2OVEA

Crystal structure of recombinant human complement protein c8gamma
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
170
structure length
162
Chain Sequence
SPISTIQPKANFDAQQFAGTWLLVAVGSAARAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein,ligand binding protein
molecule keywords Complement component 8, gamma polypeptide
publication title Structural features of the ligand binding site on human complement protein C8gamma: A member of the lipocalin family
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 162
sequence length 170
ec nomenclature
pdb deposition date 2007-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2oveA00
4GRJA 1G85A 1JYDA 1YWCA 3HK1A 4YCEA 5LKEA 1NP1A 2JN3A 2RCTA 2W2BA 2AH7X 3WJGA 4ZHHA 2HLVA 3AKMA 4QYNA 1VYGA 3PEDA 4ORSA 5F1EA 3VG4A 1AQBA 1GT5A 2L68A 1I06A 1GT4A 5CE4A 4NYRA 1L6MA 4NLJA 3JS1A 1T0VA 5HZ8A 1X89A 4ALOA 3PH6A 4AZNA 3WJBA 3APVA 4XMEA 2QO5A 1G7NA 4ODDA 1RLBE 1LIBA 2NNDA 4LKTA 1ALBA 1B4MA 1B56A 1I4UA 4QZTA 2FLJA 1A18A 1JV4A 4D6BA 5B29A 2AT5X 5B27A 4AYHA 3P6HA 3HWFA 3APUA 1QABE 5IO5A 4ORXA 3WJDA 2CBRA 1YWAA 4XMCA 1LF7A 3ZQ3A 1GKAA 5HCEC 2NNQA 3WJCA 5H9KA 4EFGA 1E00A 5HZ6A 5EPQA 1QY0A 1TXLA 1DF3A 3APWA 3ELZA 1HN2A 1E02A 3B2KA 5LJCA 2RQ0A 1VYFA 2K23A 4TKBA 1OEEA 1AB0A 1IKEA 4QAEA 1BEBA 4IAXA 1KT3A 1X8QA 4ORWA 2XSTA 1UREA 2GTFX 2ALLX 3VG6A 5LJGA 3GAQA 1JBHA 1GX9A 1SY0A 2FS6A 3BX7A 4A60A 1H91A 3ZUIA 5H9AA 1QQSA 1BSQA 5DPQA 3P6EA 5KHPA 1KXOA 3NX2A 1OBPA 4YBPA 4ZGUA 1MDCA 4TJZA 3KFFA 1SXWA 2QO6A 4I3BA 4YKMA 4AZPA 2AT6X 1KGLA 4NLIA 1JZUA 1T8VA 4Y0SA 1KT7A 4GE1A 4XMDA 4RUUA 1SXYA 4AZOA 4NP1A 3KZAA 2R73A 1GT3A 5F7GA 1U17A 1LIFA 2KTDA 1HBQA 1ERXA 4K19A 1ZNDA 3D95A 4ZHGA 4PSQA 1AELA 1BSOA 1SXUA 3APXA 4A1YA 1IKJA 2NNEA 4IB9A 1HQPA 1LIDA 3NX1A 5C0NA 4A1HA 2CZTA 4GNWA 3EBWA 1Z24A 1BRPA 1YP6A 1FEMA 1BRQA 4IAWA 4RUNA 2RD7C 3BLGA 1JJJA 4IB7A 1N0SA 3IA8A 1G5WA 1I04A 2ACOA 5HTDA 1S7DA 1QY2A 4GH7A 4I9SA 4CK4A 3PH5A 3CR6A 4XMHA 1RBPA 4D6AA 3PECA 1U18A 5HCCC 2LBVA 4YH0A 3F9DA 2HMBA 3FMZA 1X8PA 4YBUA 3WXQA 1P6PA 4A8ZA 4ZH6A 1BBPA 2KT4B 2P8GA 3FELA 1LNMA 3TZSA 1HMTA 2GC9A 5LJDA 3EYCA 4M7MA 1D2UA 3BX8A 3MVFA 5H9NA 2AT8X 4YDBA 2AT0X 3EBKA 4O9SA 2JU3A 1EW3A 5F6ZA 1TW4A 2NP1A 3BS2A 2A0AA 1KT5A 4ALBA 1ZNLA 4EXZA 1KT4A 3FA6A 2HZQA 3WBGA 5L8NA 2G7BA 4OMWA 1OBUA 2OFMX 4IB8A 2CM4A 3NQ9A 1PMPA 5JR8A 1ZRYA 3TF6A 2QM9A 5EEDA 2WSJA 3PPTA 4YFRA 2OFRX 1DFVA 1KQXA 1BLRA 5HA1A 1TOUA 4ZJ0A 2F73A 4HPBA 3KQ0A 3TGAA 1EQDA 5D8JA 1DV9A 1ZNGA 3DTQA 2LBAA 1YWDA 3FEKA 3VG2A 1GGLA 2Q2MA 3K3LA 3UEWA 3HWEA 5HBSA 1I05A 2XKLA 2WUTA 3KFHA 2FTBA 3RZYA 3BDRA 5LJKA 4ZHCA 3B2HA 4ZCBA 2E4JA 3I17A 4IB6A 4EEJA 3P6FA 4KIIA 3B2JA 1B8EA 3P6DA 2DM5A 4HPAA 5EEEA 1DZMA 2MO5A 3NPOA 2EU7X 2FR3A 1S44A 5D45A 4ARHA 2GJ5A 1DZJA 5LKFA 1QFTA 4BVMA 4YMYA 1X8UA 3FR5A 3HWDA 2LKKA 2RCQA 1CBRA 2FRSA 2HNXA 2R56A 1NP4A 2L67A 3UEUA 5LJBA 4ES7A 3BY0A 2HZRA 4LZUA 4QGXA 5BVSA 1NGLA 3HWGA 3BU1A 4QGVA 1GXAA 4AW8A 4Y0PA 3C76X 1TOWA 2X45A 2FR2A 1X8OA 2JU7A 4ZHFA 2AT3X 1E06A 1SY2A 2G78A 1O8VA 3AKNA 4IBAA 5F6BA 4ORRA 4MVIA 5HTEA 5KICA 2G79A 3I0AA 3FA9A 4WBKA 3VG7A 1S2PA 3B2IA 2AMMX 3FR2A 5FENA 4MVKA 3PP6A 1LKEA 3KFIA 4WFUA 3WJEA 2ACPX 3FR4A 2CZUA 2A13A 1CRBA 1CBIA 1XCAA 2YG2A 5L8OA 4HPDA 5FFHA 1JJXA 1KOIA 3S26A 5HZ9A 4N7CA 4MVLA 1ACDA 3DSZA 1SXXA 1FELA 1YP7A 1DZPA 4N7DA 1ERBA 3T1DA 1X8NA 2OZQA 2A2GA 4QZUA 2OVAA 5HWZA 5IO6A 1GM6A 3U9PC 1U0XA 5D4AA 1UZ2X 5LJEA 2QO4A 4DQ4A 3FEPA 1OEKA 1VPRA 3FA8A 4LKPA 4ORYA 2LB6A 1IIUA 2O62A 1JYJA 4BQUA 2WEXA 4I3DA 3NP1A 4GKCA 1IW2A 2A3FX 1G74A 1PBOA 5BVTA 1FE3A 2CM9A 2JOZA 1DZKA 1HBPA 1MUPA 1CJ5A 4TKJA 3KFGA 3SAOA 4HPCA 1EPBA 4R0BA 3FW5A 2FS7A 3F8AA 3BRNA 2OVDA 4UU2A 1FDQA 4YFQA 3CBSA 4IMNA 1LICA 2ASNX 2L9CA 3UEVA 1YWBA 1R0UA 1GX8A 3NADA 4BOEA 4TKHA 3L4RA 3O19A 2X46A 1D3SA 3NQ3A 1QG5A 4NYQA 5K06A 1EXSA 2MJIA 1GKAB 4LZVA 5DG4A 4GETA 4ZHDA 4OS3A 5HA0A 5D47A 2MM3A 1A3YA 3RSWA 3O22A 4NNTA 4I9RA 3FLLA 2HYSA 3QKGA 4GNYA 3STMX 3C78X 1HMSA 1LFOA 2A2UA 3CQRA 3BU9A 2Q39A 2WEWA 5KIDA 4OS8A 4WFVA 5AQ6A 1KZXA 1IFBA 2W2FA 3BSZE 2L5PA 5H9LA 3VG3A 5HCDC 2FT9A 2R74A 1TVQA 2JU8A 5HAEA 2CBSA 4ZR2A 1OPBA 3B2LA 2WR6A 1MVGA 4YKOA 1ICNA 3FW4A 3CBCA 1OBQA 5LJHA 1LPJA 1MX7A 1ZNKA 2AL0X 1GT1A 2ANSA 4UU3A 4OMXA 1FENA 3U0DA 1B0OA 2OVEA 2W2AA 3JSQA 4XMGA 1PEEA 1MX8A 2PY1A 1A57A 1KT6A 2Q9SA 2IFBA 1EALA 1CBSA 4IMOA 1EIIA 1BM5A 4ZH9A 3EMMA 4NNSA 4I3CA 3TGCA 4YGHA 4TNNA 3U03A 4XMFA 4YFPA 1OPAA 5EDCA 3FENA 1BWYA 4YGGA 4EDEA 3FA7A 2POAA 2WQ9A 2Q4NA 1QFVA 3C77X 3NR3A 2LFOA 1ADLA 4Y0QA 3G7XA 4M6SA 4DQ3A 1ICMA 4QGWA 3VG5A 2RA6A 4Y0RA 1ML7A 1QY1A 3D96A 3ZUOA 2BLGA 2K62A 2WWPA 4AZMA 2WQAE 1PM1X 1ZNHA 4QYPA 1SY1A 1CBQA 4TLJA 5HZQA 1KQWA 1KZWA 1E5PA 2QOSC 4HFOA 4YGZA 5IO7A 1EIOA 3IFBA 5L8IA 1LIEA 3STKA 1OEJA 3WJFA 1BJ7A 3UEXA 1X71A 4ZFXA 1BSYA 3CQNA 1FTPA 1T68X 3D97A 3P6CA 1YIVA 4AZRA 1SA8A 3STNA 1ZNEA 3ELXA 1IFCA 3EM0A 2Q2PA 5FAZA 3WVMA 2FWVA 4ORUA 4YCHA 1DC9A 3O2YA 3TGBA 4TQ2A 3P6GA 1AVGI 5H8TA 1EUOA 1HMRA 1XKIA 5D48A 2AKQA 5HZ5A 3OJYC 1A2DA 1O1UA 3Q6LA 5EZ2A 5F58A 4AZQA 1SY3A 2N93A 4OS0A 5EDBA 5BVQA 3MBTA 3FIQA 3CMPA 1YUPA 1QWDA 1EPAA 3CWKA 1O1VA 4YDAA
