1SRIA 4U9CA 4A1HA 2IZKA 1JZUA 2W2BA 2KT4B 5LJGA 2A13A 4XMEA 5B11O 3PECA 2LB6A 3WZOA 3FELA 2ANSA 4BBOA 1DF3A 1PBOA 3S5VA 3EBKA 2F01A 4HPCA 1B0OA 1Y55X 4O3WA 1LDOA 1AVGI 3VG5A 5FAZA 5BVQA 4YCHA 3B2KA 4ORXA 1H91A 3I17A 2GH7A 5EEEA 4ALBA 5JR8A 1A18A 2XKLA 1SWRA 2Y3EA 3D97A 4MVKA 4CPFA 5B29A 1KQWA 1GT4A 2A3FX 2Q39A 1QWDA 1UREA 1VWNB 1E02A 1YIVA 4DCBA 1ADLA 3BLGA 1SWGA 3CBCA 4UU3A 2C1SA 1VWOB 2AL0X 1Y52X 3WJGA 1ZNDA 2G79A 1GGLA 3CKFA 4U8UN 5LJEA 2QOMA 4NLJA 1DZJA 1LIDA 5B27A 1RAVA 3E3CA 3NPOA 1SY1A 1SRFA 3HWGA 1SMPI 2HNXA 5HZ8A 1SWPA 1SWLA 1S44A 1GT3A 4BX7B 2RTFB 3MVFA 4GUZA 4Z2VA 2WUTA 2X45A 1VWEB 5HZ6A 1VWMB 3QKGA 4M7MA 1EQDA 1T8VA 5AQ6A 2VFBA 2AT0X 4AZOA 3KVNA 2LKKA 1ZNKA 1X8QA 3CKGA 3T1DA 2CZUA 1LCWA 2IZHB 2NNEA 4OS3A 1ICMA 1BSQA 1SLEB 4GGZA 1YP7A 1ERXA 4LZUA 4CPEA 2AT8X 4NYRA 2Q4NA 3L4RA 1AELA 2CM9A 1OEKA 1XCAA 4BX5A 1ZNGA 3DSZA 2WPUA 5D45A 4YVBA 2WR6A 5LJKA 3D4RA 2FLJA 2JN3A 3HWEA 4O3YA 1KGLA 1LF7A 5IXGA 3FLLA 3FW4A 1GT1A 1KFFA 3NR3A 3PK2A 4NNTA 4IB8A 2X56A 1CBRA 2RTQB 2WEWA 1HQPA 4GNWA 4I95A 4OELA 2MM3A 4EQAC 2AH7X 2O62A 1I06A 4XMHA 4YGGA 3D9WA 4JO6A 1HQQA 5HA1A 3FEPA 4EDEA 4ORRA 4ALOA 2JU8A 2ZAGA 4DQ3A 3RKGA 2ZAIA 4IMOA 4ORYA 3VG3A 1G74A 1NP1A 5FQ6E 1O8VA 1LICA 5BYPA 4NLIA 1JIWI 3SZIA 1TOWA 3F6ZB 1KZWA 4O3XB 4A60A 2E4JA 3HK1A 1TXLA 4HPDA 2KTSA 1U17A 4ZFXA 4EFGA 3UAQA 2RTIB 4NP1A 5CHKA 1RXHA 3OBLA 4BCSA 2FTBA 2HZQA 2NNDA 2BS5A 4NNSA 3C77X 3WZPA 1VYGA 1VWJB 4WFUA 1BWYA 3AKMA 4Z2OA 1KT7A 4YMYA 4ARHA 1YP6A 2KD2A 2CBRA 3BX8A 2OY7A 1KL3A 1QY0A 3STNA 3Q34A 3ZWEA 3IA8A 5B2AO 3K3LA 3WJFA 1FJ1E 4IRWA 4TKJA 3V8UA 3VHIA 3WZQA 1HY2A 1DC9A 5H9KA 2MJIA 1LIFA 4TQ2A 1NQNA 4BGFA 1IIUA 3T6FA 1I04A 5LJDA 2GTLM 1SXYA 1SWUA 1QQSA 2N93A 4IMNA 3S5XA 4NW4A 2MO5A 3QQ2A 4AZNA 2L67A 5H9NA 2QOSC 3RDSA 2R73A 3OJYC 3KZAA 1KQXA 1STSB 3CQRA 2AKQA 4GJSA 4YGZA 1JYJA 1A3YA 5L3YA 2QO4A 1AVDA 5D48A 2QCBA 2RTRB 3FA9A 2AMMX 1X89A 3ZUOA 1N4JA 2K62A 5AEOA 2KW1A 1Y9LA 4MISA 4AZPA 3EW1A 4CV7A 2OY1O 1SLDB 1W5RA 1CBIA 5EEDA 5H8TA 5L8IA 4GE1A 4GD9A 1SXWA 1U18A 4BX5B 1B56A 2A5CA 4NYQA 2ZSCA 2MF6A 3NADA 1HXZA 2POAA 4U46A 2FKGA 5FFHA 1L6MA 2HZRA 3ZZVA 2X55A 3RY2A 1PBYA 2A2UA 1FE3A 1RXKA 4QZUA 1TVQA 4QGVA 3HWFA 2QO6A 1JQPA 2G8CO 1LCVA 2RTOB 4GRJA 4IB9A 5HCEC 5LKEA 5DPQA 4CDCA 1SRGA 3S60A 2KTDA 4LQZA 2IZEB 3CWKA 1Y0GA 2HMBA 4D6AA 2I5ZO 2AT6X 1IKJA 4OMWA 3GAQA 3P6EA 5K68A 3AEHA 3WJBA 2QMIA 2LA7A 3FA6A 2ACPX 1SWTA 4O49A 3AUMO 2OFRX 5AJBA 1G85A 1S7DA 3NX2A 3P6CA 2AT3X 4YFRA 2W2FA 1OEJA 2RCTA 1W4TA 1IJ8A 1SWNA 4L3RA 1K3BA 3FMZA 3NQ9A 1SLGB 1SY2A 4KIIA 1MUPA 3KFFA 3O19A 4FGIB 3BY0A 5HTDA 2UYWA 4M6SA 2RTCB 4ORWA 4BVMA 1BRQA 2IFBA 3DTQA 2NP1A 2RN4A 4IBAA 1QABE 3HOEA 4ES7A 2GTLO 1VWFB 1SRHA 3BDRA 2RTGB 3WJDA 4ZJ0A 1BRPA 1IKEA 1SWJA 1Y53X 2C4IA 4I9RA 5D4AA 4KC7A 2FHLA 2RTLA 2BHVA 5F6ZA 5D8JA 1I78A 2IZGB 4I3CA 1AQBA 1BJ7A 1NDJA 1STPA 3WJEA 4ZGUA 2AT5X 1OEEA 4ORSA 3P6FA 4XMCA 1NQMA 1T68X 1KT4A 2RTHB 4OKAA 5F1EA 4JGLA 3RDQA 3ZUIA 2A5BA 4IABA 4FQBB 1SWCA 3MX7A 2DJFA 4AZMA 4MVEA 2VDFA 3U03A 2X34A 2DJGA 3EM0A 4Y0QA 4GH7A 1O1UA 1SRJA 1VWCB 3HTYA 4HPBA 2IZDB 1EIIA 3SZHA 5HCDC 1SWSA 1WUBA 2Q9SA 2JU3A 3GE2A 4GETA 3B2LA 4N7DA 3STMX 1LKEA 4BOEA 1SWHA 3ZW0B 1O1VA 1SWBA 1VWBB 1KXOA 2WQAE 4BQUA 1P6PA 4DNEA 1YWBA 1GKAA 1STRB 1VWLB 4I3DA 3SOTA 3VHMA 1MVGA 4TJZA 4IB7A 1SLFB 3ZW1A 2VFCA 2YG2A 1WBIA 2OF8A 2Q2MA 2NNQA 3CR6A 3P6HA 3RWXA 2X46A 5HAEA 2RTKA 1RXJA 2Y32A 5IO7A 3MBTA 2IZJA 4A1YA 2Z4HA 1PEEA 1X8NA 4C5PA 4ZGFA 1PMPA 3WOVA 4JNJA 1JJUA 3RDUA 2RTNB 1EPAA 4QQ1A 5BVSA 4AW8A 3BX7A 2R74A 3FR4A 2G7BA 2L9CA 4Z6JA 1SWQA 2HYSA 1KT5A 3D96A 2LFOA 4O4UA 2RQ0A 2OF9A 3P6GA 5KIDA 2FR3A 4L1NA 1LELA 4YKMA 1YUPA 4QYPA 4BX6A 3LV4A 1QY1A 3OE3A 5LJHA 3SLJA 1VYFA 2L5PA 3NBXX 3LTWA 5F7GA 2FKJA 5AJCA 4PJ2A 4TLJA 1JYDA 5L8NA 3JQOA 1X8PA 2P8GA 5IO6A 4GDAA 