2JMBA

Solution structure of the protein atu4866 from agrobacterium tumefaciens
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
MQHPYVGIWVTADGRIRQELLPNGRYDEARGNRKSAYQGRYEVRGAHINYWDDTGFTADGDFVSANELHHGGMTFYREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Atu4866
publication title Solution structure of the protein Atu4866 from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11512 Atu4866 Agrobacterium tumefaciens protein Atu4866
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.290 Mainly Beta Beta Barrel Lipocalin Lipocalin 2jmbA00
2JMBA
chains in the Genus database with same CATH superfamily
2QO6A 4KIIA 4Z27A 3P6HA 1ZNLA 4JHQA 1KT6A 1B8EA 1DF8A 1HQQA 1I78A 3IFBA 1NP1A 1PBOA 2OFRX 3E3CA 3F9DA 3X00A 4FBOA 5HWZA 2E4JA 3U0DA 1FEMA 2RCQA 2X8TA 1ICMA 3RE6A 1YWDA 3FA7A 3BDRA 1VWIB 5D4AA 1ZRYA 2RTMA 1N9YA 1DFVA 1EPAA 2AT6X 4OKAA 1SWHA 2RTKA 4CPHB 4ZJ0A 3CBCA 3Q6LA 4UU2A 1FDQA 2FRSA 3BSZE 2A2GA 1SLEB 2OY7A 5L3YA 1MUPA 3CQNA 1FJ1E 3NX2A 1JV4A 1LDQA 2OFAA 3T2WA 3V8UA 2ANSA 3WZNA 4YBPA 3ZQ3A 1HMRA 3VG3A 2G7BA 2GH7A 3SAOA 1BJ7A 1UREA 1AVGI 2ACOA 4QAEA 4XMFA 1W6FA 2O62A 4NYQA 1VWEB 3FELA 3C78X 2OFBA 1ACDA 4O4OA 4QZUA 4YCEA 3VHMA 4I3DA 1VWRB 1G85A 1E02A 1SXUA 2X46A 4QRLA 4CPIA 3VG5A 1KZXA 4QNIA 4Y59A 4BX7A 1MOYA 1BBPA 1K3BA 1STPA 2F73A 4AZNA 1IFBA 1GX9A 3AUMO 1X8PA 1W5RA 1VWKB 1HMSA 3B2KA 1IJ8A 4NNTA 2GTLM 1Y0GA 4IB7A 1VPRA 4ORYA 1EIIA 2JOZA 1CRBA 4IRWA 3VU1A 4WHIA 2OY8A 2A5BA 1QG5A 2HZQA 4TJZA 2VDFA 3OBLA 2YMSA 3BU1A 1PEEA 2LBAA 3UEUA 1RSTB 2XKLA 4Y0PA 1N4JA 1CBRA 2WQAE 2JU8A 3PK2A 1YP6A 1SWTA 3PPTA 1OBUA 1IIUA 1CBQA 4BX7B 5B5FA 4BX6A 1R0UA 2WWPA 1MDCA 1E06A 2KD2A 4BGFA 2LB6A 1AVDA 3EC5A 5HCEC 1X8OA 4O9SA 2HNXA 5CHKA 2RTEB 2Q39A 3SZIA 1LPJA 2JGSA 4YCHA 5IXGA 1RXHA 4CPFA 1SWEA 1GGLA 1I4UA 1SWAA 1X8QA 2G78A 3S5XA 4GDAA 4NV8A 5B5GA 4KCAA 1NQMA 3CKGA 2JMBA 2CBRA 5LKFA 1JJJA 1ERXA 1I06A 2Q2PA 3HWEA 4YBUA 3T6FA 1G5WA 1X8UA 2OY1O 2RTFB 3ZZVA 2MM3A 1KL5A 1EW3A 5AJBA 3NP1A 4ZH6A 4MVKA 3WXQA 3STKA 2FKJA 5K67A 3P24A 5D8JA 3WJFA 1CBIA 1KOIA 1SRHA 2R56A 1HQPA 1NBXA 3CKFA 3RDMA 4ZHCA 1SMPI 3U03A 3VPJE 1SLFB 5AEOA 4FGIB 3KFFA 4ALBA 3WJBA 2IZBA 3IA8A 3OD9A 1N7YA 2A8GA 2HMBA 1SWSA 2OL7A 3D95A 4ORUA 4QZTA 4A1YA 3SLTA 3HWFA 2K62A 3EBWA 4U9CA 1LKEA 3WZQA 1A2DA 4M7MA 3EYCA 2CBSA 2LA7A 1QABE 4RUNA 3ZW0A 3FA9A 2RTGB 2RTRB 4I3BA 2JU7A 2A2UA 1SWJA 2GTFX 4GZVA 4MIRA 1ADLA 4U8UO 4YKMA 5D45A 4A8ZA 4OELA 4BX5B 1L6MA 3UEWA 4O3YA 2AKQA 1GKAA 2RD7C 4WFUA 4YMYA 1ZNKA 5AQ6A 1YP7A 4YFRA 3D97A 2MO5A 3SLOA 1FE3A 1VWOB 1LIDA 2RQ0A 3KVNA 1RSUB 5BYPA 4Z2VA 3ZW1B 4O3WA 4QYNA 3BRNA 3FR4A 3KFHA 1ZNEA 2IZCB 3D96A 5AJCA 5H9KA 2RA6A 5D47A 5DG4A 3ZW0B 2KTSA 2FKGA 3K3LA 1QY2A 3CBSA 1IKJA 2BC3A 2AF5A 4GGTA 5L8NA 2IZHB 2QO4A 1DF3A 3UEVA 2LFOA 3P6EA 2OYBO 3FR2A 1GKAB 4O4UA 3KFGA 2W2FA 4ALOA 2RTHB 1HBPA 1AB0A 4GRJA 2L9CA 1STRB 4EXZA 5JD2A 1PBYA 2AMMX 2WQ9A 2DM5A 3CQRA 1LIEA 1SY0A 2A3FX 2WEWA 3O19A 4NV7A 3ZI8A 4OMXA 1TVQA 2OVAA 3SZJA 4ON1A 1SWBA 5F2BA 4DNEA 5JR8A 2FHLA 3SLJA 1VWBB 2LKKA 1ALBA 3VG6A 2FTBA 4LZUA 2GC9A 1LIBA 1DV9A 1NDJA 4IABA 4IAWA 3WBGA 4ZGFA 1SRGA 1GT5A 3FLLA 3RDUA 2OVSA 2WR6A 4QYPA 1PMPA 2BSZA 5B27A 1SXWA 4TKJA 1JMXA 2AVIA 4XMHA 4GD9A 1JQPA 1SWFA 4ZHGA 1YWAA 4WFVA 4XMEA 4HFOA 5CSEA 4ZGUA 1JJXA 1BLRA 3O22A 5LJEA 3PDFA 4NYRA 4IBAA 1FTPA 4GH7A 5HZQA 2WSJA 1PTSA 5IRAA 3STMX 3TZSA 1S7DA 4NNSA 1BSOA 2IZDB 3VE2A 4AZQA 3EM0A 2Q9SA 3F6ZB 2ACPX 1SRFA 5B11O 2GTLO 3VE1A 1X89A 4FBRA 3RWXA 2X56A 2BT9A 2R74A 1SWKA 4YGGA 5HA0A 1FENA 3HWGA 1DC9A 1SREA 4YGHA 2OF8A 1JBHA 4EFGA 4ES7A 2IZEB 1LELA 3PEDA 1XKIA 3JQOA 5L8OA 3P6GA 3RBYA 1E5PA 2PY1A 3TF6A 4CDFA 1VWGB 3BX8A 3FW5A 1KT3A 3EW1A 4GGRA 1MK5A 1SWDA 1FELA 1P6PA 4A60A 5LJKA 4QGXA 1RXKA 2FS7A 4ZH9A 5C0NA 2BLGA 1CJ5A 2JN3A 4CV7A 1AQBA 1AELA 3H3IA 5EZ2A 4BQUA 4UU3A 2BHVA 1KT4A 4TKHA 2I5ZO 3GAQA 1T68X 2KTDA 1TW4A 1HXZA 3MBTA 1BRQA 3WYPA 3HPEA 4OS3A 4YVBA 1VWLB 2F09A 4L1NA 2AT5X 4YH0A 4Y5DA 3ZUOA 4YKOA 1BM5A 3CR6A 2CZUA 4BCSA 4IB8A 3ZW2A 1QY0A 1VYOA 2ZAIA 1BSYA 4NLJA 5LJGA 4DCBA 2AT0X 3L4RA 4YFPA 2QO5A 2L5PA 2X55A 5HA1A 