chains in the Genus database with same CATH superfamily
4GRJA 1G85A 1JYDA 1RAVA 1SWNA 1Y55X 1YWCA 3HK1A 4YCEA 1LUQA 1NP1A 2JN3A 4O3YA 3RDSA 5LKEA 2RCTA 2W2BA 2AH7X 1UYNX 2RTMA 3WJGA 4ZHHA 2HLVA 3AKMA 1WBIA 1VYGA 4QYNA 5JD2A 2IZDB 4BX7A 3PEDA 4ORSA 2IZGB 5F1EA 3VG4A 1AQBA 1GT5A 2L68A 1IJ8A 1GT4A 1I06A 5CE4A 4NYRA 3ZW0A 1L6MA 4NLJA 2GTLO 3JS1A 3LHNA 1T0VA 3SOTA 3WYPA 5HZ8A 2RTOB 1X89A 4ALOA 3PH6A 4AZNA 3WJBA 3APVA 4XMEA 2IZBA 2QO5A 1G7NA 4ODDA 1RLBE 2FHNX 4O3XB 4OEMA 2RTFB 1LIBA 4DCBA 2NNDA 4LKTA 4DNEA 4QQ1A 1ALBA 4O3WA 1B56A 1I4UA 2CAMA 1B4MA 4QZTA 2FLJA 1A18A 1JV4A 5B3MO 4D6BA 2AT5X 5B29A 5B27A 1STRB 4AYHA 2BS6A 3HWFA 3P6HA 1JMXA 1Y9TA 3RDMA 3APUA 1QABE 4CPFA 5IO5A 4ORXA 3WJDA 1SLFB 1YWAA 1LDQA 2CBRA 4XMCA 1LF7A 2RTCB 3ZQ3A 1WUBA 1GKAA 5HCEC 2NNQA 3WJCA 2F09A 5H9KA 4NV8A 1E00A 4EFGA 5HZ6A 4O3ZA 5EPQA 3CWKA 1QY0A 2BHVA 2A5CA 1TXLA 1DF3A 3APWA 3ELZA 1HN2A 1E02A 2OF9A 2X56A 2OYBO 1SWLA 2Y3EA 3B2KA 5LJCA 2RQ0A 1VYFA 3P24A 2K23A 4TKBA 1MK5A 1OEEA 2GTLN 1AB0A 1IKEA 1VWCB 4QAEA 1BEBA 4IAXA 2VFBA 1KT3A 1X8QA 3KVNA 5B2AO 4O4UA 4ORWA 2XSTA 3VU1A 1UREA 2GTFX 1SWGA 1SREA 2ALLX 3VG6A 3HOEA 4INNA 2WPUA 5LJGA 3GAQA 1JBHA 2IZEB 1GX9A 2G5LA 4GU8A 1SY0A 1VWEB 2FS6A 3BX7A 2RTDB 4JGLA 2IZCB 4MIRA 4A60A 4BJ8A 1VWOB 1VWIB 1H91A 3VE2A 3ZUIA 2AF5A 5H9AA 1HXLA 1QQSA 2ZAIA 1BSQA 1HQQA 3QQ2A 4CDFA 2BC3A 4BX6A 5DPQA 2MHDA 3P6EA 2JW1A 4FBVA 4GJSA 5KHPA 1KXOA 3NX2A 2X55A 1RSTB 3PK2A 1OBPA 4YBPA 4ZGUA 1MDCA 4CPHA 1SRHA 4TJZA 3X00A 1SWDA 3KFFA 1SXWA 2QO6A 4I3BA 1N43A 4U46A 4YKMA 4AZPA 2AT6X 1KGLA 1MOYA 4NLIA 1JZUA 1SWTA 1JMZA 1T8VA 1JQPA 4Y0SA 1KT7A 2RN4A 4GE1A 4XMDA 4RUUA 1SXYA 4GDZA 4AZOA 4NP1A 3KZAA 2R73A 3S5XA 1GT3A 5F7GA 1U17A 1LIFA 2JGSA 1HBQA 1ERXA 2KTDA 1RXJA 1ZNDA 4K19A 2OL6O 3D95A 4ZHGA 2BS5A 4PSQA 1AELA 2I5VO 3E3CA 1SWSA 1BSOA 1SXUA 4I6SA 3APXA 4A1YA 1IKJA 4ML7B 2NNEA 4IB9A 1HQPA 1LIDA 3NX1A 3RKGA 4A1HA 4AZMA 4CDCA 5C0NA 2CZTA 2ZSCA 3ZW1A 2X34A 3PQSA 4GNWA 4KCAA 2C1QA 1Z24A 1K3BA 3EBWA 5IRWA 1BRPA 1YP6A 1FEMA 1BRQA 2ZAGA 4IAWA 4RUNA 2RD7C 2DJGA 3BLGA 4NW4A 1JJJA 4IB7A 1N0SA 3IA8A 2OY5O 4C5PA 1I04A 2ACOA 4FQBB 5HTDA 1S7DA 1VWQB 1G5WA 3P02A 1QY2A 4GH7A 4I9SA 2Y32A 1SWQA 4CK4A 3PH5A 3CR6A 4XMHA 1RBPA 4D6AA 5K67A 3PECA 1U18A 3HOLA 2LBVA 3RE5A 4FBRA 1NQMA 4YH0A 4ZGFA 3F9DA 2HMBA 3FMZA 1X8PA 3FYFA 4YBUA 3WXQA 1P6PA 3VPJE 4A8ZA 4ZH6A 4Y5DA 1BBPA 2KT4B 1JJUA 2P8GA 1LNMA 3FELA 4JNJA 1HMTA 4U9CA 3ZI8A 4CDEA 2GC9A 3TZSA 5LJDA 3EYCA 4M7MA 1D2UA 5FQ6E 5BYPA 4BBOA 3BX8A 4JHQA 1SWUA 4GUZA 3MVFA 5H9NA 2AT8X 5IXGA 3AUMO 3T2WA 4YDBA 2AT0X 4BX5A 3FDCA 1RSUB 3EBKA 2JU3A 4O9SA 3VE1A 1EW3A 2OL8O 3EW2A 1AVEA 1N4JA 5F6ZA 3ZW0B 1TW4A 2NP1A 2F01A 2RTEB 2A0AA 2QMIA 2RTKA 3BS2A 1KT5A 4ALBA 1ZNLA 4EXZA 5FQ7E 3S60A 1KT4A 1LDOA 3FA6A 1SWFA 2HZQA 2MWHA 2KTSA 5IRAA 3WBGA 5L8NA 2G7BA 4OMWA 4O4OA 1OBUA 1DF8A 2I5ZO 2OFMX 4IB8A 4HWMA 2CM4A 3NQ9A 3WOVA 1PMPA 3S5VA 2RTHB 5JR8A 1VWRB 1KL4A 1ZRYA 3TF6A 2QM9A 5EEDA 2WSJA 3PPTA 4YFRA 2OFRX 1I9HA 1DFVA 1HY2A 3SZJA 1KQXA 3PDFA 5LJHA 4O49A 4Z2OA 1BLRA 3ZWEA 4KC7A 5HA1A 1TOUA 4ZJ0A 1VWGB 4PJ2A 2F73A 4HPBA 3KQ0A 3TGAA 3WZPA 1EQDA 5D8JA 1DV9A 1ZNGA 3DTQA 1MEPA 2LBAA 1YWDA 3FEKA 3VG2A 1VWDB 3FIDA 1GGLA 2G8CO 2Q2MA 3K3LA 3UEWA 3HWEA 3H3IA 5HBSA 1I05A 2XKLA 2WUTA 2RTAA 3HPEA 2FTBA 1SLGB 3KFHA 4QNIA 3RDUA 2BSZA 3BDRA 3RZYA 2VDFA 4GGTA 5LJKA 4KT5A 4ZHCA 3B2HA 4ZCBA 2E4JA 2IZLB 3I17A 4IB6A 4EEJA 1OSPO 4COTA 3P6FA 4KIIA 3B2JA 1SLEB 1B8EA 3P6DA 2DM5A 2Z4IA 4HPAA 4LQZA 5EEEA 1DZMA 3PQUA 1RXHA 2MO5A 3NPOA 3LV4A 1FJ1E 1VWFB 1SWBA 3GE2A 2EU7X 2FR3A 1S44A 5D45A 2OY7A 4ARHA 2GJ5A 1DZJA 5LKFA 1GX3A 1SRGA 1QFTA 5HCCC 5L3YA 4BVMA 3AEHA 4YMYA 1X8UA 3FR5A 3HWDA 2LKKA 1UYOX 2RCQA 1CBRA 2FRSA 2HNXA 2OY1O 2R56A 1NP4A 1STPA 2L67A 4ON1A 3RE6A 3UEUA 2C4IA 1SRJA 4CPIA 4Z2VA 4ES7A 5LJBA 3LTWA 3BY0A 3JQOA 2HZRA 4NV7A 4LZUA 4B55A 4QGXA 3RY1A 3T6LA 5IRUA 5BVSA 5K68A 5CHKA 1NGLA 3HWGA 4MISA 2IZAA 3BU1A 1W6FA 3OD9A 5CYBA 4QGVA 1GXAA 4CSBA 4AW8A 4Y0PA 3C76X 1TOWA 2X45A 2FR2A 3OE3A 1NC9A 1X8OA 3SZHA 1N9MA 3VHMA 2JU7A 1MM9A 4ZHFA 1VWJB 1SWRA 4GK9A 2AT3X 1E06A 1SY2A 2G78A 1O8VA 3AKNA 1NDJA 4IBAA 5F6BA 4ORRA 4ID2A 2BT9A 4MVIA 5B11O 5HTEA 2G79A 3I0AA 2RTQB 3FA9A 4WBKA 3VG7A 1S2PA 3B2IA 2AMMX 2M4LA 2LA7A 3FR2A 5CSEA 1KFFA 5FENA 4MVKA 3PP6A 1PEEA 4OELA 1LKEA 3KFIA 4WFUA 3WJEA 2ACPX 3FR4A 2CZUA 2A13A 1Y52X 1CRBA 1EI5A 1CBIA 1XCAA 2YG2A 5L8OA 2OFBA 4HPDA 3V8UA 5FFHA 1JJXA 2X8SA 1RXKA 4GGRA 1KOIA 3S26A 1LCZA 3NQKA 4N7CA 5HZ9A 3EC5A 4MVLA 1ACDA 3DSZA 5B5GA 1SXXA 1FELA 1VYOA 1DZPA 1YP7A 2OL7A 4N7DA 1ERBA 4BGFA 2X4MA 3T1DA 1X8NA 2OZQA 2A2GA 2UZ2A 4QZUA 2OVAA 1JIWI 5HWZA 5IO6A 1GM6A 4QRLA 3U9PC 1U0XA 5D4AA 1UZ2X 3ZW2A 5LJEA 2IZFB 2QO4A 2YMSA 2RTLA 3T2XA 2IZHB 4DQ4A 3FEPA 1OEKA 1SRFA 1VPRA 3FA8A 1KL3A 4LKPA 4BX5B 2DJFA 4ORYA 2LB6A 3ZZVA 1IIUA 2O62A 2X32A 4KC8A 4BX7B 4JO6A 2Y3FA 1JYJA 3SLJA 3UAQA 1VWKB 4GZVA 