4NV8A 3WXQA 1NGLA 1HXLA 4U8UM 5B5GA 4HFOA 1JMZA 2IZCB 3EMMA 1VWGB 2A2GA 4GU8A 5F2BA 1B8EA 5DG4A 1XKIA 3RZYA 3RE5A 4I6SA 2OFMX 3JS1A 4QGXA 4MVLA 4O4SA 4ZHFA 1SY0A 1UYOX 3PEDA 5B10O 3F9DA 4YH0A 2GC9A 2OYBO 4YFQA 3VPJE 3FDCA 2BLGA 1ZNHA 2IZBA 3FR2A 1EI5A 4N7CA 1MX8A 5JD2A 1JBHA 1JMXA 1IFBA 2PI3O 4EEJA 2RD7C 4I9SA 3PPTA 2OL7A 4ID2A 1I9HA 3RDOA 4CPHA 1GX9A 4CPIA 3ZW2A 2JMBA 3FYFA 3VE2A 1LFOA 1PTSA 3CMPA 1OBPA 4IAXA 3O22A 4TKHA 3RE6A 5EZ2A 1LDQA 1MM9A 2FS6A 4QRLA 3SAOA 5H9LA 4CSBA 5HBSA 1VWDB 2OFAA 1TW4A 2MWHA 4D6BA 1D2UA 1YWCA 1LIEA 1SWFA 1SWOA 3IFBA 4MVIA 1OBUA 4GNYA 1GXAA 2LBAA 3P02A 1CBQA 3SZJA 4B55A 5HA0A 1E06A 2OVAA 2YMSA 2FRSA 3B2HA 1RSUB 3O2YA 1OPBA 1U0XA 2L68A 5FQ7E 1QFVA 1GT5A 4TKBA 3NQ3A 4MIRA 3VGWA 4KC8A 3UEUA 1RLBE 3ZW1B 3EC5A 4KH8A 3FIQA 3P6DA 2GTFX 3JSQA 1YWDA 5CE4A 4QNIA 3TGCA 1AB0A 5HWZA 3APWA 5IRWA 2RTBB 3NQKA 4PSQA 3MG5A 3SLOA 4OEMA 4YBPA 4GKCA 2A8GA 5FENA 3N91A 1BLRA 3KQ0A 4O4XA 2C1QA 1D3SA 2F09A 3FW5A 3VG4A 1VWKB 2QM9A 1MEPA 4HPAA 1UZ2X 4Y0PA 1MK5A 1FEMA 2JGSA 1HBPA 2FHNX 3PH5A 5EDCA 4GGRA 3U9PC 1BSOA 1ZNEA 2JU7A 4AZQA 3T6LA 4O3ZA 2OL6O 3D95A 4U8UO 5CSEA 4EKVA 4Z27A 1N7YA 1NC9A 1SA8A 2RTMA 4ZHCA 3VG6A 1GX8A 1KT3A 4ZH9A 2BSZA 3G7XA 1OSPO 3ELXA 5HCCC 4RUUA 3RBYA 4TNNA 1B4MA 1ACDA 1LCZA 5C0NA 1HMTA 3FA8A 4QYNA 4LKPA 1VWAB 2I5VO 4WBKA 1BSYA 4ODDA 3WBGA 3ZQ3A 1SXUA 4CDFA 1G7NA 1NBXA 2ALLX 3APXA 4CK4A 1QY2A 1JJXA 4NV7A 1ERBA 3BU1A 1PM1X 1QG5A 5D47A 2X8SA 3CBSA 1HMSA 2WWPA 3C76X 3CQNA 3KFIA 4YKOA 2OY5O 4ZHGA 5K67A 3PQUA 5IRAA 3P24A 2BT9A 5IO5A 5EPQA 3TF6A 4KCAA 2BS6A 1W6FA 3C78X 4AZRA 4Z2PA 4YGHA 2W2AA 2ACOA 3ELZA 3HPEA 3PP6A 4K19A 1E5PA 3PDFA 1FDQA 4YDAA 3WZNA 4CPHB 5B5FA 4O9SA 1Y9TA 4XMDA 1N0SA 3SLTA 3FEKA 4I60A 3T2WA 3TGAA 4YCEA 5CYBA 3Q6LA 2IZIA 3ZI8A 1KT6A 2WEXA 1VWQB 2FGSA 1FTPA 1SREA 2M4LA 1MDCA 3EYCA 1X8UA 2HLVA 2Z4IA 3BRNA 1VWHB 1EALA 1EIOA 2GTLN 3VG7A 1FENA 1VWPB 4COTA 2RCQA 4YBUA 4EXZA 1BBPA 4GZVA 2F73A 1TOUA 2JOZA 3I0AA 4FBOA 5LJBA 1EPBA 1LNMA
chains in the Genus database with same CATH topology
4UU2A 5HTEA 5H9AA 3TZSA 1GM6A 3B2JA 3S26A 2R56A 3UEWA 4HWMA 4R0BA 4ZR2A 3H3IA 1CJ5A 1KZXA 2RA6A 5BVTA 4I3BA 3KFHA 2Q2PA 1DFVA 4OS0A 2FR2A 4YFPA 1FELA 4QAEA 2CZTA 1EXSA 2FWVA 1I05A 1QFTA 3WJCA 2A0AA 1HBQA 4ZH6A 2ASNX 5LJCA 1JV4A 4Y0SA 3NX1A 3EBWA 1X71A 1ZNLA 1A2DA 2EU7X 3FR5A 1BM5A 3RSWA 1OBQA 4OMXA 1ALBA 1ML7A 1DZPA 3LHNA 5F6BA 1DV9A 1ICNA 2G78A 3VE1A 5KHPA 4DQ4A 4U3QA 3PQSA 2CBSA 1NP4A 4XMGA 4ZHHA 1S2PA 1X8OA 3BS2A 3VG2A 1G5WA 2K23A 1KOIA 1E00A 1IFCA 1MX7A 2QO5A 4ML7B 5EDBA 1JJJA 1LIBA 5HZ9A 2MHDA 5FQ8E 1LPJA 4ZCBA 1DZMA 1EUOA 2XSTA 2CM4A 2OVDA 4RUNA 4YDBA 3UEXA 3UEVA 4AYHA 3AKNA 4ZHDA 4XMFA 1YWAA 3F8AA 2OVEA 2X8TA 4OS8A 2DM5A 2GJ5A 3WVMA 4LZVA 4LKTA 1ZRYA 4WFVA 3BU9A 4FBVA 2LBVA 4A8ZA 4ON1A 3VU1A 3PH6A 2X8FA 1SY3A 1GKAB 4KT5A 3HOLA 1SXXA 1BEBA 5F58A 4INNA 3U0DA 4O4OA 4ORUA 1EW3A 3APVA 1VPRA 2OZQA 1R0UA 4QGWA 2FT9A 4WHIA 5HZ5A 4Y0RA 3TGBA 5HZQA 4GK9A 3ZW0A 1HN2A 3HWDA 3OD9A 1HMRA 1OPAA 2WQ9A 3B2IA 5KICA 3APUA 2JW1A 2FS7A 4QZTA 1I4UA 5LKFA 1DZKA 1CBSA 3BSZE 4GDZA 4IB6A 3KFGA 1A57A 3STKA 2OVSA 4FBRA 1RBPA 1Z24A 1CRBA 3FA7A 3FENA 5K06A 2PY1A 4IAWA 1T0VA 2WSJA 3NP1A 1IW2A 4U9CA 4A1HA 1JZUA 2W2BA 2KT4B 5LJGA 2A13A 4XMEA 3PECA 2LB6A 3FELA 2ANSA 1DF3A 1PBOA 3S5VA 3EBKA 4HPCA 1B0OA 4O3WA 1AVGI 3VG5A 5FAZA 5BVQA 4YCHA 3B2KA 4ORXA 1H91A 3I17A 5EEEA 4ALBA 5JR8A 1A18A 2XKLA 3D97A 4MVKA 5B29A 1KQWA 1GT4A 2A3FX 2Q39A 1QWDA 1UREA 1YIVA 1E02A 1ADLA 3BLGA 3CBCA 4UU3A 2AL0X 3WJGA 1ZNDA 2G79A 1GGLA 4U8UN 5LJEA 4NLJA 1DZJA 1LIDA 5B27A 3E3CA 3NPOA 1SY1A 3HWGA 1SMPI 2HNXA 5HZ8A 1S44A 1GT3A 3MVFA 2WUTA 2X45A 5HZ6A 3QKGA 4M7MA 1EQDA 1T8VA 5AQ6A 2AT0X 4AZOA 2LKKA 1ZNKA 1X8QA 3T1DA 3V8UA 2CZUA 2NNEA 4OS3A 1ICMA 1BSQA 1YP7A 1ERXA 4LZUA 2AT8X 4NYRA 2Q4NA 3L4RA 1AELA 2CM9A 1OEKA 