5HTEA 3VG2A 1X71A 3Q34A 1IFCA 5B29A 1SWPA 3P6CA 3PP6A 1MX8A 3MVFA 1X8NA 2W2AA 4BX6B 2DJFA 3U9PC 1HY2A 4AZOA 4BBOA 1DZPA 2ZSCA 2C1SA 4IAXA 4U3QA 5K06A 1U17A 4OMWA 1ICNA 2NNDA 4GNYA 4AZMA 3BX7A 3AEHA 4IMOA 2NNEA 1TOUA 4R0BA 4AZRA 2RTBB 1DZMA 4Z6JA 3BLGA 3QQ2A 1KQWA 4YDAA 1NGLA 3LV4A 5B3MO 2X45A 4HPAA 4GUZA 1SWLA 1Y53X 1SRIA 1VWJB 2AL0X 2FS6A 2VFCA 3FIQA 3PQUA 4AYHA 2MWHA 1KXOA 2KT4B 1LCZA 2L68A 2QCBA 2Y32A 1UYOX 3APVA 4O49A 5EPQA 1AVEA 1DZKA 4GE1A 2OVDA 2QOSC 3CMPA 3I0AA 3EBKA 3RY1A 3RY2A 3WYQA 4ZHHA 1JIWI 2OVEA 1S44A 5LJDA 4QGVA 2IZGB 1YIVA 3WJCA 2FWVA 2MF6A 4XMDA 1OEJA 1SWCA 3NQKA 4INNA 1G7NA 2QOMA 1SWGA 5LKEA 1JYJA 1OPAA 1IKEA 2G79A 4OS8A 3APXA 4Y0RA 2Z4HA 2WPUA 1VWQB 3NX1A 2RTQB 1VWHB 3LTWA 1MVGA 4JGLA 4GGZA 5IRUA 1GT1A 1G74A 4IMNA 2RTJA 2YG2A 3NPOA 2CM4A 4CSBA 3T1DA 3BY0A 4K19A 3D4RA 4NLIA 2RTCB 4AW8A 4GK9A 4YDBA 1PM1X 4OEMA 4MEEA 1SWQA 2X8FA 4LQZA 1GX8A 2RN4A 2LBVA 3S26A 1K24A 4ARHA 5F6BA 1A57A 3TGBA 2OL6O 1KFFA 1JYDA 1QQSA 3DTQA 2ZAGA 1OPBA 1KT7A 2NP1A 3C76X 3VG4A 1RBPA 2RTAA 2FR2A 4Y0QA 3RZYA 2Q4NA 1VWCB 3WJGA 2X32A 3FYFA 3NQ3A 1UZ2X 2FT9A 2OF9A 2CAMA 4U8UM 3VHIA 1BWYA 5EDCA 4BVMA 1QFTA 5HZ9A 3OE3A 1Y52X 1LF7A 1RAVA 1ZNGA 2FR3A 1LDOA 1WBIA 2IZFB 1O1UA 2MHDA 2POAA 5EDBA 4A1HA 2JU3A 1KZWA 3AKMA 1KL3A 4I6SA 1BSQA 1CBSA 3RKGA 1QWDA 3FA8A 4O3XB 3T2XA 1HN2A 1T8VA 3T6LA 1Z24A 1EALA 2W2BA 4ORXA 3FA6A 3O2YA 1SXXA 1IW2A 4KC7A 5FQ6E 1EQDA 5H9AA 3RDSA 1LUQA 3STNA 3APUA 4CDCA 4CPHA 1SY1A 2NNQA 1LCVA 2Z4IA 2GJ5A 4GETA 5HCCC 1JZUA 5BVTA 4NP1A 1JJUA 1KQXA 4GNWA 3RDQA 3D9WA 3FMZA 3ZWEA 4EDEA 1I04A 5KHPA 3GE2A 2OL8O 1UYNX 2IFBA 1KT5A 2HYSA 2IZKA 4ZR2A 5HZ6A 5EEEA 3TGCA 4TKBA 1ML7A 1SXYA 2C1QA 3CWKA 3WJEA 2RTLA 4CDDA 3FENA 4PSQA 4LZVA 2X4MA 3VHHA 5IRWA 2A13A 1JMZA 2OY5O 3RSWA 4DQ4A 3HTYA 2AH7X 1EXSA 2RCTA 3UAQA 1STSB 5FENA 1B4MA 3MG5A 1LCWA 3WJDA 1SA8A 2UYWA 5F58A 5HZ8A 4Y0SA 5H9NA 3P6FA 2IZAA 2C4IA 2WUTA 4CK4A 1QFVA 5KICA 3B2HA 1B56A 2VFBA 4GDZA 1Y9LA 4U8UN 1I05A 4HWMA 2P8GA 2MJIA 5L8IA 4TLJA 5H8TA 3OJYC 4I3CA 4D6BA 1YUPA 4MVIA 4TQ2A 1E2TA 5CYBA 4JNJA 3N91A 1EIOA 2WEXA 4CDEA 2OZQA 4O4XA 1HXLA 1NC9A 1B0OA 2QMIA 3BS2A 2A5CA 3FEKA 3KZAA 2ASNX 4IB9A 4KT5A 2HLVA 4COTA 1NP4A 5F1EA 4LKTA 2KW1A 1O1VA 5LJBA 1SWUA 5HTDA 1WUBA 2R73A 3PQSA 4KH8A 5F6ZA 5CE4A 1EI5A 2AT8X 3PH6A 4YGZA 4ORWA 4M6SA 2FLJA 1LICA 4GJVA 3LHNA 3ELXA 3WZOA 4Z28A 1GM6A 1N9MA 3KQ0A 4D6AA 4ODDA 2RTNB 2BS6A 1YWCA 2I5VO 5HCDC 1EUOA 1ZNHA 4I95A 2OFMX 1E00A 4O3ZA 4OS0A 3ELZA 3NBXX 4CPEA 2RTDB 4EQAC 5KIDA 5FAZA 4ZHDA 2G5LA 3NQ9A 1Y9TA 3NR3A 4ZHFA 1SWRA 4I9RA 3FR5A 5H9LA 5B2AO 4Z2PA 1W4TA 4YFQA 3FW4A 1HBQA 1MX7A 4I60A 4Z2OA 1RLBE 1U18A 3F8AA 1VWFB 5FFHA 5IO7A 3EW2A 5DPQA 1LNMA 4EEJA 4RUUA 1DZJA 2HZRA 3SZHA 1SLDB 4DQ3A 2M4LA 1MEPA 1N0SA 1A3YA 1SY2A 1VWDB 2Y3FA 5K68A 3SOTA 3TGAA 3B2LA 4QQ1A 5LJCA 1GT3A 5D48A 1OEEA 2K23A 2IZLB 3VGWA 4MVEA 4GKCA 2G8CO 2PI3O 4HPBA 1O8VA 1MM9A 5HAEA 2Q2MA 1QY1A 3FDCA 1D3SA 3HWDA 4LKPA 4ZCBA 1T0VA 4EKVA 2A0AA 4TNNA 4BX5A 2RTOB 3KFIA 5IO5A 3BU9A 1SRJA 3PECA 3G7XA 1D2UA 3JS1A 4ML7B 2CM9A 3S60A 1OSPO 2F01A 4PJ2A 4FBVA 4IB6A 1HMTA 1RXJA 1U0XA 1N43A 2DJGA 2QM9A 3HK1A 2GTLN 4XMGA 2IZIA 3FIDA 3UEXA 3B2JA 3ZW1A 2JW1A 5LJHA 1VYGA 3HOLA 4ID2A 2UZ2A 2EU7X 2XSTA 4B55A 3C77X 1VYFA 3RDOA 4QGWA 1OBPA 1EPBA 1VWNB 4KC8A 3VG7A 2FHNX 3DSZA 4GU8A 5F7GA 5BVQA 3I17A 4AZPA 4N7DA 1BEBA 1H91A 1TXLA 3APWA 4FQBB 2ALLX 3AKNA 4ORRA 2X8SA 4XMCA 2IZJA 3WVMA 3JSQA 4U46A 3EMMA 3MX7A 1SLGB 2FGSA 4NW4A 1XCAA 1Y55X 1A18A 3RE5A 1S2PA 5BVSA 4BOEA 1GX3A 3P6DA 2Y3EA 2N93A 4HPDA 2X34A 1KL4A 3P02A 4ORSA 5FQ7E 3ZUIA 1OEKA 4C5PA 4O4SA 1TOWA 4ZFXA 3FEPA 2L67A 5HZ5A 3WOVA 1NQNA 4GJSA 1YWBA 1ERBA 2BS5A 5HBSA 5FQ8E 4MISA 5IO6A 4MVLA 1VWAB 1GT4A 4N7CA 4BJ8A 3NADA 3B2IA 2AT3X 4JO6A 1LIFA 3WZPA 4I9SA 1ZNDA 5EEDA 4WBKA 3QKGA 1BRPA 1I9HA 2RTPB 5B10O 1SWNA 2CZTA 2HKDA 1VWPB 1SWOA 3HOEA 3PH5A 3S5VA 3MM0A 1GXAA 1OBQA 3RDXA 1KGLA 1SY3A 1VWMB 1LFOA 4L3RA 2RTIB 4HPCA
chains in the Genus database with same CATH topology