2WEXA 4I3DA 4BQUA 3NP1A 4GKCA 4U8UM 1IW2A 1VWAB 2A3FX 4CDDA 1G74A 1PBOA 4IRWA 2GH7A 4MVEA 1FE3A 2CM9A 2JOZA 1DZKA 2RTPB 2RTRB 5BVTA 3RWXA 1HBPA 1MUPA 1CJ5A 4TKJA 3KFGA 3SAOA 4HPCA 1EPBA 1SWOA 4R0BA 2IZIA 2GTLM 2FS7A 3FW5A 1SWKA 2FKJA 3F8AA 3F6ZB 3BRNA 2OVDA 4UU2A 2MF6A 1FDQA 1SWHA 4I60A 4YFQA 3CBSA 2UYWA 4IMNA 1LICA 2ASNX 1NQNA 2L9CA 4GJVA 4U8UO 3UEVA 1VWBB 1YWBA 1R0UA 1GX8A 3NADA 4BOEA 4TKHA 1I78A 3L4RA 3O19A 1VWPB 2X46A 1D3SA 3NQ3A 2IZKA 3MM0A 1QG5A 4NYQA 5K06A 4CV7A 4OKAA 1EXSA 2MJIA 1GKAB 4LZVA 4U3QA 5DG4A 4GETA 4ZHDA 4OS3A 5HA0A 5D47A 1K24A 2MM3A 1A3YA 2KW1A 3O22A 4NNTA 4Y59A 3RSWA 3SLOA 5KICA 4I9RA 3FLLA 2HYSA 3QKGA 4GD9A 4GNYA 3STMX 1LELA 1HMSA 1LFOA 3C78X 2A2UA 4EQAC 3CQRA 2A5BA 3BU9A 2Q39A 2WEWA 5KIDA 4OS8A 4WFVA 5AQ6A 5AJCA 4YVBA 1KZXA 1IFBA 2IZJA 4Z27A 2W2FA 3BSZE 2L5PA 5H9LA 3VG3A 5HCDC 1W5RA 2FT9A 1LCWA 1SLDB 2R74A 1TVQA 2JU8A 5HAEA 2CBSA 4ZR2A 1OPBA 3B2LA 2WR6A 1MVGA 4YKOA 3T6FA 1ICNA 1VWNB 3VHIA 3FW4A 3CBCA 1OBQA 2OY8A 3D9WA 4FGIB 1LPJA 1MX7A 1ZNKA 2AL0X 4GGZA 1LCVA 1GT1A 1SWCA 4U8UN 2ANSA 3WYQA 4UU3A 1N9YA 4OMXA 3WZOA 2PI3O 1PTSA 4BX6B 2FGSA 2QOMA 1FENA 2X8FA 3VHHA 3U0DA 1B0OA 2OVEA 2W2AA 3JSQA 1PBYA 4XMGA 1MX8A 2PY1A 1Y53X 2QCBA 2RTBB 1KT6A 2Q9SA 1A57A 4FBOA 2IFBA 1VWMB 4CPHB 1EALA 1CBSA 4IMOA 2X8TA 4KH8A 1EIIA 1BM5A 1VWHB 4ZH9A 1KL5A 3EMMA 3RDXA 1Y9LA 4NNSA 3HTYA 2C1SA 4I3CA 4MEEA 4YGHA 2RTJA 3TGCA 4TNNA 4Z28A 3U03A 4O4XA 4XMFA 4YFPA 4L3RA 1OPAA 5EDCA 3FENA 3WZNA 1BWYA 3Q34A 4YGGA 1SRIA 3SZIA 4EDEA 4Z6JA 3FA7A 1SWEA 1NBXA 2POAA 2WQ9A 2Q4NA 1SWPA 1QFVA 3C77X 3NR3A 3MX7A 1E2TA 2LFOA 4BCSA 1ADLA 4Y0QA 3G7XA 4M6SA 4O4SA 3ZW1B 4DQ3A 1ICMA 3N91A 4QGWA 4WHIA 3VG5A 2RA6A 4Y0RA 1ML7A 1SWAA 1QY1A 3D96A 3ZUOA 2BLGA 2K62A 1VWLB 2WWPA 2OF8A 1PM1X 2WQAE 1ZNHA 4QYPA 5F2BA 1SY1A 1CBQA 4TLJA 5HZQA 4EKVA 1KQWA 2OVSA 1KZWA 1E5PA 2QOSC 4HFOA 4YGZA 5IO7A 4GDAA 1EIOA 1Y0GA 3IFBA 2RTGB 1LIEA 2VFCA 5AJBA 5L8IA 3STKA 4Z2PA 3RDQA 2HKDA 5AEOA 1OEJA 2AVIA 3WJFA 3D4RA 3RDOA 1BJ7A 3UEXA 1X71A 5FQ8E 4ZFXA 1BSYA 3CQNA 5B10O 1FTPA 1T68X 3D97A 3P6CA 1YIVA 4AZRA 5B5FA 3OBLA 1SA8A 3EW1A 3STNA 1ZNEA 2RTIB 3ELXA 3WZQA 1IFCA 4IABA 3EM0A 2OFAA 2KD2A 2Q2PA 5FAZA 3SLTA 2FWVA 1STSB 3WVMA 4ORUA 4YCHA 1DC9A 3CKFA 3O2YA 4I95A 3TGBA 3VGWA 4TQ2A 3P6GA 1AVGI 4CPEA 2FKGA 5H8TA 1EUOA 3CKGA 1HMRA 4L1NA 1XKIA 1HXZA 5D48A 2Z4HA 2JMBA 1N7YA 2AKQA 2RTNB 1W4TA 5HZ5A 1SMPI 3OJYC 3RY2A 1A2DA 1AVDA 1O1UA 3Q6LA 5EZ2A 3NBXX 5F58A 4AZQA 1SY3A 2N93A 4OS0A 2FHLA 2A8GA 5EDBA 5BVQA 3MBTA 3RBYA 3FIQA 3CMPA 1YUPA 3MG5A 1QWDA 1EPAA 1SWJA 1O1VA 4YDAA
chains in the Genus database with same CATH topology
4GRJA 1G85A 1JYDA 1YWCA 3HK1A 4YCEA 5LKEA 1NP1A 2JN3A 4O3YA 2RCTA 2W2BA 2AH7X 3WJGA 4ZHHA 2HLVA 3AKMA 4QYNA 1VYGA 3PEDA 4ORSA 5F1EA 3VG4A 1AQBA 1GT5A 2L68A 1I06A 1GT4A 5CE4A 4NYRA 3ZW0A 1L6MA 4NLJA 2GTLO 3JS1A 3LHNA 1T0VA 3SOTA 5HZ8A 1X89A 4ALOA 3PH6A 4AZNA 3WJBA 3APVA 4XMEA 2QO5A 1G7NA 4ODDA 1RLBE 4O3XB 1LIBA 2NNDA 4LKTA 4QQ1A 1ALBA 4O3WA 1B56A 1I4UA 1B4MA 4QZTA 2FLJA 1A18A 1JV4A 4D6BA 5B29A 2AT5X 5B27A 4AYHA 2BS6A 3HWFA 3P6HA 1Y9TA 3APUA 1QABE 5IO5A 4ORXA 3WJDA 2CBRA 1YWAA 4XMCA 1LF7A 3ZQ3A 1GKAA 5HCEC 2NNQA 3WJCA 2F09A 5H9KA 4EFGA 1E00A 5HZ6A 4O3ZA 5EPQA 1QY0A 2BHVA 1TXLA 1DF3A 3APWA 3ELZA 1HN2A 1E02A 3B2KA 5LJCA 2RQ0A 1VYFA 3P24A 2K23A 4TKBA 1OEEA 2GTLN 1AB0A 1IKEA 4QAEA 1BEBA 4IAXA 1KT3A 1X8QA 4O4UA 4ORWA 2XSTA 3VU1A 1UREA 2GTFX 2ALLX 3VG6A 3HOEA 4INNA 5LJGA 3GAQA 1JBHA 1GX9A 4GU8A 1SY0A 2FS6A 3BX7A 4JGLA 4A60A 4MIRA 1H91A 3VE2A 3ZUIA 5H9AA 1QQSA 2ZAIA 1BSQA 5DPQA 2MHDA 3P6EA 2JW1A 4FBVA 5KHPA 1KXOA 3NX2A 1OBPA 4YBPA 4ZGUA 1MDCA 4TJZA 3KFFA 1SXWA 2QO6A 4I3BA 4YKMA 4AZPA 2AT6X 1KGLA 4NLIA 1JZUA 1T8VA 4Y0SA 1KT7A 2RN4A 4GE1A 4XMDA 4RUUA 1SXYA 4GDZA 4AZOA 4NP1A 3KZAA 2R73A 3S5XA 1GT3A 5F7GA 1U17A 1LIFA 2KTDA 1HBQA 1ERXA 4K19A 1ZNDA 3D95A 4ZHGA 2BS5A 4PSQA 1AELA 3E3CA 1BSOA 1SXUA 4I6SA 3APXA 4A1YA 1IKJA 4ML7B 2NNEA 4IB9A 1HQPA 1LIDA 3NX1A 3RKGA 4A1HA 5C0NA 2CZTA 3ZW1A 3PQSA 4GNWA 4KCAA 3EBWA 1Z24A 1BRPA 1YP6A 1FEMA 1BRQA 2ZAGA 4IAWA 4RUNA 2RD7C 3BLGA 4NW4A 1JJJA 4IB7A 1N0SA 3IA8A 1G5WA 1I04A 2ACOA 4FQBB 5HTDA 1S7DA 3P02A 1QY2A 4GH7A 4I9SA 4CK4A 3PH5A 3CR6A 4XMHA 1RBPA 4D6AA 3PECA 1U18A 3HOLA 2LBVA 4FBRA 5HCCC 4YH0A 4ZGFA 3F9DA 2HMBA 3FMZA 1X8PA 3FYFA 4YBUA 3WXQA 1P6PA 3VPJE 4A8ZA 4ZH6A 1BBPA 2KT4B 2P8GA 3FELA 1LNMA 3TZSA 4U9CA 1HMTA 3ZI8A 2GC9A 5LJDA 3EYCA 4M7MA 1D2UA 5FQ6E 5BYPA 3BX8A 3MVFA 5H9NA 2AT8X 4YDBA 2AT0X 3EBKA 4O9SA 2JU3A 3VE1A 1EW3A 5F6ZA 3ZW0B 1TW4A 2NP1A 3BS2A 2A0AA 2QMIA 1KT5A 4ALBA 1ZNLA 4EXZA 5FQ7E 3S60A 1KT4A 3FA6A 2HZQA 2MWHA 2KTSA 3WBGA 5L8NA 2G7BA 4OMWA 4O4OA 1OBUA 2OFMX 4IB8A 4HWMA 2CM4A 3NQ9A 3WOVA 1PMPA 3S5VA 5JR8A 1ZRYA 3TF6A 2QM9A 5EEDA 2WSJA 3PPTA 4YFRA 2OFRX 1DFVA 1KQXA 4O49A 1BLRA 3ZWEA 4KC7A 5HA1A 1TOUA 4ZJ0A 4PJ2A 2F73A 4HPBA 3KQ0A 3TGAA 1EQDA 5D8JA 1DV9A 1ZNGA 3DTQA 2LBAA 1YWDA 3FEKA 3VG2A 1GGLA 2Q2MA 3K3LA 3UEWA 3HWEA 3H3IA 5HBSA 1I05A 2XKLA 2WUTA 3KFHA 4QNIA 2FTBA 3RZYA 3BDRA 5LJKA 4KT5A 4ZHCA 