1XCAA 1ZNGA 3DSZA 5D45A 2WR6A 5LJKA 3D4RA 2FLJA 2JN3A 3HWEA 4O3YA 1KGLA 1LF7A 3FLLA 3FW4A 1GT1A 3NR3A 4NNTA 4IB8A 1CBRA 2WEWA 1HQPA 4GNWA 4I95A 4EQAC 2MM3A 2AH7X 2O62A 1I06A 4XMHA 4YGGA 5HA1A 3FEPA 4EDEA 4ORRA 4ALOA 2JU8A 2ZAGA 4DQ3A 3RKGA 2ZAIA 4IMOA 4ORYA 3VG3A 1G74A 1NP1A 5FQ6E 1O8VA 1LICA 5BYPA 4NLIA 1JIWI 1KZWA 1TOWA 3F6ZB 4O3XB 4A60A 2E4JA 3HK1A 1TXLA 4HPDA 2KTSA 1U17A 4ZFXA 4EFGA 3UAQA 4NP1A 3OBLA 2FTBA 2HZQA 2NNDA 2BS5A 4NNSA 3C77X 1VYGA 4WFUA 1BWYA 3AKMA 1KT7A 4YMYA 4ARHA 1YP6A 2KD2A 2CBRA 3BX8A 1QY0A 3STNA 3ZWEA 3IA8A 3K3LA 3WJFA 4TKJA 1DC9A 5H9KA 2MJIA 1LIFA 4TQ2A 1IIUA 1I04A 5LJDA 2GTLM 1SXYA 1QQSA 2N93A 4IMNA 3S5XA 4NW4A 2MO5A 4AZNA 2L67A 5H9NA 2QOSC 2R73A 3OJYC 3KZAA 1KQXA 3CQRA 2AKQA 4YGZA 1JYJA 1A3YA 2QO4A 5D48A 3FA9A 2AMMX 1X89A 3ZUOA 2K62A 5AEOA 2KW1A 1Y9LA 4MISA 4AZPA 4CV7A 5EEDA 5L8IA 1CBIA 5H8TA 4GE1A 1U18A 1SXWA 1B56A 4NYQA 3NADA 4ES7A 2POAA 5FFHA 3ZZVA 1L6MA 2HZRA 2A2UA 1FE3A 4QZUA 1TVQA 4QGVA 3HWFA 2QO6A 4GRJA 5HCEC 5LKEA 4IB9A 5DPQA 3S60A 2KTDA 4LQZA 3CWKA 2HMBA 4D6AA 2AT6X 1IKJA 4OMWA 3GAQA 3P6EA 3WJBA 2QMIA 2LA7A 3FA6A 2ACPX 4O49A 2OFRX 5AJBA 1G85A 1S7DA 3NX2A 3P6CA 2AT3X 4YFRA 2W2FA 1OEJA 2RCTA 4L3RA 3FMZA 3NQ9A 1SY2A 4KIIA 1MUPA 3KFFA 3O19A 4FGIB 3BY0A 5HTDA 4M6SA 4BVMA 4ORWA 5IO6A 1BRQA 2IFBA 3DTQA 2NP1A 2RN4A 4IBAA 1QABE 3HOEA 2GTLO 3BDRA 3WJDA 4ZJ0A 1BRPA 1IKEA 5D4AA 4I9RA 4KC7A 5F6ZA 2BHVA 5D8JA 4I3CA 1AQBA 1BJ7A 4ZGUA 3WJEA 2AT5X 1OEEA 4ORSA 3P6FA 4XMCA 1T68X 5F1EA 1KT4A 4JGLA 3ZUIA 4IABA 4FQBB 3MX7A 4AZMA 4MVEA 3U03A 3EM0A 4Y0QA 4GH7A 1O1UA 3HTYA 4HPBA 1EIIA 5HCDC 2Q9SA 2JU3A 3GE2A 4GETA 3B2LA 4N7DA 3STMX 1LKEA 4BOEA 3ZW0B 1O1VA 1KXOA 2WQAE 4BQUA 1P6PA 1GKAA 1YWBA 4I3DA 3SOTA 1MVGA 4TJZA 4IB7A 3ZW1A 2YG2A 3CR6A 2Q2MA 3P6HA 3RWXA 2NNQA 2X46A 5HAEA 5IO7A 3MBTA 4A1YA 2Z4HA 1PEEA 1X8NA 4ZGFA 1PMPA 1EPAA 4QQ1A 5BVSA 4AW8A 3BX7A 2R74A 3FR4A 2G7BA 2L9CA 2HYSA 1KT5A 3D96A 2LFOA 4O4UA 2RQ0A 5KIDA 3P6GA 2FR3A 4L1NA 4YKMA 1YUPA 4QYPA 3LV4A 1QY1A 3OE3A 5LJHA 1VYFA 2L5PA 3NBXX 5F7GA 5AJCA 4PJ2A 4TLJA 1JYDA 5L8NA 3JQOA 1X8PA 2P8GA 3WXQA 1NGLA 4U8UM 4HFOA 4GU8A 3EMMA 2A2GA 1B8EA 5DG4A 1XKIA 3RZYA 4I6SA 2OFMX 3JS1A 4QGXA 4MVLA 4O4SA 4ZHFA 1SY0A 3PEDA 3VPJE 3F9DA 4YH0A 2GC9A 4YFQA 3FR2A 2BLGA 1ZNHA 1EI5A 4N7CA 1MX8A 1JBHA 1IFBA 4EEJA 2RD7C 4I9SA 3PPTA 4ID2A 1GX9A 3ZW2A 2JMBA 3FYFA 3VE2A 1LFOA 3CMPA 1OBPA 4IAXA 3O22A 4TKHA 5EZ2A 2FS6A 4QRLA 3SAOA 5H9LA 4CSBA 5HBSA 1TW4A 2MWHA 4D6BA 1D2UA 1YWCA 1LIEA 3IFBA 4MVIA 1OBUA 4GNYA 1GXAA 2LBAA 3P02A 1CBQA 5HA0A 1E06A 2OVAA 2YMSA 2FRSA 3B2HA 3O2YA 1OPBA 1U0XA 2L68A 5FQ7E 1QFVA 1GT5A 4TKBA 3NQ3A 4MIRA 4KC8A 3UEUA 1RLBE 3ZW1B 4KH8A 3FIQA 3P6DA 2GTFX 3JSQA 1YWDA 5CE4A 4QNIA 3TGCA 1AB0A 5HWZA 3APWA 3NQKA 4PSQA 4YBPA 4GKCA 5FENA 3N91A 1BLRA 3KQ0A 4O4XA 1D3SA 2F09A 3FW5A 3VG4A 2QM9A 4HPAA 1UZ2X 4Y0PA 1FEMA 1HBPA 3PH5A 5EDCA 3U9PC 1BSOA 1ZNEA 2JU7A 4AZQA 4O3ZA 4U8UO 3D95A 1SA8A 4ZHCA 3VG6A 1GX8A 1KT3A 4ZH9A 3G7XA 3ELXA 5HCCC 4RUUA 3RBYA 4TNNA 1B4MA 1ACDA 5C0NA 1HMTA 3FA8A 4QYNA 4LKPA 4WBKA 3WBGA 1BSYA 4ODDA 3ZQ3A 5L8OA 1SXUA 1G7NA 2ALLX 3APXA 4CK4A 1JJXA 1QY2A 1ERBA 3BU1A 1PM1X 1QG5A 5D47A 2X8SA 3CBSA 1HMSA 2WWPA 3C76X 3CQNA 3KFIA 4YKOA 4ZHGA 3PQUA 3P24A 2BT9A 5IO5A 5EPQA 3TF6A 4KCAA 2BS6A 4AZRA 3C78X 4YGHA 2W2AA 2ACOA 3ELZA 3PP6A 4K19A 1E5PA 1FDQA 4YDAA 4O9SA 1Y9TA 4XMDA 1N0SA 3FEKA 3TGAA 4YCEA 5CYBA 3Q6LA 3ZI8A 1KT6A 2WEXA 2M4LA 3EYCA 1FTPA 3WOVA 1MDCA 1X8UA 2HLVA 2Z4IA 3BRNA 1EALA 1EIOA 2GTLN 3VG7A 1FENA 4COTA 2RCQA 4YBUA 4EXZA 1BBPA 4GZVA 2F73A 1TOUA 2JOZA 3I0AA 4FBOA 5LJBA 1EPBA 1LNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMB A; 
#chains in the Genus database with same CATH topology