2QO6A 4KIIA 3P6HA 1ZNLA 1KT6A 1B8EA 3IFBA 1NP1A 1PBOA 2OFRX 3E3CA 3F9DA 5HWZA 4FBOA 2E4JA 3U0DA 1FEMA 2RCQA 2X8TA 1ICMA 1YWDA 3FA7A 3BDRA 5D4AA 1ZRYA 1DFVA 1EPAA 2AT6X 4ZJ0A 3CBCA 3Q6LA 4UU2A 1FDQA 2FRSA 3BSZE 2A2GA 1MUPA 3CQNA 3NX2A 1JV4A 3V8UA 4YBPA 2ANSA 3ZQ3A 1HMRA 3VG3A 2G7BA 3SAOA 1BJ7A 1UREA 1AVGI 2ACOA 4QAEA 4XMFA 2O62A 4NYQA 3FELA 3C78X 4O4OA 1ACDA 4QZUA 4YCEA 4I3DA 1G85A 1E02A 1SXUA 2X46A 4QRLA 3VG5A 1KZXA 4QNIA 1BBPA 2F73A 4AZNA 1IFBA 1GX9A 1X8PA 1HMSA 3B2KA 4NNTA 2GTLM 4IB7A 4ORYA 1VPRA 1EIIA 2JOZA 1CRBA 3VU1A 4WHIA 1QG5A 2HZQA 4TJZA 3OBLA 2YMSA 3BU1A 1PEEA 2LBAA 3UEUA 2XKLA 4Y0PA 1CBRA 2WQAE 2JU8A 3PPTA 1YP6A 1OBUA 1IIUA 1CBQA 1R0UA 2WWPA 1MDCA 1E06A 2KD2A 2LB6A 5HCEC 1X8OA 4O9SA 2HNXA 2Q39A 1LPJA 4YCHA 1GGLA 1I4UA 1X8QA 2G78A 3S5XA 4FBRA 1JJJA 4KCAA 5LKFA 2JMBA 2CBRA 1ERXA 1I06A 2Q2PA 3HWEA 4YBUA 1G5WA 1X8UA 3ZZVA 2MM3A 1EW3A 5AJBA 3NP1A 4ZH6A 4MVKA 3WXQA 3STKA 3P24A 5D8JA 3WJFA 1CBIA 1KOIA 2R56A 4ZHHA 1HQPA 4ZHCA 1SMPI 3U03A 3VPJE 5AEOA 4FGIB 3KFFA 4ALBA 3WJBA 3IA8A 3OD9A 4ORUA 4QZTA 2HMBA 4A1YA 3D95A 3HWFA 2K62A 3EBWA 4U9CA 1LKEA 1A2DA 4M7MA 3EYCA 2CBSA 2LA7A 1QABE 4RUNA 3ZW0A 3FA9A 4I3BA 2JU7A 2A2UA 2GTFX 4GZVA 4MIRA 1ADLA 4U8UO 4YKMA 5D45A 4A8ZA 1L6MA 3UEWA 4O3YA 2AKQA 1GKAA 2RD7C 4WFUA 4YMYA 1ZNKA 5AQ6A 1YP7A 4YFRA 3D97A 2MO5A 1FE3A 1LIDA 2RQ0A 5BYPA 3ZW1B 4O3WA 4QYNA 3BRNA 3FR4A 3KFHA 1ZNEA 3D96A 5AJCA 5H9KA 3ZW0B 2RA6A 5D47A 5DG4A 2KTSA 3K3LA 1QY2A 3CBSA 1IKJA 5L8NA 2QO4A 1DF3A 3UEVA 2LFOA 3P6EA 3FR2A 1GKAB 4O4UA 3KFGA 2W2FA 4ALOA 1HBPA 1AB0A 4GRJA 2L9CA 4EXZA 2AMMX 2WQ9A 2DM5A 3CQRA 1LIEA 1SY0A 2A3FX 2WEWA 3O19A 3ZI8A 4OMXA 1TVQA 2OVAA 4ON1A 5JR8A 2LKKA 1ALBA 3VG6A 2FTBA 4LZUA 2GC9A 1LIBA 4IABA 4IAWA 3WBGA 4ZGFA 1GT5A 3FLLA 2OVSA 2WR6A 4QYPA 1PMPA 5B27A 1SXWA 4TKJA 4XMHA 1YWAA 4WFVA 4XMEA 4HFOA 1JJXA 4ZGUA 1BLRA 3O22A 5LJEA 4NYRA 4IBAA 1FTPA 4GH7A 5HZQA 2WSJA 3STMX 3TZSA 1S7DA 4NNSA 1BSOA 3VE2A 4AZQA 3EM0A 2Q9SA 3F6ZB 2ACPX 3VE1A 2GTLO 1X89A 3RWXA 2BT9A 2R74A 4YGGA 5HA0A 1FENA 3HWGA 1DC9A 4YGHA 1JBHA 4EFGA 4ES7A 3PEDA 1XKIA 3JQOA 5L8OA 3P6GA 1E5PA 2PY1A 3TF6A 3BX8A 3FW5A 1KT3A 5LJKA 1KZWA 4A60A 1FELA 1P6PA 4QGXA 2FS7A 4ZH9A 5C0NA 2BLGA 1CJ5A 2JN3A 4CV7A 1AQBA 1AELA 3H3IA 5EZ2A 4BQUA 4UU3A 2BHVA 1KT4A 4TKHA 3GAQA 1T68X 2KTDA 1TW4A 3MBTA 1BRQA 4OS3A 2F09A 4L1NA 2AT5X 4YH0A 3ZUOA 4YKOA 1BM5A 3CR6A 2CZUA 4IB8A 3ZW2A 1QY0A 2ZAIA 1BSYA 4NLJA 5LJGA 2AT0X 3L4RA 4YFPA 2QO5A 2L5PA 5HA1A 5HTEA 3VG2A 1X71A 1IFCA 5B29A 3P6CA 3PP6A 1MX8A 3MVFA 1X8NA 2W2AA 3U9PC 4AZOA 1DZPA 4IAXA 4U3QA 5K06A 1U17A 4OMWA 1ICNA 2NNDA 4GNYA 4AZMA 3BX7A 4IMOA 2NNEA 1TOUA 4R0BA 4AZRA 1DZMA 3BLGA 1KQWA 4YDAA 1NGLA 3LV4A 2X45A 4HPAA 5HCDC 2FS6A 4AYHA 2AL0X 3FIQA 3PQUA 2MWHA 1KXOA 2KT4B 2L68A 4O49A 5EPQA 3APVA 1DZKA 4GE1A 2OVDA 2QOSC 3CMPA 3I0AA 3EBKA 1JIWI 2OVEA 1S44A 5LJDA 4QGVA 1YIVA 3WJCA 2FWVA 4XMDA 1OEJA 3NQKA 4INNA 1G7NA 5LKEA 1JYJA 1OPAA 1IKEA 2G79A 4OS8A 3APXA 4Y0RA 2Z4HA 3NX1A 1MVGA 4JGLA 1GT1A 1G74A 4IMNA 2YG2A 3NPOA 2CM4A 4CSBA 3T1DA 3BY0A 4K19A 3D4RA 4NLIA 4AW8A 4GK9A 4YDBA 1PM1X 2X8FA 4LQZA 1GX8A 2RN4A 2LBVA 3S26A 1A57A 4ARHA 5F6BA 3TGBA 1JYDA 1QQSA 3DTQA 2ZAGA 1OPBA 1KT7A 2NP1A 3C76X 3VG4A 1RBPA 2FR2A 4Y0QA 3RZYA 2Q4NA 3WJGA 3FYFA 3NQ3A 1UZ2X 2FT9A 4U8UM 1BWYA 5EDCA 4BVMA 1QFTA 5HZ9A 3OE3A 1LF7A 1ZNGA 2FR3A 5EDBA 2MHDA 1O1UA 4A1HA 2POAA 2JU3A 3AKMA 4I6SA 1BSQA 1CBSA 3RKGA 1QWDA 3FA8A 4O3XB 1HN2A 1T8VA 1Z24A 1EALA 2W2BA 4ORXA 3FA6A 3O2YA 1SXXA 1IW2A 4KC7A 5FQ6E 1EQDA 5H9AA 3STNA 3APUA 1SY1A 2NNQA 4GETA 2Z4IA 2GJ5A 5HCCC 1JZUA 5BVTA 4NP1A 1KQXA 4GNWA 3ZWEA 3FMZA 4EDEA 1I04A 5KHPA 3GE2A 2IFBA 1KT5A 2HYSA 4ZR2A 5HZ6A 5EEEA 3TGCA 4TKBA 1ML7A 1SXYA 3CWKA 3FENA 4PSQA 4LZVA 2A13A 3RSWA 4DQ4A 3HTYA 2AH7X 1EXSA 2RCTA 3UAQA 5FENA 1B4MA 3WJDA 1SA8A 5HZ8A 5F58A 4Y0SA 5H9NA 3P6FA 2WUTA 4CK4A 1QFVA 5KICA 3B2HA 1B56A 4GDZA 1Y9LA 4U8UN 1I05A 4HWMA 2P8GA 2MJIA 5L8IA 4TLJA 5H8TA 3OJYC 4I3CA 4D6BA 1YUPA 4MVIA 4TQ2A 5CYBA 3N91A 1EIOA 2WEXA 2OZQA 4O4XA 2QMIA 1B0OA 3BS2A 3FEKA 3KZAA 4IB9A 4KT5A 2ASNX 3RBYA 4COTA 2HLVA 1NP4A 5F1EA 4LKTA 2KW1A 1O1VA 5LJBA 5HTDA 3PQSA 2R73A 4KH8A 5F6ZA 5CE4A 1EI5A 2AT8X 3PH6A 4YGZA 4ORWA 4M6SA 2FLJA 1LICA 3LHNA 