3B2HA 4ZCBA 2E4JA 3I17A 4IB6A 4EEJA 3P6FA 4KIIA 3B2JA 1B8EA 3P6DA 2DM5A 2Z4IA 4HPAA 4LQZA 5EEEA 1DZMA 3PQUA 2MO5A 3NPOA 3LV4A 3GE2A 2EU7X 2FR3A 1S44A 5D45A 4ARHA 2GJ5A 1DZJA 5LKFA 1QFTA 4BVMA 4YMYA 1X8UA 3FR5A 3HWDA 2LKKA 2RCQA 1CBRA 2FRSA 2HNXA 2R56A 1NP4A 2L67A 3UEUA 4ON1A 5LJBA 4ES7A 3BY0A 3JQOA 2HZRA 4LZUA 4QGXA 5BVSA 1NGLA 3HWGA 4MISA 3BU1A 3OD9A 5CYBA 4QGVA 1GXAA 4CSBA 4AW8A 4Y0PA 3C76X 1TOWA 2X45A 2FR2A 3OE3A 1X8OA 2JU7A 4ZHFA 4GK9A 2AT3X 1E06A 1SY2A 2G78A 1O8VA 3AKNA 4IBAA 5F6BA 4ORRA 4ID2A 2BT9A 4MVIA 5HTEA 5KICA 2G79A 3I0AA 3FA9A 4WBKA 3VG7A 1S2PA 3B2IA 2AMMX 2M4LA 2LA7A 3FR2A 5FENA 4MVKA 3PP6A 1LKEA 3KFIA 4WFUA 3WJEA 2ACPX 3FR4A 2CZUA 2A13A 1CRBA 1EI5A 1CBIA 1XCAA 2YG2A 5L8OA 4HPDA 3V8UA 5FFHA 1JJXA 2X8SA 1KOIA 3S26A 5HZ9A 3NQKA 4N7CA 4MVLA 1ACDA 3DSZA 1SXXA 1FELA 1YP7A 1DZPA 4N7DA 1ERBA 3T1DA 1X8NA 2OZQA 2A2GA 4QZUA 2OVAA 1JIWI 5HWZA 5IO6A 1GM6A 4QRLA 3U9PC 1U0XA 5D4AA 1UZ2X 3ZW2A 5LJEA 2QO4A 2YMSA 4DQ4A 3FEPA 1OEKA 1VPRA 3FA8A 4LKPA 4ORYA 2LB6A 3ZZVA 1IIUA 2O62A 4KC8A 1JYJA 3UAQA 4BQUA 4GZVA 2WEXA 4I3DA 3NP1A 4GKCA 4U8UM 1IW2A 2A3FX 1G74A 1PBOA 5BVTA 4MVEA 1FE3A 2CM9A 2JOZA 1DZKA 3RWXA 1HBPA 1MUPA 1CJ5A 4TKJA 3KFGA 3SAOA 4HPCA 1EPBA 4R0BA 2GTLM 2FS7A 3FW5A 3F8AA 3F6ZB 3BRNA 2OVDA 4UU2A 1FDQA 4YFQA 3CBSA 4IMNA 1LICA 2ASNX 2L9CA 4U8UO 3UEVA 1YWBA 1R0UA 1GX8A 3NADA 4BOEA 4TKHA 3L4RA 3O19A 2X46A 1D3SA 3NQ3A 1QG5A 4NYQA 5K06A 4CV7A 1EXSA 2MJIA 1GKAB 4LZVA 4U3QA 5DG4A 4GETA 4ZHDA 4OS3A 5HA0A 5D47A 2MM3A 1A3YA 2KW1A 3O22A 4NNTA 3RSWA 4I9RA 3FLLA 2HYSA 3QKGA 4GNYA 3STMX 3C78X 1HMSA 1LFOA 4EQAC 2A2UA 3CQRA 3BU9A 2Q39A 2WEWA 5KIDA 4OS8A 4WFVA 5AQ6A 5AJCA 1KZXA 1IFBA 2W2FA 3BSZE 2L5PA 5H9LA 3VG3A 5HCDC 2FT9A 2R74A 1TVQA 2JU8A 5HAEA 2CBSA 4ZR2A 1OPBA 3B2LA 2WR6A 1MVGA 4YKOA 1ICNA 3FW4A 3CBCA 1OBQA 5LJHA 4FGIB 1LPJA 1MX7A 1ZNKA 2AL0X 4U8UN 1GT1A 2ANSA 4COTA 4UU3A 4OMXA 1FENA 2X8FA 3U0DA 1B0OA 2OVEA 2W2AA 3JSQA 4XMGA 1PEEA 1MX8A 2PY1A 1A57A 1KT6A 2Q9SA 4FBOA 2IFBA 1EALA 1CBSA 4IMOA 2X8TA 4KH8A 1EIIA 1BM5A 4ZH9A 3EMMA 1Y9LA 4NNSA 3HTYA 4I3CA 3TGCA 4YGHA 4TNNA 3U03A 4O4XA 4XMFA 4YFPA 4L3RA 1OPAA 5EDCA 3FENA 1BWYA 4YGGA 4EDEA 3FA7A 2POAA 2WQ9A 2Q4NA 1QFVA 3C77X 3NR3A 3MX7A 2LFOA 1ADLA 4Y0QA 3G7XA 4M6SA 4O4SA 3ZW1B 4DQ3A 1ICMA 3N91A 4QGWA 4WHIA 3VG5A 2RA6A 4Y0RA 1ML7A 1QY1A 3D96A 3ZUOA 2BLGA 2K62A 2WWPA 4AZMA 2WQAE 1PM1X 1ZNHA 4QYPA 1SY1A 1CBQA 4TLJA 5HZQA 1KQWA 2OVSA 1KZWA 1E5PA 2QOSC 4HFOA 4YGZA 5IO7A 1EIOA 3IFBA 5L8IA 1LIEA 5AJBA 3STKA 5AEOA 1OEJA 3WJFA 3D4RA 1BJ7A 3UEXA 1X71A 5FQ8E 4ZFXA 1BSYA 3CQNA 1FTPA 1T68X 3D97A 3P6CA 1YIVA 4AZRA 3OBLA 1SA8A 3STNA 1ZNEA 3ELXA 1IFCA 4IABA 3EM0A 2KD2A 2Q2PA 5FAZA 3WVMA 2FWVA 4ORUA 4YCHA 1DC9A 3O2YA 4I95A 3TGBA 4TQ2A 3P6GA 1AVGI 5H8TA 1EUOA 4L1NA 1HMRA 1XKIA 5D48A 2Z4HA 2JMBA 2AKQA 5HZ5A 1SMPI 3OJYC 1A2DA 1O1UA 3Q6LA 5EZ2A 3NBXX 5F58A 4AZQA 1SY3A 2N93A 4OS0A 5EDBA 5BVQA 3MBTA 3RBYA 3FIQA 3CMPA 1YUPA 1QWDA 1EPAA 3CWKA 1O1VA 4YDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRJ A;  1G85 A;  1JYD A;  1YWC A;  3HK1 A;  4YCE A;  5LKE A;  1NP1 A;  2JN3 A;  2RCT A;  2W2B A;  2AH7 X;  3WJG A;  4ZHH A;  2HLV A;  3AKM A;  4QYN A;  1VYG A;  3PED A;  4ORS A;  5F1E A;  3VG4 A;  1AQB A;  1GT5 A;  2L68 A;  1I06 A;  1GT4 A;  5CE4 A;  4NYR A;  1L6M A;  4NLJ A;  3JS1 A;  1T0V A;  5HZ8 A;  1X89 A;  4ALO A;  3PH6 A;  4AZN A;  3WJB A;  3APV A;  4XME A;  2QO5 A;  1G7N A;  4ODD A;  1RLB E;  1LIB A;  2NND A;  4LKT A;  1ALB A;  1B4M A;  1B56 A;  1I4U A;  4QZT A;  2FLJ A;  1A18 A;  1JV4 A;  4D6B A;  5B29 A;  2AT5 X;  5B27 A;  4AYH A;  3P6H A;  3HWF A;  3APU A;  1QAB E;  5IO5 A;  4ORX A;  3WJD A;  2CBR A;  1YWA A;  4XMC A;  1LF7 A;  3ZQ3 A;  1GKA A;  5HCE C;  2NNQ A;  3WJC A;  5H9K A;  4EFG A;  1E00 A;  5HZ6 A;  5EPQ A;  1QY0 A;  1TXL A;  1DF3 A;  3APW A;  3ELZ A;  1HN2 A;  1E02 A;  3B2K A;  5LJC A;  2RQ0 A;  1VYF A;  2K23 A;  4TKB A;  1OEE A;  1AB0 A;  1IKE A;  4QAE A;  1BEB A;  4IAX A;  1KT3 A;  1X8Q A;  4ORW A;  2XST A;  1URE A;  2GTF X;  2ALL X;  3VG6 A;  5LJG A;  3GAQ A;  1JBH A;  1GX9 A;  1SY0 A;  2FS6 A;  3BX7 A;  4A60 A;  1H91 A;  3ZUI A;  5H9A A;  1QQS A;  1BSQ A;  5DPQ A;  3P6E A;  5KHP A;  1KXO A;  3NX2 A;  1OBP A;  4YBP A;  4ZGU A;  1MDC A;  4TJZ A;  3KFF A;  1SXW A;  2QO6 A;  4I3B A;  4YKM A;  4AZP A;  2AT6 X;  1KGL A;  4NLI A;  1JZU A;  1T8V A;  4Y0S A;  1KT7 A;  4GE1 A;  4XMD A;  4RUU A;  1SXY A;  4AZO A;  4NP1 A;  3KZA A;  2R73 A;  1GT3 A;  5F7G A;  1U17 A;  1LIF A;  2KTD A;  1HBQ A;  1ERX A;  4K19 A;  1ZND A;  3D95 A;  4ZHG A;  4PSQ A;  1AEL A;  1BSO A;  1SXU A;  3APX A;  4A1Y A;  1IKJ A;  2NNE A;  4IB9 A;  1HQP A;  1LID A;  3NX1 A;  5C0N A;  4A1H A;  2CZT A;  4GNW A;  3EBW A;  1Z24 A;  1BRP A;  1YP6 A;  1FEM A;  1BRQ A;  4IAW A;  4RUN A;  2RD7 C;  3BLG A;  1JJJ A;  4IB7 A;  1N0S A;  3IA8 A;  1G5W A;  1I04 A;  2ACO A;  5HTD A;  1S7D A;  1QY2 A;  4GH7 A;  4I9S A;  4CK4 A;  3PH5 A;  3CR6 A;  4XMH A;  1RBP A;  4D6A A;  3PEC A;  1U18 A;  5HCC C;  