 4UU2 A;  5HTE A;  1VYO A;  5H9A A;  1GM6 A;  3B2J A;  3TZS A;  3S26 A;  2R56 A;  3UEW A;  2AVI A;  2IZL B;  2IZA A;  4MEE A;  2RTE B;  4HWM A;  4R0B A;  4ZR2 A;  5IRU A;  3H3I A;  4CDE A;  1CJ5 A;  4BJ8 A;  2RA6 A;  2X32 A;  5BVT A;  1KZX A;  1DF8 A;  4I3B A;  3KFH A;  2Q2P A;  1DFV A;  4OS0 A;  2FR2 A;  4YFP A;  3EW2 A;  4GJV A;  1FEL A;  4QAE A;  2CZT A;  2HKD A;  1E2T A;  1EXS A;  2FWV A;  1I05 A;  1QFT A;  5B3M O;  3WJC A;  2A0A A;  1HBQ A;  4Y59 A;  2ASN X;  4ZH6 A;  1KL4 A;  5LJC A;  1JV4 A;  5L8O A;  4Y0S A;  3NX1 A;  2BC3 A;  4JHQ A;  3EBW A;  1GX3 A;  2OY8 A;  1X71 A;  1ZNL A;  4CDD A;  1A2D A;  2EU7 X;  3FR5 A;  1BM5 A;  3RSW A;  1N43 A;  1OBQ A;  2AF5 A;  4OMX A;  1ALB A;  1ML7 A;  1DZP A;  1K24 A;  3LHN A;  5F6B A;  3WYP A;  3WYQ A;  1ICN A;  1DV9 A;  3T2X A;  3RDX A;  2G78 A;  1RST B;  3VE1 A;  5KHP A;  4DQ4 A;  1MOY A;  3RDM A;  4U3Q A;  3PQS A;  2IZF B;  2CBS A;  1NP4 A;  1AVE A;  1LUQ A;  4GGT A;  4XMG A;  1S2P A;  1X8O A;  3BS2 A;  3VG2 A;  4ZHH A;  2K23 A;  1G5W A;  1KOI A;  1E00 A;  1IFC A;  1MX7 A;  2QO5 A;  4ML7 B;  5EDB A;  3RY1 A;  1LIB A;  1JJJ A;  5HZ9 A;  2MHD A;  5FQ8 E;  1LPJ A;  4ZCB A;  1N9M A;  1DZM A;  1EUO A;  2XST A;  1SWE A;  2CAM A;  2CM4 A;  2OVD A;  4RUN A;  4YDB A;  3UEX A;  3UEV A;  4AYH A;  3AKN A;  4BX7 A;  4ZHD A;  2G5L A;  4XMF A;  1YWA A;  3F8A A;  2OVE A;  2X8T A;  4OS8 A;  2DM5 A;  2GJ5 A;  3WVM A;  4LZV A;  4LKT A;  1ZRY A;  4WFV A;  2RTJ A;  3BU9 A;  4FBV A;  2LBV A;  1VWR B;  4ON1 A;  4A8Z A;  2OL8 O;  3VU1 A;  3PH6 A;  1UYN X;  2X8F A;  1SY3 A;  1GKA B;  4Z28 A;  4KT5 A;  3HOL A;  1SXX A;  3VHH A;  1BEB A;  2RTA A;  5F58 A;  4INN A;  1VWI B;  3U0D A;  4O4O A;  4ORU A;  1EW3 A;  2X4M A;  1VPR A;  1R0U A;  2OZQ A;  3APV A;  2FT9 A;  4QGW A;  1N9Y A;  4WHI A;  4Y0R A;  4Y5D A;  5HZ5 A;  5HZQ A;  3TGB A;  1KL5 A;  1SWA A;  2Y3F A;  4GK9 A;  3ZW0 A;  1SWD A;  1HN2 A;  3HWD A;  3OD9 A;  1HMR A;  1OPA A;  2WQ9 A;  3B2I A;  3FID A;  5KIC A;  3APU A;  2JW1 A;  2FS7 A;  1SWK A;  1I4U A;  4QZT A;  1DZK A;  5LKF A;  1CBS A;  2RTD B;  2UZ2 A;  3BSZ E;  4GDZ A;  4IB6 A;  3KFG A;  1A57 A;  3STK A;  2OVS A;  2RTP B;  4FBR A;  1RBP A;  1Z24 A;  4BX6 B;  1CRB A;  3FA7 A;  3FEN A;  2OFB A;  3MM0 A;  5K06 A;  2PY1 A;  3X00 A;  4IAW A;  1T0V A;  2WSJ A;  3NP1 A;  1IW2 A;  1SRI A;  4U9C A;  4A1H A;  2IZK A;  1JZU A;  2W2B A;  2KT4 B;  5LJG A;  2A13 A;  4XME A;  5B11 O;  3PEC A;  2LB6 A;  3WZO A;  3FEL A;  2ANS A;  4BBO A;  1DF3 A;  1PBO A;  3S5V A;  3EBK A;  2F01 A;  4HPC A;  1B0O A;  1Y55 X;  4O3W A;  1LDO A;  1AVG I;  3VG5 A;  5FAZ A;  5BVQ A;  4YCH A;  3B2K A;  4ORX A;  1H91 A;  3I17 A;  2GH7 A;  5EEE A;  4ALB A;  5JR8 A;  1A18 A;  2XKL A;  1SWR A;  2Y3E A;  3D97 A;  4MVK A;  4CPF A;  5B29 A;  1KQW A;  1GT4 A;  2A3F X;  2Q39 A;  1QWD A;  1URE A;  1VWN B;  1E02 A;  1YIV A;  4DCB A;  1ADL A;  3BLG A;  1SWG A;  3CBC A;  4UU3 A;  2C1S A;  1VWO B;  2AL0 X;  1Y52 X;  3WJG A;  1ZND A;  2G79 A;  1GGL A;  3CKF A;  4U8U N;  5LJE A;  2QOM A;  4NLJ A;  1DZJ A;  1LID A;  5B27 A;  1RAV A;  3E3C A;  3NPO A;  1SY1 A;  1SRF A;  3HWG A;  1SMP I;  2HNX A;  5HZ8 A;  1SWP A;  1SWL A;  1S44 A;  1GT3 A;  4BX7 B;  2RTF B;  3MVF A;  4GUZ A;  4Z2V A;  2WUT A;  2X45 A;  1VWE B;  5HZ6 A;  1VWM B;  3QKG A;  4M7M A;  1EQD A;  1T8V A;  5AQ6 A;  2VFB A;  2AT0 X;  4AZO A;  3KVN A;  2LKK A;  1ZNK A;  1X8Q A;  3CKG A;  3T1D A;  2CZU A;  1LCW A;  2IZH B;  2NNE A;  4OS3 A;  1ICM A;  1BSQ A;  1SLE B;  4GGZ A;  1YP7 A;  1ERX A;  4LZU A;  4CPE A;  2AT8 X;  4NYR A;  2Q4N A;  3L4R A;  1AEL A;  2CM9 A;  1OEK A;  1XCA A;  4BX5 A;  1ZNG A;  3DSZ A;  2WPU A;  5D45 A;  4YVB A;  2WR6 A;  5LJK A;  3D4R A;  2FLJ A;  2JN3 A;  3HWE A;  4O3Y A;  1KGL A;  1LF7 A;  5IXG A;  3FLL A;  3FW4 A;  1GT1 A;  1KFF A;  3NR3 A;  3PK2 A;  4NNT A;  4IB8 A;  2X56 A;  1CBR A;  2RTQ B;  2WEW A;  1HQP A;  4GNW