3ELXA 1GM6A 3KQ0A 4D6AA 4ODDA 2BS6A 1YWCA 1EUOA 1ZNHA 4I95A 2OFMX 1E00A 4O3ZA 4OS0A 3ELZA 3NBXX 4EQAC 5KIDA 5FAZA 4ZHDA 3NQ9A 1Y9TA 3NR3A 4ZHFA 4I9RA 3FR5A 5H9LA 4YFQA 3FW4A 1HBQA 1MX7A 1RLBE 1U18A 3F8AA 5FFHA 5IO7A 5DPQA 4EEJA 1LNMA 4RUUA 1DZJA 2HZRA 4DQ3A 2M4LA 3TGAA 1N0SA 1A3YA 1SY2A 1KGLA 3SOTA 3B2LA 4QQ1A 5LJCA 1GT3A 5D48A 1OEEA 2K23A 4MVEA 4GKCA 4HPBA 1O8VA 5HAEA 2Q2MA 1QY1A 1D3SA 3HWDA 4LKPA 4ZCBA 1T0VA 2A0AA 4TNNA 5IO5A 3KFIA 3BU9A 3PECA 3G7XA 1D2UA 3JS1A 4ML7B 2CM9A 3S60A 4PJ2A 4FBVA 4IB6A 1HMTA 1U0XA 2QM9A 4XMGA 3UEXA 1DV9A 3HK1A 2GTLN 3B2JA 3ZW1A 2JW1A 5LJHA 1VYGA 3HOLA 4ID2A 2XSTA 2EU7X 3C77X 1VYFA 4QGWA 1OBPA 1EPBA 4KC8A 3VG7A 3DSZA 4GU8A 5F7GA 5BVQA 4AZPA 3I17A 4N7DA 1BEBA 1H91A 1TXLA 3APWA 4FQBB 2ALLX 3AKNA 4ORRA 2X8SA 4XMCA 3WVMA 3JSQA 3EMMA 3MX7A 4NW4A 1XCAA 1A18A 1S2PA 5BVSA 4BOEA 3P6DA 2N93A 4HPDA 3P02A 4ORSA 5FQ7E 3ZUIA 1OEKA 4O4SA 1TOWA 4ZFXA 3FEPA 2L67A 5HZ5A 3WOVA 1YWBA 1ERBA 2BS5A 5HBSA 5FQ8E 4MISA 5IO6A 4MVLA 1GT4A 4N7CA 3NADA 3B2IA 2AT3X 1LIFA 4I9SA 1ZNDA 5EEDA 4WBKA 3QKGA 1BRPA 3WJEA 4ZHGA 3HOEA 2CZTA 3PH5A 3S5VA 1GXAA 1OBQA 1SY3A 1LFOA 4L3RA 4HPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMB A; 
#chains in the Genus database with same CATH topology
 2QO6 A;  4KII A;  4Z27 A;  3P6H A;  1ZNL A;  4JHQ A;  1KT6 A;  1B8E A;  1DF8 A;  1HQQ A;  1I78 A;  3IFB A;  1NP1 A;  1PBO A;  2OFR X;  3E3C A;  3F9D A;  3X00 A;  4FBO A;  5HWZ A;  2E4J A;  3U0D A;  1FEM A;  2RCQ A;  2X8T A;  1ICM A;  3RE6 A;  1YWD A;  3FA7 A;  3BDR A;  1VWI B;  5D4A A;  1ZRY A;  2RTM A;  1N9Y A;  1DFV A;  1EPA A;  2AT6 X;  4OKA A;  1SWH A;  2RTK A;  4CPH B;  4ZJ0 A;  3CBC A;  3Q6L A;  4UU2 A;  1FDQ A;  2FRS A;  3BSZ E;  2A2G A;  1SLE B;  2OY7 A;  5L3Y A;  1MUP A;  3CQN A;  1FJ1 E;  3NX2 A;  1JV4 A;  1LDQ A;  2OFA A;  3T2W A;  3V8U A;  2ANS A;  3WZN A;  4YBP A;  3ZQ3 A;  1HMR A;  3VG3 A;  2G7B A;  2GH7 A;  3SAO A;  1BJ7 A;  1URE A;  1AVG I;  2ACO A;  4QAE A;  4XMF A;  1W6F A;  2O62 A;  4NYQ A;  1VWE B;  3FEL A;  3C78 X;  2OFB A;  1ACD A;  4O4O A;  4QZU A;  4YCE A;  3VHM A;  4I3D A;  1VWR B;  1G85 A;  1E02 A;  1SXU A;  2X46 A;  4QRL A;  4CPI A;  3VG5 A;  1KZX A;  4QNI A;  4Y59 A;  4BX7 A;  1MOY A;  1BBP A;  1K3B A;  1STP A;  2F73 A;  4AZN A;  1IFB A;  1GX9 A;  3AUM O;  1X8P A;  1W5R A;  1VWK B;  1HMS A;  3B2K A;  1IJ8 A;  4NNT A;  2GTL M;  1Y0G A;  4IB7 A;  1VPR A;  4ORY A;  1EII A;  2JOZ A;  1CRB A;  4IRW A;  3VU1 A;  4WHI A;  2OY8 A;  2A5B A;  1QG5 A;  2HZQ A;  4TJZ A;  2VDF A;  3OBL A;  2YMS A;  3BU1 A;  1PEE A;  2LBA A;  3UEU A;  1RST B;  2XKL A;  4Y0P A;  1N4J A;  1CBR A;  2WQA E;  2JU8 A;  3PK2 A;  1YP6 A;  1SWT A;  3PPT A;  1OBU A;  1IIU A;  1CBQ A;  4BX7 B;  5B5F A;  4BX6 A;  1R0U A;  2WWP A;  1MDC A;  1E06 A;  2KD2 A;  4BGF A;  2LB6 A;  1AVD A;  3EC5 A;  5HCE C;  1X8O A;  4O9S A;  2HNX A;  5CHK A;  2RTE B;  2Q39 A;  3SZI A;  1LPJ A;  2JGS A;  4YCH A;  5IXG A;  1RXH A;  4CPF A;  1SWE A;  1GGL A;  1I4U A;  1SWA A;  1X8Q A;  2G78 A;  3S5X A;  4GDA A;  4NV8 A;  5B5G A;  4KCA A;  1NQM A;  3CKG A;  2JMB A;  2CBR A;  5LKF A;  1JJJ A;  1ERX A;  1I06 A;  2Q2P A;  3HWE A;  4YBU A;  3T6F A;  1G5W A;  1X8U A;  2OY1 O;  2RTF B;  3ZZV A;  2MM3 A;  1KL5 A;  1EW3 A;  5AJB A;  3NP1 A;  4ZH6 A;  4MVK A;  3WXQ A;  3STK A;  2FKJ A;  5K67 A;  3P24 A;  5D8J A;  3WJF A;  1CBI A;  1KOI A;  1SRH A;  2R56 A;  1HQP A;  1NBX A;  3CKF A;  3RDM A;  4ZHC A;  1SMP I;  3U03 A;  3VPJ E;  1SLF B;  5AEO A;  4FGI B;  3KFF A;  4ALB A;  3WJB A;  2IZB A;  3IA8 A;  3OD9 A;  1N7Y A;  2A8G A;  2HMB A;  1SWS A;  2OL7 A;  3D95 A;  4ORU A;  4QZT A;  4A1Y A;  3SLT A;  3HWF A;  2K62 A;  3EBW A;  4U9C A;  1LKE A;  3WZQ A;  1A2D A;  4M7M A;  3EYC A;  2CBS A;  2LA7 A;  1QAB E;  4RUN A;  3ZW0 A;  3FA9 A;  2RTG B;  2RTR B;  4I3B A;  2JU7 A;  2A2U A;  1SWJ A;  2GTF X;  4GZV A;  4MIR A;  1ADL A;  4U8U O;  4YKM A;  5D45 A;  4A8Z A;  4OEL A;  4BX5 B;  1L6M A;  3UEW A;  4O3Y A;  2AKQ A;  1GKA A;  2RD7 C;  4WFU A;  4YMY A;  1ZNK A;  5AQ6 A;  1YP7 A;  4YFR A;  3D97 A;  2MO5 