2LBV A;  4YH0 A;  3F9D A;  2HMB A;  3FMZ A;  1X8P A;  4YBU A;  3WXQ A;  1P6P A;  4A8Z A;  4ZH6 A;  1BBP A;  2KT4 B;  2P8G A;  3FEL A;  1LNM A;  3TZS A;  1HMT A;  2GC9 A;  5LJD A;  3EYC A;  4M7M A;  1D2U A;  3BX8 A;  3MVF A;  5H9N A;  2AT8 X;  4YDB A;  2AT0 X;  3EBK A;  4O9S A;  2JU3 A;  1EW3 A;  5F6Z A;  1TW4 A;  2NP1 A;  3BS2 A;  2A0A A;  1KT5 A;  4ALB A;  1ZNL A;  4EXZ A;  1KT4 A;  3FA6 A;  2HZQ A;  3WBG A;  5L8N A;  2G7B A;  4OMW A;  1OBU A;  2OFM X;  4IB8 A;  2CM4 A;  3NQ9 A;  1PMP A;  5JR8 A;  1ZRY A;  3TF6 A;  2QM9 A;  5EED A;  2WSJ A;  3PPT A;  4YFR A;  2OFR X;  1DFV A;  1KQX A;  1BLR A;  5HA1 A;  1TOU A;  4ZJ0 A;  2F73 A;  4HPB A;  3KQ0 A;  3TGA A;  1EQD A;  5D8J A;  1DV9 A;  1ZNG A;  3DTQ A;  2LBA A;  1YWD A;  3FEK A;  3VG2 A;  1GGL A;  2Q2M A;  3K3L A;  3UEW A;  3HWE A;  5HBS A;  1I05 A;  2XKL A;  2WUT A;  3KFH A;  2FTB A;  3RZY A;  3BDR A;  5LJK A;  4ZHC A;  3B2H A;  4ZCB A;  2E4J A;  3I17 A;  4IB6 A;  4EEJ A;  3P6F A;  4KII A;  3B2J A;  1B8E A;  3P6D A;  2DM5 A;  4HPA A;  5EEE A;  1DZM A;  2MO5 A;  3NPO A;  2EU7 X;  2FR3 A;  1S44 A;  5D45 A;  4ARH A;  2GJ5 A;  1DZJ A;  5LKF A;  1QFT A;  4BVM A;  4YMY A;  1X8U A;  3FR5 A;  3HWD A;  2LKK A;  2RCQ A;  1CBR A;  2FRS A;  2HNX A;  2R56 A;  1NP4 A;  2L67 A;  3UEU A;  5LJB A;  4ES7 A;  3BY0 A;  2HZR A;  4LZU A;  4QGX A;  5BVS A;  1NGL A;  3HWG A;  3BU1 A;  4QGV A;  1GXA A;  4AW8 A;  4Y0P A;  3C76 X;  1TOW A;  2X45 A;  2FR2 A;  1X8O A;  2JU7 A;  4ZHF A;  2AT3 X;  1E06 A;  1SY2 A;  2G78 A;  1O8V A;  3AKN A;  4IBA A;  5F6B A;  4ORR A;  4MVI A;  5HTE A;  5KIC A;  2G79 A;  3I0A A;  3FA9 A;  4WBK A;  3VG7 A;  1S2P A;  3B2I A;  2AMM X;  3FR2 A;  5FEN A;  4MVK A;  3PP6 A;  1LKE A;  3KFI A;  4WFU A;  3WJE A;  2ACP X;  3FR4 A;  2CZU A;  2A13 A;  1CRB A;  1CBI A;  1XCA A;  2YG2 A;  5L8O A;  4HPD A;  5FFH A;  1JJX A;  1KOI A;  3S26 A;  5HZ9 A;  4N7C A;  4MVL A;  1ACD A;  3DSZ A;  1SXX A;  1FEL A;  1YP7 A;  1DZP A;  4N7D A;  1ERB A;  3T1D A;  1X8N A;  2OZQ A;  2A2G A;  4QZU A;  2OVA A;  5HWZ A;  5IO6 A;  1GM6 A;  3U9P C;  1U0X A;  5D4A A;  1UZ2 X;  5LJE A;  2QO4 A;  4DQ4 A;  3FEP A;  1OEK A;  1VPR A;  3FA8 A;  4LKP A;  4ORY A;  2LB6 A;  1IIU A;  2O62 A;  1JYJ A;  4BQU A;  2WEX A;  4I3D A;  3NP1 A;  4GKC A;  1IW2 A;  2A3F X;  1G74 A;  1PBO A;  5BVT A;  1FE3 A;  2CM9 A;  2JOZ A;  1DZK A;  1HBP A;  1MUP A;  1CJ5 A;  4TKJ A;  3KFG A;  3SAO A;  4HPC A;  1EPB A;  4R0B A;  3FW5 A;  2FS7 A;  3F8A A;  3BRN A;  2OVD A;  4UU2 A;  1FDQ A;  4YFQ A;  3CBS A;  4IMN A;  1LIC A;  2ASN X;  2L9C A;  3UEV A;  1YWB A;  1R0U A;  1GX8 A;  3NAD A;  4BOE A;  4TKH A;  3L4R A;  3O19 A;  2X46 A;  1D3S A;  3NQ3 A;  1QG5 A;  4NYQ A;  5K06 A;  1EXS A;  2MJI A;  1GKA B;  4LZV A;  5DG4 A;  4GET A;  4ZHD A;  4OS3 A;  5HA0 A;  5D47 A;  2MM3 A;  1A3Y A;  3RSW A;  3O22 A;  4NNT A;  4I9R A;  3FLL A;  2HYS A;  3QKG A;  4GNY A;  3STM X;  3C78 X;  1HMS A;  1LFO A;  2A2U A;  3CQR A;  3BU9 A;  2Q39 A;  2WEW A;  5KID A;  4OS8 A;  4WFV A;  5AQ6 A;  1KZX A;  1IFB A;  2W2F A;  3BSZ E;  2L5P A;  5H9L A;  3VG3 A;  5HCD C;  2FT9 A;  2R74 A;  1TVQ A;  2JU8 A;  5HAE A;  2CBS A;  4ZR2 A;  1OPB A;  3B2L A;  2WR6 A;  1MVG A;  4YKO A;  1ICN A;  3FW4 A;  3CBC A;  1OBQ A;  5LJH A;  1LPJ A;  1MX7 A;  1ZNK A;  2AL0 X;  1GT1 A;  2ANS A;  4UU3 A;  4OMX A;  1FEN A;  3U0D A;  1B0O A;  2OVE A;  2W2A A;  3JSQ A;  4XMG A;  1PEE A;  1MX8 A;  2PY1 A;  1A57 A;  1KT6 A;  2Q9S A;  2IFB A;  1EAL A;  1CBS A;  4IMO A;  1EII A;  1BM5 A;  4ZH9 A;  3EMM A;  4NNS A;  4I3C A;  3TGC A;  4YGH A;  4TNN A;  3U03 A;  4XMF A;  4YFP A;  1OPA A;  5EDC A;  3FEN A;  1BWY A;  4YGG A;  4EDE A;  3FA7 A;  2POA A;  2WQ9 A;  2Q4N A;  1QFV A;  3C77 X;  3NR3 A;  2LFO A;  1ADL A;  4Y0Q A;  3G7X A;  4M6S A;  4DQ3 A;  1ICM A;  4QGW A;  3VG5 A;  2RA6 A;  4Y0R A;  1ML7 A;  1QY1 A;  3D96 A;  3ZUO A;  2BLG A;  2K62 A;  2WWP A;  4AZM A;  2WQA E;  1PM1 X;  1ZNH A;  4QYP A;  1SY1 A;  1CBQ A;  4TLJ A;  5HZQ A;  1KQW A;  1KZW A;  1E5P A;  2QOS C;  4HFO A;  4YGZ A;  5IO7 A;  1EIO A;  3IFB A;  5L8I A;  1LIE A;  3STK A;  1OEJ A;  3WJF A;  1BJ7 A;  3UEX A;  1X71 A;  4ZFX A;  1BSY A;  3CQN A;  1FTP A;  1T68 X;  3D97 A;  3P6C A;  1YIV A;  4AZR A;  1SA8 A;  3STN A;  1ZNE A;  3ELX A;  1IFC A;  3EM0 A;  2Q2P A;  5FAZ A;  3WVM A;  2FWV A;  4ORU A;  4YCH A;  1DC9 A;  3O2Y A;  3TGB A;  4TQ2 A;  3P6G A;  1AVG I;  5H8T A;  1EUO A;  1HMR A;  1XKI A;  5D48 A;  2AKQ A;  5HZ5 A;  3OJY C;  1A2D A;  1O1U A;  3Q6L A;  5EZ2 A;  5F58 A;  4AZQ A;  1SY3 A;  2N93 A;  4OS0 A;  5EDB A;  5BVQ A;  3MBT A;  3FIQ A;  3CMP A;  1YUP A;  1QWD A;  1EPA A;  3CWK A;  1O1V A;  4YDA A; 
#chains in the Genus database with same CATH topology