A;  4I95 A;  4OEL A;  2MM3 A;  4EQA C;  2AH7 X;  2O62 A;  1I06 A;  4XMH A;  4YGG A;  3D9W A;  4JO6 A;  1HQQ A;  5HA1 A;  3FEP A;  4EDE A;  4ORR A;  4ALO A;  2JU8 A;  2ZAG A;  4DQ3 A;  3RKG A;  2ZAI A;  4IMO A;  4ORY A;  3VG3 A;  1G74 A;  1NP1 A;  5FQ6 E;  1O8V A;  1LIC A;  5BYP A;  4NLI A;  1JIW I;  3SZI A;  1TOW A;  3F6Z B;  1KZW A;  4O3X B;  4A60 A;  2E4J A;  3HK1 A;  1TXL A;  4HPD A;  2KTS A;  1U17 A;  4ZFX A;  4EFG A;  3UAQ A;  2RTI B;  4NP1 A;  5CHK A;  1RXH A;  3OBL A;  4BCS A;  2FTB A;  2HZQ A;  2NND A;  2BS5 A;  4NNS A;  3C77 X;  3WZP A;  1VYG A;  1VWJ B;  4WFU A;  1BWY A;  3AKM A;  4Z2O A;  1KT7 A;  4YMY A;  4ARH A;  1YP6 A;  2KD2 A;  2CBR A;  3BX8 A;  2OY7 A;  1KL3 A;  1QY0 A;  3STN A;  3Q34 A;  3ZWE A;  3IA8 A;  5B2A O;  3K3L A;  3WJF A;  1FJ1 E;  4IRW A;  4TKJ A;  3V8U A;  3VHI A;  3WZQ A;  1HY2 A;  1DC9 A;  5H9K A;  2MJI A;  1LIF A;  4TQ2 A;  1NQN A;  4BGF A;  1IIU A;  3T6F A;  1I04 A;  5LJD A;  2GTL M;  1SXY A;  1SWU A;  1QQS A;  2N93 A;  4IMN A;  3S5X A;  4NW4 A;  2MO5 A;  3QQ2 A;  4AZN A;  2L67 A;  5H9N A;  2QOS C;  3RDS A;  2R73 A;  3OJY C;  3KZA A;  1KQX A;  1STS B;  3CQR A;  2AKQ A;  4GJS A;  4YGZ A;  1JYJ A;  1A3Y A;  5L3Y A;  2QO4 A;  1AVD A;  5D48 A;  2QCB A;  2RTR B;  3FA9 A;  2AMM X;  1X89 A;  3ZUO A;  1N4J A;  2K62 A;  5AEO A;  2KW1 A;  1Y9L A;  4MIS A;  4AZP A;  3EW1 A;  4CV7 A;  2OY1 O;  1SLD B;  1W5R A;  1CBI A;  5EED A;  5H8T A;  5L8I A;  4GE1 A;  4GD9 A;  1SXW A;  1U18 A;  4BX5 B;  1B56 A;  2A5C A;  4NYQ A;  2ZSC A;  2MF6 A;  3NAD A;  1HXZ A;  2POA A;  4U46 A;  2FKG A;  5FFH A;  1L6M A;  2HZR A;  3ZZV A;  2X55 A;  3RY2 A;  1PBY A;  2A2U A;  1FE3 A;  1RXK A;  4QZU A;  1TVQ A;  4QGV A;  3HWF A;  2QO6 A;  1JQP A;  2G8C O;  1LCV A;  2RTO B;  4GRJ A;  4IB9 A;  5HCE C;  5LKE A;  5DPQ A;  4CDC A;  1SRG A;  3S60 A;  2KTD A;  4LQZ A;  2IZE B;  3CWK A;  1Y0G A;  2HMB A;  4D6A A;  2I5Z O;  2AT6 X;  1IKJ A;  4OMW A;  3GAQ A;  3P6E A;  5K68 A;  3AEH A;  3WJB A;  2QMI A;  2LA7 A;  3FA6 A;  2ACP X;  1SWT A;  4O49 A;  3AUM O;  2OFR X;  5AJB A;  1G85 A;  1S7D A;  3NX2 A;  3P6C A;  2AT3 X;  4YFR A;  2W2F A;  1OEJ A;  2RCT A;  1W4T A;  1IJ8 A;  1SWN A;  4L3R A;  1K3B A;  3FMZ A;  3NQ9 A;  1SLG B;  1SY2 A;  4KII A;  1MUP A;  3KFF A;  3O19 A;  4FGI B;  3BY0 A;  5HTD A;  2UYW A;  4M6S A;  2RTC B;  4ORW A;  4BVM A;  1BRQ A;  2IFB A;  3DTQ A;  2NP1 A;  2RN4 A;  4IBA A;  1QAB E;  3HOE A;  4ES7 A;  2GTL O;  1VWF B;  1SRH A;  3BDR A;  2RTG B;  3WJD A;  4ZJ0 A;  1BRP A;  1IKE A;  1SWJ A;  1Y53 X;  2C4I A;  4I9R A;  5D4A A;  4KC7 A;  2FHL A;  2RTL A;  2BHV A;  5F6Z A;  5D8J A;  1I78 A;  2IZG B;  4I3C A;  1AQB A;  1BJ7 A;  1NDJ A;  1STP A;  3WJE A;  4ZGU A;  2AT5 X;  1OEE A;  4ORS A;  3P6F A;  4XMC A;  1NQM A;  1T68 X;  1KT4 A;  2RTH B;  4OKA A;  5F1E A;  4JGL A;  3RDQ A;  3ZUI A;  2A5B A;  4IAB A;  4FQB B;  1SWC A;  3MX7 A;  2DJF A;  4AZM A;  4MVE A;  2VDF A;  3U03 A;  2X34 A;  2DJG A;  3EM0 A;  4Y0Q A;  4GH7 A;  1O1U A;  1SRJ A;  1VWC B;  3HTY A;  4HPB A;  2IZD B;  1EII A;  3SZH A;  5HCD C;  1SWS A;  1WUB A;  2Q9S A;  2JU3 A;  3GE2 A;  4GET A;  3B2L A;  4N7D A;  3STM X;  1LKE A;  4BOE A;  1SWH A;  3ZW0 B;  1O1V A;  1SWB A;  1VWB B;  1KXO A;  2WQA E;  4BQU A;  1P6P A;  4DNE A;  1YWB A;  1GKA A;  1STR B;  1VWL B;  4I3D A;  3SOT A;  3VHM A;  1MVG A;  4TJZ A;  4IB7 A;  1SLF B;  3ZW1 A;  2VFC A;  2YG2 A;  1WBI A;  2OF8 A;  2Q2M A;  2NNQ A;  3CR6 A;  3P6H A;  3RWX A;  2X46 A;  5HAE A;  2RTK A;  1RXJ A;  2Y32 A;  5IO7 A;  3MBT A;  2IZJ A;  4A1Y A;  2Z4H A;  1PEE A;  1X8N A;  4C5P A;  4ZGF A;  1PMP A;  3WOV A;  4JNJ A;  1JJU A;  3RDU A;  2RTN B;  1EPA A;  4QQ1 A;  5BVS A;  4AW8 A;  3BX7 A;  2R74 A;  3FR4 A;  2G7B A;  2L9C A;  4Z6J A;  1SWQ A;  2HYS A;  1KT5 A;  3D96 