A;  3SLO A;  1FE3 A;  1VWO B;  1LID A;  2RQ0 A;  3KVN A;  1RSU B;  5BYP A;  4Z2V A;  3ZW1 B;  4O3W A;  4QYN A;  3BRN A;  3FR4 A;  3KFH A;  1ZNE A;  2IZC B;  3D96 A;  5AJC A;  5H9K A;  2RA6 A;  5D47 A;  5DG4 A;  3ZW0 B;  2KTS A;  2FKG A;  3K3L A;  1QY2 A;  3CBS A;  1IKJ A;  2BC3 A;  2AF5 A;  4GGT A;  5L8N A;  2IZH B;  2QO4 A;  1DF3 A;  3UEV A;  2LFO A;  3P6E A;  2OYB O;  3FR2 A;  1GKA B;  4O4U A;  3KFG A;  2W2F A;  4ALO A;  2RTH B;  1HBP A;  1AB0 A;  4GRJ A;  2L9C A;  1STR B;  4EXZ A;  5JD2 A;  1PBY A;  2AMM X;  2WQ9 A;  2DM5 A;  3CQR A;  1LIE A;  1SY0 A;  2A3F X;  2WEW A;  3O19 A;  4NV7 A;  3ZI8 A;  4OMX A;  1TVQ A;  2OVA A;  3SZJ A;  4ON1 A;  1SWB A;  5F2B A;  4DNE A;  5JR8 A;  2FHL A;  3SLJ A;  1VWB B;  2LKK A;  1ALB A;  3VG6 A;  2FTB A;  4LZU A;  2GC9 A;  1LIB A;  1DV9 A;  1NDJ A;  4IAB A;  4IAW A;  3WBG A;  4ZGF A;  1SRG A;  1GT5 A;  3FLL A;  3RDU A;  2OVS A;  2WR6 A;  4QYP A;  1PMP A;  2BSZ A;  5B27 A;  1SXW A;  4TKJ A;  1JMX A;  2AVI A;  4XMH A;  4GD9 A;  1JQP A;  1SWF A;  4ZHG A;  1YWA A;  4WFV A;  4XME A;  4HFO A;  5CSE A;  4ZGU A;  1JJX A;  1BLR A;  3O22 A;  5LJE A;  3PDF A;  4NYR A;  4IBA A;  1FTP A;  4GH7 A;  5HZQ A;  2WSJ A;  1PTS A;  5IRA A;  3STM X;  3TZS A;  1S7D A;  4NNS A;  1BSO A;  2IZD B;  3VE2 A;  4AZQ A;  3EM0 A;  2Q9S A;  3F6Z B;  2ACP X;  1SRF A;  5B11 O;  2GTL O;  3VE1 A;  1X89 A;  4FBR A;  3RWX A;  2X56 A;  2BT9 A;  2R74 A;  1SWK A;  4YGG A;  5HA0 A;  1FEN A;  3HWG A;  1DC9 A;  1SRE A;  4YGH A;  2OF8 A;  1JBH A;  4EFG A;  4ES7 A;  2IZE B;  1LEL A;  3PED A;  1XKI A;  3JQO A;  5L8O A;  3P6G A;  3RBY A;  1E5P A;  2PY1 A;  3TF6 A;  4CDF A;  1VWG B;  3BX8 A;  3FW5 A;  1KT3 A;  3EW1 A;  4GGR A;  1MK5 A;  1SWD A;  1FEL A;  1P6P A;  4A60 A;  5LJK A;  4QGX A;  1RXK A;  2FS7 A;  4ZH9 A;  5C0N A;  2BLG A;  1CJ5 A;  2JN3 A;  4CV7 A;  1AQB A;  1AEL A;  3H3I A;  5EZ2 A;  4BQU A;  4UU3 A;  2BHV A;  1KT4 A;  4TKH A;  2I5Z O;  3GAQ A;  1T68 X;  2KTD A;  1TW4 A;  1HXZ A;  3MBT A;  1BRQ A;  3WYP A;  3HPE A;  4OS3 A;  4YVB A;  1VWL B;  2F09 A;  4L1N A;  2AT5 X;  4YH0 A;  4Y5D A;  3ZUO A;  4YKO A;  1BM5 A;  3CR6 A;  2CZU A;  4BCS A;  4IB8 A;  3ZW2 A;  1QY0 A;  1VYO A;  2ZAI A;  1BSY A;  4NLJ A;  5LJG A;  4DCB A;  2AT0 X;  3L4R A;  4YFP A;  2QO5 A;  2L5P A;  2X55 A;  5HA1 A;  5HTE A;  3VG2 A;  1X71 A;  3Q34 A;  1IFC A;  5B29 A;  1SWP A;  3P6C A;  3PP6 A;  1MX8 A;  3MVF A;  1X8N A;  2W2A A;  4BX6 B;  2DJF A;  3U9P C;  1HY2 A;  4AZO A;  4BBO A;  1DZP A;  2ZSC A;  2C1S A;  4IAX A;  4U3Q A;  5K06 A;  1U17 A;  4OMW A;  1ICN A;  2NND A;  4GNY A;  4AZM A;  3BX7 A;  3AEH A;  4IMO A;  2NNE A;  1TOU A;  4R0B A;  4AZR A;  2RTB B;  1DZM A;  4Z6J A;  3BLG A;  3QQ2 A;  1KQW A;  4YDA A;  1NGL A;  3LV4 A;  5B3M O;  2X45 A;  4HPA A;  4GUZ A;  1SWL A;  1Y53 X;  1SRI A;  1VWJ B;  2AL0 X;  2FS6 A;  2VFC A;  3FIQ A;  3PQU A;  4AYH A;  2MWH A;  1KXO A;  2KT4 B;  1LCZ A;  2L68 A;  2QCB A;  2Y32 A;  1UYO X;  3APV A;  4O49 A;  5EPQ A;  1AVE A;  1DZK A;  4GE1 A;  2OVD A;  2QOS C;  3CMP A;  3I0A A;  3EBK A;  3RY1 A;  3RY2 A;  3WYQ A;  4ZHH A;  1JIW I;  2OVE A;  1S44 A;  5LJD A;  4QGV A;  2IZG B;  1YIV A;  3WJC A;  2FWV A;  2MF6 A;  4XMD A;  1OEJ A;  1SWC A;  3NQK A;  4INN A;  1G7N A;  2QOM A;  1SWG A;  5LKE A;  1JYJ A;  1OPA A;  1IKE A;  2G79 A;  4OS8 A;  3APX A;  4Y0R A;  2Z4H A;  2WPU A;  1VWQ B;  3NX1 A;  2RTQ B;  1VWH B;  3LTW A;  1MVG A;  4JGL A;  4GGZ A;  5IRU A;  1GT1 A;  1G74 A;  4IMN A;  2RTJ A;  2YG2 A;  3NPO A;  2CM4 A;  4CSB A;  3T1D A;  3BY0 A;  4K19 A;  3D4R A;  4NLI A;  2RTC B;  4AW8 A;  4GK9 A;  4YDB A;  1PM1 X;  4OEM A;  4MEE A;  1SWQ A;  2X8F A;  4LQZ A;  1GX8 A;  2RN4 A;  2LBV A;  3S26 A;  1K24 A;  4ARH A;  5F6B A;  1A57 A;  3TGB A;  2OL6 O;  1KFF A;  1JYD A;  1QQS A;  3DTQ A;  2ZAG A;  1OPB A;  1KT7 A;  2NP1 A;  3C76 X;  3VG4 A;  1RBP A;  2RTA A;  2FR2 A;  4Y0Q A;  3RZY A;  2Q4N A;  1VWC B;  3WJG A;  2X32 A;  3FYF A;  3NQ3 A;  1UZ2 X;  2FT9 A;  2OF9 A;  2CAM A;  4U8U M;  3VHI A;  1BWY A;  5EDC A;  4BVM A;  1QFT A;  5HZ9 