 4GRJ A;  1G85 A;  1JYD A;  1RAV A;  1SWN A;  1Y55 X;  1YWC A;  3HK1 A;  4YCE A;  1LUQ A;  1NP1 A;  2JN3 A;  4O3Y A;  3RDS A;  5LKE A;  2RCT A;  2W2B A;  2AH7 X;  1UYN X;  2RTM A;  3WJG A;  4ZHH A;  2HLV A;  3AKM A;  1WBI A;  1VYG A;  4QYN A;  5JD2 A;  2IZD B;  4BX7 A;  3PED A;  4ORS A;  2IZG B;  5F1E A;  3VG4 A;  1AQB A;  1GT5 A;  2L68 A;  1IJ8 A;  1GT4 A;  1I06 A;  5CE4 A;  4NYR A;  3ZW0 A;  1L6M A;  4NLJ A;  2GTL O;  3JS1 A;  3LHN A;  1T0V A;  3SOT A;  3WYP A;  5HZ8 A;  2RTO B;  1X89 A;  4ALO A;  3PH6 A;  4AZN A;  3WJB A;  3APV A;  4XME A;  2IZB A;  2QO5 A;  1G7N A;  4ODD A;  1RLB E;  2FHN X;  4O3X B;  4OEM A;  2RTF B;  1LIB A;  4DCB A;  2NND A;  4LKT A;  4DNE A;  4QQ1 A;  1ALB A;  4O3W A;  1B56 A;  1I4U A;  2CAM A;  1B4M A;  4QZT A;  2FLJ A;  1A18 A;  1JV4 A;  5B3M O;  4D6B A;  2AT5 X;  5B29 A;  5B27 A;  1STR B;  4AYH A;  2BS6 A;  3HWF A;  3P6H A;  1JMX A;  1Y9T A;  3RDM A;  3APU A;  1QAB E;  4CPF A;  5IO5 A;  4ORX A;  3WJD A;  1SLF B;  1YWA A;  1LDQ A;  2CBR A;  4XMC A;  1LF7 A;  2RTC B;  3ZQ3 A;  1WUB A;  1GKA A;  5HCE C;  2NNQ A;  3WJC A;  2F09 A;  5H9K A;  4NV8 A;  1E00 A;  4EFG A;  5HZ6 A;  4O3Z A;  5EPQ A;  3CWK A;  1QY0 A;  2BHV A;  2A5C A;  1TXL A;  1DF3 A;  3APW A;  3ELZ A;  1HN2 A;  1E02 A;  2OF9 A;  2X56 A;  2OYB O;  1SWL A;  2Y3E A;  3B2K A;  5LJC A;  2RQ0 A;  1VYF A;  3P24 A;  2K23 A;  4TKB A;  1MK5 A;  1OEE A;  2GTL N;  1AB0 A;  1IKE A;  1VWC B;  4QAE A;  1BEB A;  4IAX A;  2VFB A;  1KT3 A;  1X8Q A;  3KVN A;  5B2A O;  4O4U A;  4ORW A;  2XST A;  3VU1 A;  1URE A;  2GTF X;  1SWG A;  1SRE A;  2ALL X;  3VG6 A;  3HOE A;  4INN A;  2WPU A;  5LJG A;  3GAQ A;  1JBH A;  2IZE B;  1GX9 A;  2G5L A;  4GU8 A;  1SY0 A;  1VWE B;  2FS6 A;  3BX7 A;  2RTD B;  4JGL A;  2IZC B;  4MIR A;  4A60 A;  4BJ8 A;  1VWO B;  1VWI B;  1H91 A;  3VE2 A;  3ZUI A;  2AF5 A;  5H9A A;  1HXL A;  1QQS A;  2ZAI A;  1BSQ A;  1HQQ A;  3QQ2 A;  4CDF A;  2BC3 A;  4BX6 A;  5DPQ A;  2MHD A;  3P6E A;  2JW1 A;  4FBV A;  4GJS A;  5KHP A;  1KXO A;  3NX2 A;  2X55 A;  1RST B;  3PK2 A;  1OBP A;  4YBP A;  4ZGU A;  1MDC A;  4CPH A;  1SRH A;  4TJZ A;  3X00 A;  1SWD A;  3KFF A;  1SXW A;  2QO6 A;  4I3B A;  1N43 A;  4U46 A;  4YKM A;  4AZP A;  2AT6 X;  1KGL A;  1MOY A;  4NLI A;  1JZU A;  1SWT A;  1JMZ A;  1T8V A;  1JQP A;  4Y0S A;  1KT7 A;  2RN4 A;  4GE1 A;  4XMD A;  4RUU A;  1SXY A;  4GDZ A;  4AZO A;  4NP1 A;  3KZA A;  2R73 A;  3S5X A;  1GT3 A;  5F7G A;  1U17 A;  1LIF A;  2JGS A;  1HBQ A;  1ERX A;  2KTD A;  1RXJ A;  1ZND A;  4K19 A;  2OL6 O;  3D95 A;  4ZHG A;  2BS5 A;  4PSQ A;  1AEL A;  2I5V O;  3E3C A;  1SWS A;  1BSO A;  1SXU A;  4I6S A;  3APX A;  4A1Y A;  1IKJ A;  4ML7 B;  2NNE A;  4IB9 A;  1HQP A;  1LID A;  3NX1 A;  3RKG A;  4A1H A;  4AZM A;  4CDC A;  5C0N A;  2CZT A;  2ZSC A;  3ZW1 A;  2X34 A;  3PQS A;  4GNW A;  4KCA A;  2C1Q A;  1Z24 A;  1K3B A;  3EBW A;  5IRW A;  1BRP A;  1YP6 A;  1FEM A;  1BRQ A;  2ZAG A;  4IAW A;  4RUN A;  2RD7 C;  2DJG A;  3BLG A;  4NW4 A;  1JJJ A;  4IB7 A;  1N0S A;  3IA8 A;  2OY5 O;  4C5P A;  1I04 A;  2ACO A;  4FQB B;  5HTD A;  1S7D A;  1VWQ B;  1G5W A;  3P02 A;  1QY2 A;  4GH7 A;  4I9S A;  2Y32 A;  1SWQ A;  4CK4 A;  3PH5 A;  3CR6 A;  4XMH A;  1RBP A;  4D6A A;  5K67 A;  3PEC A;  1U18 A;  3HOL A;  2LBV A;  3RE5 A;  4FBR A;  1NQM A;  4YH0 A;  4ZGF A;  3F9D A;  2HMB A;  3FMZ A;  1X8P A;  3FYF A;  4YBU A;  3WXQ A;  1P6P A;  3VPJ E;  4A8Z A;  4ZH6 A;  4Y5D A;  1BBP A;  2KT4 B;  1JJU A;  2P8G A;  1LNM A;  3FEL A;  4JNJ A;  1HMT A;  4U9C A;  3ZI8 A;  4CDE A;  2GC9 A;  3TZS A;  5LJD A;  3EYC A;  4M7M A;  1D2U A;  5FQ6 E;  5BYP A;  4BBO A;  3BX8 A;  4JHQ A;  1SWU A;  4GUZ A;  3MVF A;  5H9N A;  2AT8 X;  5IXG A;  3AUM O;  3T2W A;  4YDB A;  2AT0 X;  4BX5 A;  3FDC A;  1RSU B;  3EBK A;  2JU3 A;  4O9S A;  3VE1 A;  1EW3 A;  2OL8 O;  3EW2 A;  1AVE A;  1N4J A;  5F6Z A;  3ZW0 B;  1TW4 A;  2NP1 A;  2F01 A;  2RTE B;  2A0A A;  2QMI A;  2RTK A;  3BS2 A;  1KT5 A;  4ALB A;  1ZNL A;  4EXZ A;  5FQ7 E;  3S60 A;  1KT4 A;  1LDO A;  3FA6 A;  1SWF A;  2HZQ A;  2MWH A;  2KTS A;  5IRA A;  3WBG A;  5L8N A;  2G7B A;  4OMW A;  4O4O A;  1OBU A;  1DF8 A;  2I5Z O;  2OFM X;  4IB8 A;  4HWM A;  2CM4 A;  3NQ9 A;  3WOV A;  1PMP A;  3S5V A;  2RTH B;  5JR8 A;  1VWR B;  1KL4 A;  1ZRY A;  3TF6 A;  2QM9 A;  5EED A;  2WSJ A;  3PPT A;  4YFR A;  2OFR X;  1I9H A;  1DFV A;  1HY2 A;  3SZJ A;  1KQX A;  3PDF A;  5LJH A;  4O49 A;  4Z2O A;  1BLR A;  3ZWE A;  4KC7 A;  5HA1 A;  1TOU A;  4ZJ0 A;  1VWG B;  4PJ2 A;  2F73 A;  4HPB A;  3KQ0 A;  3TGA A;  3WZP A;  1EQD A;  5D8J A;  1DV9 A;  1ZNG A;  3DTQ A;  1MEP A;  2LBA A;  1YWD A;  3FEK A;  3VG2 A;  1VWD B;  3FID A;  1GGL A;  2G8C O;  2Q2M A;  3K3L A;  3UEW A;  3HWE A;  3H3I A;  5HBS A;  1I05 A;  2XKL A;  2WUT A;  2RTA A;  3HPE A;  2FTB A;  1SLG B;  3KFH A;  4QNI A;  3RDU A;  2BSZ A;  3BDR A;  3RZY A;  2VDF A;  4GGT A;  5LJK A;  4KT5 A;  4ZHC A;  3B2H A;  4ZCB A;  2E4J A;  2IZL B;  3I17 A;  4IB6 A;  4EEJ A;  1OSP O;  4COT A;  3P6F A;  4KII A;  3B2J A;  1SLE B;  1B8E A;  3P6D A;  2DM5 A;  2Z4I A;  4HPA A;  4LQZ A;  5EEE A;  1DZM A;  3PQU A;  1RXH A;  2MO5 A;  3NPO A;  3LV4 A;  1FJ1 E;  1VWF B;  1SWB A;  3GE2 A;  2EU7 X;  2FR3 A;  1S44 A;  5D45 A;  2OY7 A;  4ARH A;  2GJ5 A;  1DZJ A;  5LKF A;  1GX3 A;  1SRG A;  1QFT A;  5HCC C;  5L3Y A;  4BVM A;  3AEH A;  4YMY A;  1X8U A;  3FR5 A;  3HWD A;  2LKK A;  1UYO X;  2RCQ A;  1CBR A;  2FRS A;  2HNX A;  2OY1 O;  2R56 A;  1NP4 A;  1STP A;  2L67 A;  4ON1 A;  3RE6 A;  3UEU A;  2C4I A;  1SRJ A;  4CPI A;  4Z2V A;  4ES7 A;  5LJB A;  3LTW A;  3BY0 A;  3JQO A;  2HZR A;  4NV7 A;  4LZU A;  4B55 A;  4QGX A;  3RY1 A;  3T6L A;  5IRU A;  5BVS A;  5K68 A;  5CHK A;  1NGL A;  3HWG A;  4MIS A;  2IZA A;  3BU1 A;  1W6F A;  3OD9 A;  5CYB A;  4QGV A;  1GXA A;  4CSB A;  4AW8 A;  4Y0P A;  3C76 X;  1TOW A;  2X45 A;  2FR2 A;  3OE3 A;  1NC9 A;  1X8O A;  3SZH A;  1N9M A;  3VHM A;  2JU7 A;  1MM9 A;  4ZHF A;  1VWJ B;  1SWR A;  4GK9 A;  2AT3 X;  1E06 A;  1SY2 A;  2G78 A;  1O8V A;  3AKN A;  1NDJ A;  4IBA A;  5F6B A;  4ORR A;  4ID2 A;  2BT9 A;  4MVI A;  5B11 O;  5HTE A;  2G79 A;  3I0A A;  2RTQ B;  3FA9 A;  4WBK A;  3VG7 A;  1S2P A;  3B2I A;  2AMM X;  2M4L A;  2LA7 A;  3FR2 A;  5CSE A;  1KFF A;  5FEN A;  4MVK A;  3PP6 A;  1PEE A;  4OEL A;  1LKE A;  3KFI A;  4WFU A;  3WJE A;  2ACP X;  3FR4 A;  2CZU A;  2A13 A;  1Y52 X;  1CRB A;  1EI5 A;  1CBI A;  1XCA A;  2YG2 A;  5L8O A;  2OFB A;  4HPD A;  3V8U A;  5FFH A;  1JJX A;  2X8S A;  1RXK A;  4GGR A;  1KOI A;  3S26 A;  1LCZ A;  3NQK A;  4N7C A;  5HZ9 A;  3EC5 A;  4MVL A;  1ACD A;  3DSZ A;  5B5G A;  1SXX A;  1FEL A;  1VYO A;  1DZP A;  1YP7 A;  2OL7 A;  4N7D A;  1ERB A;  4BGF A;  2X4M A;  3T1D A;  1X8N A;  2OZQ A;  2A2G A;  2UZ2 A;  4QZU A;  2OVA A;  1JIW I;  5HWZ A;  5IO6 A;  1GM6 A;  4QRL A;  3U9P C;  1U0X A;  5D4A A;  1UZ2 X;  3ZW2 A;  5LJE A;  2IZF B;  2QO4 A;  2YMS A;  2RTL A;  3T2X A;  2IZH B;  4DQ4 A;  3FEP A;  1OEK A;  1SRF A;  1VPR A;  3FA8 A;  1KL3 A;  4LKP A;  4BX5 B;  2DJF A;  4ORY A;  2LB6 A;  3ZZV A;  1IIU A;  2O62 A;  2X32 A;  4KC8 A;  4BX7 B;  4JO6 A;  2Y3F A;  1JYJ A;  3SLJ A;  3UAQ A;  1VWK B;  4GZV A;  2WEX A;  4I3D A;  4BQU A;  3NP1 A;  4GKC A;  4U8U M;  1IW2 A;  1VWA B;  2A3F X;  4CDD A;  1G74 A;  1PBO A;  4IRW A;  2GH7 A;  4MVE A;  1FE3 A;  2CM9 A;  2JOZ A;  1DZK A;  2RTP B;  2RTR B;  5BVT A;  3RWX A;  1HBP A;  1MUP A;  1CJ5 A;  4TKJ A;  3KFG A;  3SAO A;  4HPC A;  1EPB A;  1SWO A;  4R0B A;  2IZI A;  2GTL M;  2FS7 A;  3FW5 A;  1SWK A;  2FKJ A;  3F8A A;  3F6Z B;  3BRN A;  2OVD A;  4UU2 A;  2MF6 A;  1FDQ A;  1SWH A;  4I60 A;  4YFQ A;  3CBS A;  2UYW A;  4IMN A;  1LIC A;  2ASN X;  1NQN A;  2L9C A;  4GJV A;  4U8U O;  3UEV A;  1VWB B;  1YWB A;  1R0U A;  1GX8 A;  3NAD A;  4BOE A;  4TKH A;  1I78 A;  3L4R A;  3O19 A;  1VWP B;  2X46 A;  1D3S A;  3NQ3 A;  2IZK A;  3MM0 A;  1QG5 A;  4NYQ A;  5K06 A;  4CV7 A;  4OKA A;  1EXS A;  2MJI A;  1GKA B;  4LZV A;  4U3Q A;  5DG4 A;  4GET A;  4ZHD A;  4OS3 A;  5HA0 A;  5D47 A;  1K24 A;  2MM3 A;  1A3Y A;  2KW1 A;  3O22 A;  4NNT A;  4Y59 A;  3RSW A;  3SLO A;  5KIC A;  4I9R A;  3FLL A;  2HYS A;  3QKG A;  4GD9 A;  4GNY A;  3STM X;  1LEL A;  1HMS A;  1LFO A;  3C78 X;  2A2U A;  4EQA C;  3CQR A;  2A5B A;  3BU9 A;  2Q39 A;  2WEW A;  5KID A;  4OS8 A;  4WFV A;  5AQ6 A;  5AJC A;  4YVB A;  1KZX A;  1IFB A;  2IZJ A;  4Z27 A;  2W2F A;  3BSZ E;  2L5P A;  5H9L A;  3VG3 A;  5HCD C;  1W5R A;  2FT9 A;  1LCW A;  1SLD B;  2R74 A;  1TVQ A;  2JU8 A;  5HAE A;  2CBS A;  4ZR2 A;  1OPB A;  3B2L A;  2WR6 A;  1MVG A;  4YKO A;  3T6F A;  1ICN A;  1VWN B;  3VHI A;  3FW4 A;  3CBC A;  1OBQ A;  2OY8 A;  3D9W A;  4FGI B;  1LPJ A;  1MX7 A;  1ZNK A;  2AL0 X;  4GGZ A;  1LCV A;  1GT1 A;  1SWC A;  4U8U N;  2ANS A;  3WYQ A;  4UU3 A;  1N9Y A;  4OMX A;  3WZO A;  2PI3 O;  1PTS A;  4BX6 B;  2FGS A;  2QOM A;  1FEN A;  2X8F A;  3VHH A;  3U0D A;  1B0O A;  2OVE A;  2W2A A;  3JSQ A;  1PBY A;  4XMG A;  1MX8 A;  2PY1 A;  1Y53 X;  2QCB A;  2RTB B;  1KT6 A;  2Q9S A;  1A57 A;  4FBO A;  2IFB A;  1VWM B;  4CPH B;  1EAL A;  1CBS A;  4IMO A;  2X8T A;  4KH8 A;  1EII A;  1BM5 A;  1VWH B;  4ZH9 A;  1KL5 A;  3EMM A;  3RDX A;  1Y9L A;  4NNS A;  3HTY A;  2C1S A;  4I3C A;  4MEE A;  4YGH A;  2RTJ A;  3TGC A;  4TNN A;  4Z28 A;  3U03 A;  4O4X A;  4XMF A;  4YFP A;  4L3R A;  1OPA A;  5EDC A;  3FEN A;  3WZN A;  1BWY A;  3Q34 A;  4YGG A;  1SRI A;  3SZI A;  4EDE A;  4Z6J A;  3FA7 A;  1SWE A;  1NBX A;  2POA A;  2WQ9 A;  2Q4N A;  1SWP A;  1QFV A;  3C77 X;  3NR3 A;  3MX7 A;  1E2T A;  2LFO A;  4BCS A;  1ADL A;  4Y0Q A;  3G7X A;  4M6S A;  4O4S A;  3ZW1 B;  4DQ3 A;  1ICM A;  3N91 A;  4QGW A;  4WHI A;  3VG5 A;  2RA6 A;  4Y0R A;  1ML7 A;  1SWA A;  1QY1 A;  3D96 A;  3ZUO A;  2BLG A;  2K62 A;  1VWL B;  2WWP A;  2OF8 A;  1PM1 X;  2WQA E;  1ZNH A;  4QYP A;  5F2B A;  1SY1 A;  1CBQ A;  4TLJ A;  5HZQ A;  4EKV A;  1KQW A;  2OVS A;  1KZW A;  1E5P A;  2QOS C;  4HFO A;  4YGZ A;  5IO7 A;  4GDA A;  1EIO A;  1Y0G A;  3IFB A;  2RTG B;  1LIE A;  2VFC A;  5AJB A;  5L8I A;  3STK A;  4Z2P A;  3RDQ A;  2HKD A;  5AEO A;  1OEJ A;  2AVI A;  3WJF A;  3D4R A;  3RDO A;  1BJ7 A;  3UEX A;  1X71 A;  5FQ8 E;  4ZFX A;  1BSY A;  3CQN A;  