A;  2LFO A;  4O4U A;  2RQ0 A;  2OF9 A;  3P6G A;  5KID A;  2FR3 A;  4L1N A;  1LEL A;  4YKM A;  1YUP A;  4QYP A;  4BX6 A;  3LV4 A;  1QY1 A;  3OE3 A;  5LJH A;  3SLJ A;  1VYF A;  2L5P A;  3NBX X;  3LTW A;  5F7G A;  2FKJ A;  5AJC A;  4PJ2 A;  4TLJ A;  1JYD A;  5L8N A;  3JQO A;  1X8P A;  2P8G A;  5IO6 A;  4GDA A;  4NV8 A;  3WXQ A;  1NGL A;  1HXL A;  4U8U M;  5B5G A;  4HFO A;  1JMZ A;  2IZC B;  3EMM A;  1VWG B;  2A2G A;  4GU8 A;  5F2B A;  1B8E A;  5DG4 A;  1XKI A;  3RZY A;  3RE5 A;  4I6S A;  2OFM X;  3JS1 A;  4QGX A;  4MVL A;  4O4S A;  4ZHF A;  1SY0 A;  1UYO X;  3PED A;  5B10 O;  3F9D A;  4YH0 A;  2GC9 A;  2OYB O;  4YFQ A;  3VPJ E;  3FDC A;  2BLG A;  1ZNH A;  2IZB A;  3FR2 A;  1EI5 A;  4N7C A;  1MX8 A;  5JD2 A;  1JBH A;  1JMX A;  1IFB A;  2PI3 O;  4EEJ A;  2RD7 C;  4I9S A;  3PPT A;  2OL7 A;  4ID2 A;  1I9H A;  3RDO A;  4CPH A;  1GX9 A;  4CPI A;  3ZW2 A;  2JMB A;  3FYF A;  3VE2 A;  1LFO A;  1PTS A;  3CMP A;  1OBP A;  4IAX A;  3O22 A;  4TKH A;  3RE6 A;  5EZ2 A;  1LDQ A;  1MM9 A;  2FS6 A;  4QRL A;  3SAO A;  5H9L A;  4CSB A;  5HBS A;  1VWD B;  2OFA A;  1TW4 A;  2MWH A;  4D6B A;  1D2U A;  1YWC A;  1LIE A;  1SWF A;  1SWO A;  3IFB A;  4MVI A;  1OBU A;  4GNY A;  1GXA A;  2LBA A;  3P02 A;  1CBQ A;  3SZJ A;  4B55 A;  5HA0 A;  1E06 A;  2OVA A;  2YMS A;  2FRS A;  3B2H A;  1RSU B;  3O2Y A;  1OPB A;  1U0X A;  2L68 A;  5FQ7 E;  1QFV A;  1GT5 A;  4TKB A;  3NQ3 A;  4MIR A;  3VGW A;  4KC8 A;  3UEU A;  1RLB E;  3ZW1 B;  3EC5 A;  4KH8 A;  3FIQ A;  3P6D A;  2GTF X;  3JSQ A;  1YWD A;  5CE4 A;  4QNI A;  3TGC A;  1AB0 A;  5HWZ A;  3APW A;  5IRW A;  2RTB B;  3NQK A;  4PSQ A;  3MG5 A;  3SLO A;  4OEM A;  4YBP A;  4GKC A;  2A8G A;  5FEN A;  3N91 A;  1BLR A;  3KQ0 A;  4O4X A;  2C1Q A;  1D3S A;  2F09 A;  3FW5 A;  3VG4 A;  1VWK B;  2QM9 A;  1MEP A;  4HPA A;  1UZ2 X;  4Y0P A;  1MK5 A;  1FEM A;  2JGS A;  1HBP A;  2FHN X;  3PH5 A;  5EDC A;  4GGR A;  3U9P C;  1BSO A;  1ZNE A;  2JU7 A;  4AZQ A;  3T6L A;  4O3Z A;  2OL6 O;  3D95 A;  4U8U O;  5CSE A;  4EKV A;  4Z27 A;  1N7Y A;  1NC9 A;  1SA8 A;  2RTM A;  4ZHC A;  3VG6 A;  1GX8 A;  1KT3 A;  4ZH9 A;  2BSZ A;  3G7X A;  1OSP O;  3ELX A;  5HCC C;  4RUU A;  3RBY A;  4TNN A;  1B4M A;  1ACD A;  1LCZ A;  5C0N A;  1HMT A;  3FA8 A;  4QYN A;  4LKP A;  1VWA B;  2I5V O;  4WBK A;  1BSY A;  4ODD A;  3WBG A;  3ZQ3 A;  1SXU A;  4CDF A;  1G7N A;  1NBX A;  2ALL X;  3APX A;  4CK4 A;  1QY2 A;  1JJX A;  4NV7 A;  1ERB A;  3BU1 A;  1PM1 X;  1QG5 A;  5D47 A;  2X8S A;  3CBS A;  1HMS A;  2WWP A;  3C76 X;  3CQN A;  3KFI A;  4YKO A;  2OY5 O;  4ZHG A;  5K67 A;  3PQU A;  5IRA A;  3P24 A;  2BT9 A;  5IO5 A;  5EPQ A;  3TF6 A;  4KCA A;  2BS6 A;  1W6F A;  3C78 X;  4AZR A;  4Z2P A;  4YGH A;  2W2A A;  2ACO A;  3ELZ A;  3HPE A;  3PP6 A;  4K19 A;  1E5P A;  3PDF A;  1FDQ A;  4YDA A;  3WZN A;  4CPH B;  5B5F A;  4O9S A;  1Y9T A;  4XMD A;  1N0S A;  3SLT A;  3FEK A;  4I60 A;  3T2W A;  3TGA A;  4YCE A;  5CYB A;  3Q6L A;  2IZI A;  3ZI8 A;  1KT6 A;  2WEX A;  1VWQ B;  2FGS A;  1FTP A;  1SRE A;  2M4L A;  1MDC A;  3EYC A;  1X8U A;  2HLV A;  2Z4I A;  3BRN A;  1VWH B;  1EAL A;  1EIO A;  2GTL N;  3VG7 A;  1FEN A;  1VWP B;  4COT A;  2RCQ A;  4YBU A;  4EXZ A;  1BBP A;  4GZV A;  2F73 A;  1TOU A;  2JOZ A;  3I0A A;  4FBO A;  5LJB A;  1EPB A;  1LNM A; 
#chains in the Genus database with same CATH homology