A;  3OE3 A;  1Y52 X;  1LF7 A;  1RAV A;  1ZNG A;  2FR3 A;  1LDO A;  1WBI A;  2IZF B;  1O1U A;  2MHD A;  2POA A;  5EDB A;  4A1H A;  2JU3 A;  1KZW A;  3AKM A;  1KL3 A;  4I6S A;  1BSQ A;  1CBS A;  3RKG A;  1QWD A;  3FA8 A;  4O3X B;  3T2X A;  1HN2 A;  1T8V A;  3T6L A;  1Z24 A;  1EAL A;  2W2B A;  4ORX A;  3FA6 A;  3O2Y A;  1SXX A;  1IW2 A;  4KC7 A;  5FQ6 E;  1EQD A;  5H9A A;  3RDS A;  1LUQ A;  3STN A;  3APU A;  4CDC A;  4CPH A;  1SY1 A;  2NNQ A;  1LCV A;  2Z4I A;  2GJ5 A;  4GET A;  5HCC C;  1JZU A;  5BVT A;  4NP1 A;  1JJU A;  1KQX A;  4GNW A;  3RDQ A;  3D9W A;  3FMZ A;  3ZWE A;  4EDE A;  1I04 A;  5KHP A;  3GE2 A;  2OL8 O;  1UYN X;  2IFB A;  1KT5 A;  2HYS A;  2IZK A;  4ZR2 A;  5HZ6 A;  5EEE A;  3TGC A;  4TKB A;  1ML7 A;  1SXY A;  2C1Q A;  3CWK A;  3WJE A;  2RTL A;  4CDD A;  3FEN A;  4PSQ A;  4LZV A;  2X4M A;  3VHH A;  5IRW A;  2A13 A;  1JMZ A;  2OY5 O;  3RSW A;  4DQ4 A;  3HTY A;  2AH7 X;  1EXS A;  2RCT A;  3UAQ A;  1STS B;  5FEN A;  1B4M A;  3MG5 A;  1LCW A;  3WJD A;  1SA8 A;  2UYW A;  5F58 A;  5HZ8 A;  4Y0S A;  5H9N A;  3P6F A;  2IZA A;  2C4I A;  2WUT A;  4CK4 A;  1QFV A;  5KIC A;  3B2H A;  1B56 A;  2VFB A;  4GDZ A;  1Y9L A;  4U8U N;  1I05 A;  4HWM A;  2P8G A;  2MJI A;  5L8I A;  4TLJ A;  5H8T A;  3OJY C;  4I3C A;  4D6B A;  1YUP A;  4MVI A;  4TQ2 A;  1E2T A;  5CYB A;  4JNJ A;  3N91 A;  1EIO A;  2WEX A;  4CDE A;  2OZQ A;  4O4X A;  1HXL A;  1NC9 A;  1B0O A;  2QMI A;  3BS2 A;  2A5C A;  3FEK A;  3KZA A;  2ASN X;  4IB9 A;  4KT5 A;  2HLV A;  4COT A;  1NP4 A;  5F1E A;  4LKT A;  2KW1 A;  1O1V A;  5LJB A;  1SWU A;  5HTD A;  1WUB A;  2R73 A;  3PQS A;  4KH8 A;  5F6Z A;  5CE4 A;  1EI5 A;  2AT8 X;  3PH6 A;  4YGZ A;  4ORW A;  4M6S A;  2FLJ A;  1LIC A;  4GJV A;  3LHN A;  3ELX A;  3WZO A;  4Z28 A;  1GM6 A;  1N9M A;  3KQ0 A;  4D6A A;  4ODD A;  2RTN B;  2BS6 A;  1YWC A;  2I5V O;  5HCD C;  1EUO A;  1ZNH A;  4I95 A;  2OFM X;  1E00 A;  4O3Z A;  4OS0 A;  3ELZ A;  3NBX X;  4CPE A;  2RTD B;  4EQA C;  5KID A;  5FAZ A;  4ZHD A;  2G5L A;  3NQ9 A;  1Y9T A;  3NR3 A;  4ZHF A;  1SWR A;  4I9R A;  3FR5 A;  5H9L A;  5B2A O;  4Z2P A;  1W4T A;  4YFQ A;  3FW4 A;  1HBQ A;  1MX7 A;  4I60 A;  4Z2O A;  1RLB E;  1U18 A;  3F8A A;  1VWF B;  5FFH A;  5IO7 A;  3EW2 A;  5DPQ A;  1LNM A;  4EEJ A;  4RUU A;  1DZJ A;  2HZR A;  3SZH A;  1SLD B;  4DQ3 A;  2M4L A;  1MEP A;  1N0S A;  1A3Y A;  1SY2 A;  1VWD B;  2Y3F A;  5K68 A;  3SOT A;  3TGA A;  3B2L A;  4QQ1 A;  5LJC A;  1GT3 A;  5D48 A;  1OEE A;  2K23 A;  2IZL B;  3VGW A;  4MVE A;  4GKC A;  2G8C O;  2PI3 O;  4HPB A;  1O8V A;  1MM9 A;  5HAE A;  2Q2M A;  1QY1 A;  3FDC A;  1D3S A;  3HWD A;  4LKP A;  4ZCB A;  1T0V A;  4EKV A;  2A0A A;  4TNN A;  4BX5 A;  2RTO B;  3KFI A;  5IO5 A;  3BU9 A;  1SRJ A;  3PEC A;  3G7X A;  1D2U A;  3JS1 A;  4ML7 B;  2CM9 A;  3S60 A;  1OSP O;  2F01 A;  4PJ2 A;  4FBV A;  4IB6 A;  1HMT A;  1RXJ A;  1U0X A;  1N43 A;  2DJG A;  2QM9 A;  3HK1 A;  2GTL N;  4XMG A;  2IZI A;  3FID A;  3UEX A;  3B2J A;  3ZW1 A;  2JW1 A;  5LJH A;  1VYG A;  3HOL A;  4ID2 A;  2UZ2 A;  2EU7 X;  2XST A;  4B55 A;  3C77 X;  1VYF A;  3RDO A;  4QGW A;  1OBP A;  1EPB A;  1VWN B;  4KC8 A;  3VG7 A;  2FHN X;  3DSZ A;  4GU8 A;  5F7G A;  5BVQ A;  3I17 A;  4AZP A;  4N7D A;  1BEB A;  1H91 A;  1TXL A;  3APW A;  4FQB B;  2ALL X;  3AKN A;  4ORR A;  2X8S A;  4XMC A;  2IZJ A;  3WVM A;  3JSQ A;  4U46 A;  3EMM A;  3MX7 A;  1SLG B;  2FGS A;  4NW4 A;  1XCA A;  1Y55 X;  1A18 A;  3RE5 A;  1S2P A;  5BVS A;  4BOE A;  1GX3 A;  3P6D A;  2Y3E A;  2N93 A;  4HPD A;  2X34 A;  1KL4 A;  3P02 A;  4ORS A;  5FQ7 E;  3ZUI A;  1OEK A;  4C5P A;  4O4S A;  1TOW A;  4ZFX A;  3FEP A;  2L67 A;  5HZ5 A;  3WOV A;  1NQN A;  4GJS A;  1YWB A;  1ERB A;  2BS5 A;  5HBS A;  5FQ8 E;  4MIS A;  5IO6 A;  4MVL A;  1VWA B;  1GT4 A;  4N7C A;  4BJ8 A;  3NAD A;  3B2I A;  2AT3 X;  4JO6 A;  1LIF A;  3WZP A;  4I9S A;  1ZND A;  5EED A;  4WBK A;  3QKG A;  1BRP A;  1I9H A;  2RTP B;  5B10 O;  1SWN A;  2CZT A;  2HKD A;  1VWP B;  1SWO A;  3HOE A;  3PH5 A;  3S5V A;  3MM0 A;  1GXA A;  1OBQ A;  3RDX A;  1KGL A;  1SY3 A;  1VWM B;  1LFO A;  4L3R A;  2RTI B;  4HPC A; 
#chains in the Genus database with same CATH homology
 2QO6 A;  4KII A;  3P6H A;  1ZNL A;  1KT6 A;  1B8E A;  3IFB A;  1NP1 A;  1PBO A;  2OFR X;  3E3C A;  3F9D A;  5HWZ A;  4FBO A;  2E4J A;  3U0D A;  1FEM A;  2RCQ A;  2X8T A;  1ICM A;  1YWD A;  3FA7 A;  3BDR A;  5D4A A;  1ZRY A;  1DFV A;  1EPA A;  2AT6 X;  4ZJ0 A;  3CBC A;  3Q6L A;  4UU2 A;  1FDQ A;  2FRS A;  3BSZ E;  2A2G A;  1MUP A;  3CQN A;  3NX2 A;  1JV4 A;  3V8U A;  4YBP A;  2ANS A;  3ZQ3 A;  1HMR A;  3VG3 A;  2G7B A;  3SAO A;  1BJ7 A;  1URE A;  1AVG I;  2ACO A;  4QAE A;  4XMF A;  2O62 A;  4NYQ A;  3FEL A;  3C78 X;  4O4O A;  1ACD A;  4QZU A;  4YCE A;  4I3D A;  1G85 A;  1E02 A;  1SXU A;  2X46 A;  4QRL A;  3VG5 A;  1KZX A;  4QNI A;  1BBP A;  2F73 A;  4AZN A;  1IFB A;  1GX9 A;  1X8P A;  1HMS A;  3B2K A;  4NNT A;  2GTL M;  4IB7 A;  4ORY A;  1VPR A;  1EII A;  2JOZ A;  1CRB A;  3VU1 A;  4WHI A;  1QG5 A;  2HZQ A;  4TJZ A;  3OBL A;  2YMS A;  3BU1 A;  1PEE A;  2LBA A;  3UEU A;  2XKL A;  4Y0P A;  1CBR A;  2WQA E;  2JU8 A;  3PPT A;  1YP6 A;  1OBU A;  1IIU A;  1CBQ A;  1R0U A;  2WWP A;  1MDC A;  1E06 A;  2KD2 A;  2LB6 A;  5HCE C;  1X8O A;  4O9S A;  2HNX A;  2Q39 A;  1LPJ A;  4YCH A;  1GGL A;  1I4U A;  1X8Q A;  2G78 A;  3S5X A;  4FBR A;  1JJJ A;  4KCA A;  5LKF A;  2JMB A;  2CBR A;  1ERX A;  1I06 A;  2Q2P A;  3HWE A;  4YBU A;  1G5W A;  1X8U A;  3ZZV A;  2MM3 A;  1EW3 A;  5AJB A;  3NP1 A;  4ZH6 A;  4MVK A;  3WXQ A;  3STK A;  3P24 A;  5D8J A;  3WJF A;  1CBI A;  1KOI A;  2R56 A;  4ZHH A;  1HQP A;  4ZHC A;  1SMP I;  3U03 A;  3VPJ E;  5AEO A;  4FGI B;  3KFF A;  4ALB A;  3WJB A;  3IA8 A;  3OD9 A;  4ORU A;  4QZT A;  2HMB A;  4A1Y A;  3D95 A;  3HWF A;  2K62 A;  3EBW A;  4U9C A;  1LKE A;  1A2D A;  4M7M A;  3EYC A;  2CBS A;  2LA7 A;  1QAB E;  4RUN A;  3ZW0 A;  3FA9 A;  4I3B A;  2JU7 A;  2A2U A;  2GTF X;  4GZV A;  4MIR A;  1ADL A;  4U8U O;  4YKM A;  5D45 A;  4A8Z A;  1L6M A;  3UEW A;  4O3Y A;  2AKQ A;  1GKA A;  2RD7 C;  4WFU A;  4YMY A;  1ZNK A;  5AQ6 A;  1YP7 A;  4YFR A;  3D97 A;  2MO5 A;  1FE3 A;  1LID A;  2RQ0 A;  5BYP A;  3ZW1 B;  4O3W A;  4QYN A;  3BRN A;  3FR4 A;  3KFH A;  1ZNE A;  3D96 A;  5AJC A;  5H9K A;  3ZW0 B;  2RA6 A;  5D47 A;  5DG4 A;  2KTS A;  3K3L A;  1QY2 A;  3CBS A;  1IKJ A;  5L8N A;  2QO4 A;  1DF3 A;  3UEV A;  2LFO A;  3P6E A;  3FR2 A;  1GKA B;  4O4U A;  3KFG A;  2W2F A;  4ALO A;  1HBP A;  1AB0 A;  4GRJ A;  2L9C A;  4EXZ A;  2AMM X;  2WQ9 A;  2DM5 A;  3CQR A;  1LIE A;  1SY0 A;  2A3F X;  2WEW A;  3O19 A;  3ZI8 A;  4OMX A;  1TVQ A;  2OVA A;  4ON1 A;  5JR8 A;  2LKK A;  1ALB A;  3VG6 A;  2FTB A;  4LZU A;  2GC9 A;  1LIB A;  4IAB A;  4IAW A;  3WBG A;  4ZGF A;  1GT5 A;  3FLL A;  2OVS A;  2WR6 A;  4QYP A;  1PMP A;  5B27 A;  1SXW A;  4TKJ A;  4XMH A;  1YWA A;  4WFV A;  4XME A;  4HFO A;  1JJX A;  4ZGU A;  1BLR A;  3O22 A;  5LJE A;  4NYR A;  4IBA A;  1FTP A;  4GH7 A;  5HZQ A;  2WSJ A;  3STM X;  3TZS A;  1S7D A;  4NNS A;  1BSO A;  3VE2 A;  4AZQ A;  3EM0 A;  2Q9S A;  3F6Z B;  2ACP X;  3VE1 A;  2GTL O;  1X89 A;  3RWX A;  2BT9 A;  2R74 A;  4YGG A;  5HA0 A;  1FEN A;  3HWG A;  1DC9 A;  4YGH A;  1JBH A;  4EFG A;  4ES7 A;  3PED A;  1XKI A;  3JQO A;  5L8O A;  3P6G A;  1E5P A;  2PY1 A;  3TF6 A;  3BX8 A;  3FW5 A;  1KT3 A;  5LJK A;  1KZW A;  4A60 A;  1FEL A;  1P6P A;  4QGX A;  2FS7 A;  4ZH9 A;  5C0N A;  2BLG A;  1CJ5 A;  2JN3 A;  4CV7 A;  1AQB A;  1AEL A;  3H3I A;  5EZ2 A;  4BQU A;  4UU3 A;  2BHV A;  1KT4 A;  4TKH A;  3GAQ A;  1T68 X;  2KTD A;  1TW4 A;  3MBT A;  1BRQ A;  4OS3 A;  2F09 A;  4L1N A;  2AT5 X;  4YH0 A;  3ZUO A;  4YKO A;  1BM5 A;  3CR6 A;  2CZU A;  4IB8 A;  3ZW2 A;  1QY0 A;  2ZAI A;  1BSY A;  4NLJ A;  5LJG A;  2AT0 X;  3L4R A;  4YFP A;  2QO5 A;  2L5P A;  5HA1 A;  5HTE A;  3VG2 A;  1X71 A;  1IFC A;  5B29 A;  3P6C A;  3PP6 A;  1MX8 A;  3MVF A;  1X8N A;  2W2A A;  3U9P C;  4AZO A;  1DZP A;  4IAX A;  4U3Q A;  5K06 A;  1U17 A;  4OMW A;  1ICN A;  2NND A;  4GNY A;  4AZM A;  3BX7 A;  4IMO A;  2NNE A;  1TOU A;  4R0B A;  4AZR A;  1DZM A;  