 4UU2 A;  5HTE A;  5H9A A;  3TZS A;  1GM6 A;  3B2J A;  3S26 A;  2R56 A;  3UEW A;  4HWM A;  4R0B A;  4ZR2 A;  3H3I A;  1CJ5 A;  1KZX A;  2RA6 A;  5BVT A;  4I3B A;  3KFH A;  2Q2P A;  1DFV A;  4OS0 A;  2FR2 A;  4YFP A;  1FEL A;  4QAE A;  2CZT A;  1EXS A;  2FWV A;  1I05 A;  1QFT A;  3WJC A;  2A0A A;  1HBQ A;  4ZH6 A;  2ASN X;  5LJC A;  1JV4 A;  4Y0S A;  3NX1 A;  3EBW A;  1X71 A;  1ZNL A;  1A2D A;  2EU7 X;  3FR5 A;  1BM5 A;  3RSW A;  1OBQ A;  4OMX A;  1ALB A;  1ML7 A;  1DZP A;  3LHN A;  5F6B A;  1DV9 A;  1ICN A;  2G78 A;  3VE1 A;  5KHP A;  4DQ4 A;  4U3Q A;  3PQS A;  2CBS A;  1NP4 A;  4XMG A;  4ZHH A;  1S2P A;  1X8O A;  3BS2 A;  3VG2 A;  1G5W A;  2K23 A;  1KOI A;  1E00 A;  1IFC A;  1MX7 A;  2QO5 A;  4ML7 B;  5EDB A;  1JJJ A;  1LIB A;  5HZ9 A;  2MHD A;  5FQ8 E;  1LPJ A;  4ZCB A;  1DZM A;  1EUO A;  2XST A;  2CM4 A;  2OVD A;  4RUN A;  4YDB A;  3UEX A;  3UEV A;  4AYH A;  3AKN A;  4ZHD A;  4XMF A;  1YWA A;  3F8A A;  2OVE A;  2X8T A;  4OS8 A;  2DM5 A;  2GJ5 A;  3WVM A;  4LZV A;  4LKT A;  1ZRY A;  4WFV A;  3BU9 A;  4FBV A;  2LBV A;  4A8Z A;  4ON1 A;  3VU1 A;  3PH6 A;  2X8F A;  1SY3 A;  1GKA B;  4KT5 A;  3HOL A;  1SXX A;  1BEB A;  5F58 A;  4INN A;  3U0D A;  4O4O A;  4ORU A;  1EW3 A;  3APV A;  1VPR A;  2OZQ A;  1R0U A;  4QGW A;  2FT9 A;  4WHI A;  5HZ5 A;  4Y0R A;  3TGB A;  5HZQ A;  4GK9 A;  3ZW0 A;  1HN2 A;  3HWD A;  3OD9 A;  1HMR A;  1OPA A;  2WQ9 A;  3B2I A;  5KIC A;  3APU A;  2JW1 A;  2FS7 A;  4QZT A;  1I4U A;  5LKF A;  1DZK A;  1CBS A;  3BSZ E;  4GDZ A;  4IB6 A;  3KFG A;  1A57 A;  3STK A;  2OVS A;  4FBR A;  1RBP A;  1Z24 A;  1CRB A;  3FA7 A;  3FEN A;  5K06 A;  2PY1 A;  4IAW A;  1T0V A;  2WSJ A;  3NP1 A;  1IW2 A;  4U9C A;  4A1H A;  1JZU A;  2W2B A;  2KT4 B;  5LJG A;  2A13 A;  4XME A;  3PEC A;  2LB6 A;  3FEL A;  2ANS A;  1DF3 A;  1PBO A;  3S5V A;  3EBK A;  4HPC A;  1B0O A;  4O3W A;  1AVG I;  3VG5 A;  5FAZ A;  5BVQ A;  4YCH A;  3B2K A;  4ORX A;  1H91 A;  3I17 A;  5EEE A;  4ALB A;  5JR8 A;  1A18 A;  2XKL A;  3D97 A;  4MVK A;  5B29 A;  1KQW A;  1GT4 A;  2A3F X;  2Q39 A;  1QWD A;  1URE A;  1YIV A;  1E02 A;  1ADL A;  3BLG A;  3CBC A;  4UU3 A;  2AL0 X;  3WJG A;  1ZND A;  2G79 A;  1GGL A;  4U8U N;  5LJE A;  4NLJ A;  1DZJ A;  1LID A;  5B27 A;  3E3C A;  3NPO A;  1SY1 A;  3HWG A;  1SMP I;  2HNX A;  5HZ8 A;  1S44 A;  1GT3 A;  3MVF A;  2WUT A;  2X45 A;  5HZ6 A;  3QKG A;  4M7M A;  1EQD A;  1T8V A;  5AQ6 A;  2AT0 X;  4AZO A;  2LKK A;  1ZNK A;  1X8Q A;  3T1D A;  3V8U A;  2CZU A;  2NNE A;  4OS3 A;  1ICM A;  1BSQ A;  1YP7 A;  1ERX A;  4LZU A;  2AT8 X;  4NYR A;  2Q4N A;  3L4R A;  1AEL A;  2CM9 A;  1OEK A;  1XCA A;  1ZNG A;  3DSZ A;  5D45 A;  2WR6 A;  5LJK A;  3D4R A;  2FLJ A;  2JN3 A;  3HWE A;  4O3Y A;  1KGL A;  1LF7 A;  3FLL A;  3FW4 A;  1GT1 A;  3NR3 A;  4NNT A;  4IB8 A;  1CBR A;  2WEW A;  1HQP A;  4GNW A;  4I95 A;  4EQA C;  2MM3 A;  2AH7 X;  2O62 A;  1I06 A;  4XMH A;  4YGG A;  5HA1 A;  3FEP A;  4EDE A;  4ORR A;  4ALO A;  2JU8 A;  2ZAG A;  4DQ3 A;  3RKG A;  2ZAI A;  4IMO A;  4ORY A;  3VG3 A;  1G74 A;  1NP1 A;  5FQ6 E;  1O8V A;  1LIC A;  5BYP A;  4NLI A;  1JIW I;  1KZW A;  1TOW A;  3F6Z B;  4O3X B;  4A60 A;  2E4J A;  3HK1 A;  1TXL A;  4HPD A;  2KTS A;  1U17 A;  4ZFX A;  4EFG A;  3UAQ A;  4NP1 A;  3OBL A;  2FTB A;  2HZQ A;  2NND A;  2BS5 A;  4NNS A;  3C77 X;  1VYG A;  4WFU A;  1BWY A;  3AKM A;  1KT7 A;  4YMY A;  4ARH A;  1YP6 A;  2KD2 A;  2CBR A;  3BX8 A;  1QY0 A;  3STN A;  3ZWE A;  3IA8 A;  3K3L A;  3WJF A;  4TKJ A;  1DC9 A;  5H9K A;  2MJI A;  1LIF A;  4TQ2 A;  1IIU A;  1I04 A;  5LJD A;  2GTL M;  1SXY A;  1QQS A;  2N93 A;  4IMN A;  3S5X A;  4NW4 A;  2MO5 A;  4AZN A;  2L67 A;  5H9N A;  2QOS C;  2R73 A;  3OJY C;  3KZA A;  1KQX A;  3CQR A;  2AKQ A;  4YGZ A;  1JYJ A;  1A3Y A;  2QO4 A;  5D48 A;  3FA9 A;  2AMM X;  1X89 A;  3ZUO A;  2K62 A;  5AEO A;  2KW1 A;  1Y9L A;  4MIS A;  4AZP A;  4CV7 A;  5EED A;  5L8I A;  1CBI A;  5H8T A;  4GE1 A;  1U18 A;  1SXW A;  1B56 A;  4NYQ A;  3NAD A;  4ES7 A;  2POA A;  5FFH A;  3ZZV A;  1L6M A;  2HZR A;  2A2U A;  1FE3 A;  4QZU A;  1TVQ A;  4QGV A;  3HWF A;  2QO6 A;  4GRJ A;  5HCE C;  5LKE A;  4IB9 A;  5DPQ A;  3S60 A;  2KTD A;  4LQZ A;  3CWK A;  2HMB A;  4D6A A;  2AT6 X;  1IKJ A;  4OMW A;  3GAQ A;  3P6E A;  3WJB A;  2QMI A;  2LA7 A;  3FA6 A;  2ACP X;  4O49 A;  2OFR X;  5AJB A;  1G85 A;  1S7D A;  3NX2 A;  3P6C A;  2AT3 X;  4YFR A;  2W2F A;  1OEJ A;  2RCT A;  4L3R A;  3FMZ A;  3NQ9 A;  1SY2 A;  4KII A;  1MUP A;  3KFF A;  3O19 A;  4FGI B;  3BY0 A;  5HTD A;  4M6S A;  4BVM A;  4ORW A;  5IO6 A;  1BRQ A;  2IFB A;  3DTQ A;  2NP1 A;  2RN4 A;  4IBA A;  1QAB E;  3HOE A;  2GTL O;  3BDR A;  3WJD A;  4ZJ0 A;  1BRP A;  1IKE A;  5D4A A;  4I9R A;  4KC7 A;  5F6Z A;  2BHV A;  5D8J A;  4I3C A;  1AQB A;  1BJ7 A;  4ZGU A;  3WJE A;  2AT5 X;  1OEE A;  4ORS A;  3P6F A;  4XMC A;  1T68 X;  5F1E A;  1KT4 A;  4JGL A;  3ZUI A;  4IAB A;  4FQB B;  3MX7 A;  4AZM A;  4MVE A;  3U03 A;  3EM0 A;  4Y0Q A;  4GH7 A;  1O1U A;  3HTY A;  4HPB A;  1EII A;  5HCD C;  2Q9S A;  2JU3 A;  3GE2 A;  4GET A;  3B2L A;  4N7D A;  3STM X;  1LKE A;  4BOE A;  3ZW0 B;  1O1V A;  1KXO A;  2WQA E;  4BQU A;  1P6P A;  1GKA A;  1YWB A;  4I3D A;  3SOT A;  1MVG A;  4TJZ A;  4IB7 A;  3ZW1 A;  2YG2 A;  3CR6 A;  2Q2M A;  3P6H A;  3RWX A;  2NNQ A;  2X46 A;  5HAE A;  5IO7 A;  3MBT A;  4A1Y A;  2Z4H A;  1PEE A;  1X8N A;  4ZGF A;  1PMP A;  1EPA A;  4QQ1 A;  5BVS A;  4AW8 A;  3BX7 A;  2R74 A;  3FR4 A;  2G7B A;  2L9C A;  2HYS A;  1KT5 A;  3D96 A;  2LFO A;  4O4U A;  2RQ0 A;  5KID A;  3P6G A;  2FR3 A;  4L1N A;  4YKM A;  1YUP A;  4QYP A;  3LV4 A;  1QY1 A;  3OE3 A;  5LJH A;  1VYF A;  2L5P A;  3NBX X;  5F7G A;  5AJC A;  4PJ2 A;  4TLJ A;  1JYD A;  5L8N A;  3JQO A;  1X8P A;  2P8G A;  3WXQ A;  1NGL A;  4U8U M;  4HFO A;  4GU8 A;  3EMM A;  2A2G A;  1B8E A;  5DG4 A;  1XKI A;  3RZY A;  4I6S A;  2OFM X;  3JS1 A;  4QGX A;  4MVL A;  4O4S A;  4ZHF A;  1SY0 A;  3PED A;  3VPJ E;  3F9D A;  4YH0 A;  2GC9 A;  4YFQ A;  3FR2 A;  2BLG A;  1ZNH A;  1EI5 A;  4N7C A;  1MX8 A;  1JBH A;  1IFB A;  4EEJ A;  2RD7 C;  4I9S A;  3PPT A;  4ID2 A;  1GX9 A;  3ZW2 A;  2JMB A;  3FYF A;  3VE2 A;  1LFO A;  3CMP A;  1OBP A;  4IAX A;  3O22 A;  4TKH A;  5EZ2 A;  2FS6 A;  4QRL A;  3SAO A;  5H9L A;  4CSB A;  5HBS A;  1TW4 A;  2MWH A;  4D6B A;  1D2U A;  1YWC A;  1LIE A;  3IFB A;  4MVI A;  1OBU A;  4GNY A;  1GXA A;  2LBA A;  3P02 A;  1CBQ A;  5HA0 A;  1E06 A;  2OVA A;  2YMS A;  2FRS A;  3B2H A;  3O2Y A;  1OPB A;  1U0X A;  2L68 A;  5FQ7 E;  1QFV A;  1GT5 A;  4TKB A;  3NQ3 A;  4MIR A;  4KC8 A;  3UEU A;  1RLB E;  3ZW1 B;  4KH8 A;  3FIQ A;  3P6D A;  2GTF X;  3JSQ A;  1YWD A;  5CE4 A;  4QNI A;  3TGC A;  1AB0 A;  5HWZ A;  3APW A;  3NQK A;  4PSQ A;  4YBP A;  4GKC A;  5FEN A;  3N91 A;  1BLR A;  3KQ0 A;  4O4X A;  1D3S A;  2F09 A;  3FW5 A;  3VG4 A;  2QM9 A;  4HPA A;  1UZ2 X;  4Y0P A;  1FEM A;  1HBP A;  3PH5 A;  5EDC A;  3U9P C;  1BSO A;  1ZNE A;  2JU7 A;  4AZQ A;  4O3Z A;  4U8U O;  3D95 A;  1SA8 A;  4ZHC A;  3VG6 A;  1GX8 A;  1KT3 A;  4ZH9 A;  3G7X A;  3ELX A;  5HCC C;  4RUU A;  3RBY A;  4TNN A;  1B4M A;  1ACD A;  5C0N A;  1HMT A;  3FA8 A;  4QYN A;  4LKP A;  4WBK A;  3WBG A;  1BSY A;  4ODD A;  3ZQ3 A;  5L8O A;  1SXU A;  1G7N A;  2ALL X;  3APX A;  4CK4 A;  1JJX A;  1QY2 A;  1ERB A;  3BU1 A;  1PM1 X;  1QG5 A;  5D47 A;  2X8S A;  3CBS A;  1HMS A;  2WWP A;  3C76 X;  3CQN A;  3KFI A;  4YKO A;  4ZHG A;  3PQU A;  3P24 A;  2BT9 A;  5IO5 A;  5EPQ A;  3TF6 A;  4KCA A;  2BS6 A;  4AZR A;  3C78 X;  4YGH A;  2W2A A;  2ACO A;  3ELZ A;  3PP6 A;  4K19 A;  1E5P A;  1FDQ A;  4YDA A;  4O9S A;  1Y9T A;  4XMD A;  1N0S A;  3FEK A;  3TGA A;  4YCE A;  5CYB A;  3Q6L A;  3ZI8 A;  1KT6 A;  2WEX A;  2M4L A;  3EYC A;  1FTP A;  3WOV A;  1MDC A;  1X8U A;  2HLV A;  2Z4I A;  3BRN A;  1EAL A;  1EIO A;  2GTL N;  3VG7 A;  1FEN A;  4COT A;  2RCQ A;  4YBU A;  4EXZ A;  1BBP A;  4GZV A;  2F73 A;  1TOU A;  2JOZ A;  3I0A A;  4FBO A;  5LJB A;  1EPB A;  1LNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...