3BLG A;  1KQW A;  4YDA A;  1NGL A;  3LV4 A;  2X45 A;  4HPA A;  5HCD C;  2FS6 A;  4AYH A;  2AL0 X;  3FIQ A;  3PQU A;  2MWH A;  1KXO A;  2KT4 B;  2L68 A;  4O49 A;  5EPQ A;  3APV A;  1DZK A;  4GE1 A;  2OVD A;  2QOS C;  3CMP A;  3I0A A;  3EBK A;  1JIW I;  2OVE A;  1S44 A;  5LJD A;  4QGV A;  1YIV A;  3WJC A;  2FWV A;  4XMD A;  1OEJ A;  3NQK A;  4INN A;  1G7N A;  5LKE A;  1JYJ A;  1OPA A;  1IKE A;  2G79 A;  4OS8 A;  3APX A;  4Y0R A;  2Z4H A;  3NX1 A;  1MVG A;  4JGL A;  1GT1 A;  1G74 A;  4IMN A;  2YG2 A;  3NPO A;  2CM4 A;  4CSB A;  3T1D A;  3BY0 A;  4K19 A;  3D4R A;  4NLI A;  4AW8 A;  4GK9 A;  4YDB A;  1PM1 X;  2X8F A;  4LQZ A;  1GX8 A;  2RN4 A;  2LBV A;  3S26 A;  1A57 A;  4ARH A;  5F6B A;  3TGB A;  1JYD A;  1QQS A;  3DTQ A;  2ZAG A;  1OPB A;  1KT7 A;  2NP1 A;  3C76 X;  3VG4 A;  1RBP A;  2FR2 A;  4Y0Q A;  3RZY A;  2Q4N A;  3WJG A;  3FYF A;  3NQ3 A;  1UZ2 X;  2FT9 A;  4U8U M;  1BWY A;  5EDC A;  4BVM A;  1QFT A;  5HZ9 A;  3OE3 A;  1LF7 A;  1ZNG A;  2FR3 A;  5EDB A;  2MHD A;  1O1U A;  4A1H A;  2POA A;  2JU3 A;  3AKM A;  4I6S A;  1BSQ A;  1CBS A;  3RKG A;  1QWD A;  3FA8 A;  4O3X B;  1HN2 A;  1T8V A;  1Z24 A;  1EAL A;  2W2B A;  4ORX A;  3FA6 A;  3O2Y A;  1SXX A;  1IW2 A;  4KC7 A;  5FQ6 E;  1EQD A;  5H9A A;  3STN A;  3APU A;  1SY1 A;  2NNQ A;  4GET A;  2Z4I A;  2GJ5 A;  5HCC C;  1JZU A;  5BVT A;  4NP1 A;  1KQX A;  4GNW A;  3ZWE A;  3FMZ A;  4EDE A;  1I04 A;  5KHP A;  3GE2 A;  2IFB A;  1KT5 A;  2HYS A;  4ZR2 A;  5HZ6 A;  5EEE A;  3TGC A;  4TKB A;  1ML7 A;  1SXY A;  3CWK A;  3FEN A;  4PSQ A;  4LZV A;  2A13 A;  3RSW A;  4DQ4 A;  3HTY A;  2AH7 X;  1EXS A;  2RCT A;  3UAQ A;  5FEN A;  1B4M A;  3WJD A;  1SA8 A;  5HZ8 A;  5F58 A;  4Y0S A;  5H9N A;  3P6F A;  2WUT A;  4CK4 A;  1QFV A;  5KIC A;  3B2H A;  1B56 A;  4GDZ A;  1Y9L A;  4U8U N;  1I05 A;  4HWM A;  2P8G A;  2MJI A;  5L8I A;  4TLJ A;  5H8T A;  3OJY C;  4I3C A;  4D6B A;  1YUP A;  4MVI A;  4TQ2 A;  5CYB A;  3N91 A;  1EIO A;  2WEX A;  2OZQ A;  4O4X A;  2QMI A;  1B0O A;  3BS2 A;  3FEK A;  3KZA A;  4IB9 A;  4KT5 A;  2ASN X;  3RBY A;  4COT A;  2HLV A;  1NP4 A;  5F1E A;  4LKT A;  2KW1 A;  1O1V A;  5LJB A;  5HTD A;  3PQS A;  2R73 A;  4KH8 A;  5F6Z A;  5CE4 A;  1EI5 A;  2AT8 X;  3PH6 A;  4YGZ A;  4ORW A;  4M6S A;  2FLJ A;  1LIC A;  3LHN A;  3ELX A;  1GM6 A;  3KQ0 A;  4D6A A;  4ODD A;  2BS6 A;  1YWC A;  1EUO A;  1ZNH A;  4I95 A;  2OFM X;  1E00 A;  4O3Z A;  4OS0 A;  3ELZ A;  3NBX X;  4EQA C;  5KID A;  5FAZ A;  4ZHD A;  3NQ9 A;  1Y9T A;  3NR3 A;  4ZHF A;  4I9R A;  3FR5 A;  5H9L A;  4YFQ A;  3FW4 A;  1HBQ A;  1MX7 A;  1RLB E;  1U18 A;  3F8A A;  5FFH A;  5IO7 A;  5DPQ A;  4EEJ A;  1LNM A;  4RUU A;  1DZJ A;  2HZR A;  4DQ3 A;  2M4L A;  3TGA A;  1N0S A;  1A3Y A;  1SY2 A;  1KGL A;  3SOT A;  3B2L A;  4QQ1 A;  5LJC A;  1GT3 A;  5D48 A;  1OEE A;  2K23 A;  4MVE A;  4GKC A;  4HPB A;  1O8V A;  5HAE A;  2Q2M A;  1QY1 A;  1D3S A;  3HWD A;  4LKP A;  4ZCB A;  1T0V A;  2A0A A;  4TNN A;  5IO5 A;  3KFI A;  3BU9 A;  3PEC A;  3G7X A;  1D2U A;  3JS1 A;  4ML7 B;  2CM9 A;  3S60 A;  4PJ2 A;  4FBV A;  4IB6 A;  1HMT A;  1U0X A;  2QM9 A;  4XMG A;  3UEX A;  1DV9 A;  3HK1 A;  2GTL N;  3B2J A;  3ZW1 A;  2JW1 A;  5LJH A;  1VYG A;  3HOL A;  4ID2 A;  2XST A;  2EU7 X;  3C77 X;  1VYF A;  4QGW A;  1OBP A;  1EPB A;  4KC8 A;  3VG7 A;  3DSZ A;  4GU8 A;  5F7G A;  5BVQ A;  4AZP A;  3I17 A;  4N7D A;  1BEB A;  1H91 A;  1TXL A;  3APW A;  4FQB B;  2ALL X;  3AKN A;  4ORR A;  2X8S A;  4XMC A;  3WVM A;  3JSQ A;  3EMM A;  3MX7 A;  4NW4 A;  1XCA A;  1A18 A;  1S2P A;  5BVS A;  4BOE A;  3P6D A;  2N93 A;  4HPD A;  3P02 A;  4ORS A;  5FQ7 E;  3ZUI A;  1OEK A;  4O4S A;  1TOW A;  4ZFX A;  3FEP A;  2L67 A;  5HZ5 A;  3WOV A;  1YWB A;  1ERB A;  2BS5 A;  5HBS A;  5FQ8 E;  4MIS A;  5IO6 A;  4MVL A;  1GT4 A;  4N7C A;  3NAD A;  3B2I A;  2AT3 X;  1LIF A;  4I9S A;  1ZND A;  5EED A;  4WBK A;  3QKG A;  1BRP A;  3WJE A;  4ZHG A;  3HOE A;  2CZT A;  3PH5 A;  3S5V A;  1GXA A;  1OBQ A;  1SY3 A;  1LFO A;  4L3R A;  4HPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...