5B10 O;  1FTP A;  1T68 X;  3D97 A;  3P6C A;  1YIV A;  4AZR A;  5B5F A;  3OBL A;  1SA8 A;  3EW1 A;  3STN A;  1ZNE A;  2RTI B;  3ELX A;  3WZQ A;  1IFC A;  4IAB A;  3EM0 A;  2OFA A;  2KD2 A;  2Q2P A;  5FAZ A;  3SLT A;  2FWV A;  1STS B;  3WVM A;  4ORU A;  4YCH A;  1DC9 A;  3CKF A;  3O2Y A;  4I95 A;  3TGB A;  3VGW A;  4TQ2 A;  3P6G A;  1AVG I;  4CPE A;  2FKG A;  5H8T A;  1EUO A;  3CKG A;  1HMR A;  4L1N A;  1XKI A;  1HXZ A;  5D48 A;  2Z4H A;  2JMB A;  1N7Y A;  2AKQ A;  2RTN B;  1W4T A;  5HZ5 A;  1SMP I;  3OJY C;  3RY2 A;  1A2D A;  1AVD A;  1O1U A;  3Q6L A;  5EZ2 A;  3NBX X;  5F58 A;  4AZQ A;  1SY3 A;  2N93 A;  4OS0 A;  2FHL A;  2A8G A;  5EDB A;  5BVQ A;  3MBT A;  3RBY A;  3FIQ A;  3CMP A;  1YUP A;  3MG5 A;  1QWD A;  1EPA A;  1SWJ A;  1O1V A;  4YDA A; 
#chains in the Genus database with same CATH homology
 4GRJ A;  1G85 A;  1JYD A;  1YWC A;  3HK1 A;  4YCE A;  5LKE A;  1NP1 A;  2JN3 A;  4O3Y A;  2RCT A;  2W2B A;  2AH7 X;  3WJG A;  4ZHH A;  2HLV A;  3AKM A;  4QYN A;  1VYG A;  3PED A;  4ORS A;  5F1E A;  3VG4 A;  1AQB A;  1GT5 A;  2L68 A;  1I06 A;  1GT4 A;  5CE4 A;  4NYR A;  3ZW0 A;  1L6M A;  4NLJ A;  2GTL O;  3JS1 A;  3LHN A;  1T0V A;  3SOT A;  5HZ8 A;  1X89 A;  4ALO A;  3PH6 A;  4AZN A;  3WJB A;  3APV A;  4XME A;  2QO5 A;  1G7N A;  4ODD A;  1RLB E;  4O3X B;  1LIB A;  2NND A;  4LKT A;  4QQ1 A;  1ALB A;  4O3W A;  1B56 A;  1I4U A;  1B4M A;  4QZT A;  2FLJ A;  1A18 A;  1JV4 A;  4D6B A;  5B29 A;  2AT5 X;  5B27 A;  4AYH A;  2BS6 A;  3HWF A;  3P6H A;  1Y9T A;  3APU A;  1QAB E;  5IO5 A;  4ORX A;  3WJD A;  2CBR A;  1YWA A;  4XMC A;  1LF7 A;  3ZQ3 A;  1GKA A;  5HCE C;  2NNQ A;  3WJC A;  2F09 A;  5H9K A;  4EFG A;  1E00 A;  5HZ6 A;  4O3Z A;  5EPQ A;  1QY0 A;  2BHV A;  1TXL A;  1DF3 A;  3APW A;  3ELZ A;  1HN2 A;  1E02 A;  3B2K A;  5LJC A;  2RQ0 A;  1VYF A;  3P24 A;  2K23 A;  4TKB A;  1OEE A;  2GTL N;  1AB0 A;  1IKE A;  4QAE A;  1BEB A;  4IAX A;  1KT3 A;  1X8Q A;  4O4U A;  4ORW A;  2XST A;  3VU1 A;  1URE A;  2GTF X;  2ALL X;  3VG6 A;  3HOE A;  4INN A;  5LJG A;  3GAQ A;  1JBH A;  1GX9 A;  4GU8 A;  1SY0 A;  2FS6 A;  3BX7 A;  4JGL A;  4A60 A;  4MIR A;  1H91 A;  3VE2 A;  3ZUI A;  5H9A A;  1QQS A;  2ZAI A;  1BSQ A;  5DPQ A;  2MHD A;  3P6E A;  2JW1 A;  4FBV A;  5KHP A;  1KXO A;  3NX2 A;  1OBP A;  4YBP A;  4ZGU A;  1MDC A;  4TJZ A;  3KFF A;  1SXW A;  2QO6 A;  4I3B A;  4YKM A;  4AZP A;  2AT6 X;  1KGL A;  4NLI A;  1JZU A;  1T8V A;  4Y0S A;  1KT7 A;  2RN4 A;  4GE1 A;  4XMD A;  4RUU A;  1SXY A;  4GDZ A;  4AZO A;  4NP1 A;  3KZA A;  2R73 A;  3S5X A;  1GT3 A;  5F7G A;  1U17 A;  1LIF A;  2KTD A;  1HBQ A;  1ERX A;  4K19 A;  1ZND A;  3D95 A;  4ZHG A;  2BS5 A;  4PSQ A;  1AEL A;  3E3C A;  1BSO A;  1SXU A;  4I6S A;  3APX A;  4A1Y A;  1IKJ A;  4ML7 B;  2NNE A;  4IB9 A;  1HQP A;  1LID A;  3NX1 A;  3RKG A;  4A1H A;  5C0N A;  2CZT A;  3ZW1 A;  3PQS A;  4GNW A;  4KCA A;  3EBW A;  1Z24 A;  1BRP A;  1YP6 A;  1FEM A;  1BRQ A;  2ZAG A;  4IAW A;  4RUN A;  2RD7 C;  3BLG A;  4NW4 A;  1JJJ A;  4IB7 A;  1N0S A;  3IA8 A;  1G5W A;  1I04 A;  2ACO A;  4FQB B;  5HTD A;  1S7D A;  3P02 A;  1QY2 A;  4GH7 A;  4I9S A;  4CK4 A;  3PH5 A;  3CR6 A;  4XMH A;  1RBP A;  4D6A A;  3PEC A;  1U18 A;  3HOL A;  2LBV A;  4FBR A;  5HCC C;  4YH0 A;  4ZGF A;  3F9D A;  2HMB A;  3FMZ A;  1X8P A;  3FYF A;  4YBU A;  3WXQ A;  1P6P A;  3VPJ E;  4A8Z A;  4ZH6 A;  1BBP A;  2KT4 B;  2P8G A;  3FEL A;  1LNM A;  3TZS A;  4U9C A;  1HMT A;  3ZI8 A;  2GC9 A;  5LJD A;  3EYC A;  4M7M A;  1D2U A;  5FQ6 E;  5BYP A;  3BX8 A;  3MVF A;  5H9N A;  2AT8 X;  4YDB A;  2AT0 X;  3EBK A;  4O9S A;  2JU3 A;  3VE1 A;  1EW3 A;  5F6Z A;  3ZW0 B;  1TW4 A;  2NP1 A;  3BS2 A;  2A0A A;  2QMI A;  1KT5 A;  4ALB A;  1ZNL A;  4EXZ A;  5FQ7 E;  3S60 A;  1KT4 A;  3FA6 A;  2HZQ A;  2MWH A;  2KTS A;  3WBG A;  5L8N A;  2G7B A;  4OMW A;  4O4O A;  1OBU A;  2OFM X;  4IB8 A;  4HWM A;  2CM4 A;  3NQ9 A;  3WOV A;  1PMP A;  3S5V A;  5JR8 A;  1ZRY A;  3TF6 A;  2QM9 A;  5EED A;  2WSJ A;  3PPT A;  4YFR A;  2OFR X;  1DFV A;  1KQX A;  4O49 A;  1BLR A;  3ZWE A;  4KC7 A;  5HA1 A;  1TOU A;  4ZJ0 A;  4PJ2 A;  2F73 A;  4HPB A;  3KQ0 A;  3TGA A;  1EQD A;  5D8J A;  1DV9 A;  1ZNG A;  3DTQ A;  2LBA A;  1YWD A;  3FEK A;  3VG2 A;  1GGL A;  2Q2M A;  3K3L A;  3UEW A;  3HWE A;  3H3I A;  5HBS A;  1I05 A;  2XKL A;  2WUT A;  3KFH A;  4QNI A;  2FTB A;  3RZY A;  3BDR A;  5LJK A;  4KT5 A;  4ZHC A;  3B2H A;  4ZCB A;  2E4J A;  3I17 A;  4IB6 A;  4EEJ A;  3P6F A;  4KII A;  3B2J A;  1B8E A;  3P6D A;  2DM5 A;  2Z4I A;  4HPA A;  4LQZ A;  5EEE A;  1DZM A;  3PQU A;  2MO5 A;  3NPO A;  3LV4 A;  3GE2 A;  2EU7 X;  2FR3 A;  1S44 A;  5D45 A;  4ARH A;  2GJ5 A;  1DZJ A;  5LKF A;  1QFT A;  4BVM A;  4YMY A;  1X8U A;  3FR5 A;  3HWD A;  2LKK A;  2RCQ A;  1CBR A;  2FRS A;  2HNX A;  2R56 A;  1NP4 A;  2L67 A;  3UEU A;  4ON1 A;  5LJB A;  4ES7 A;  3BY0 A;  3JQO A;  2HZR A;  4LZU A;  4QGX A;  5BVS A;  1NGL A;  3HWG A;  4MIS A;  3BU1 A;  3OD9 A;  5CYB A;  4QGV A;  1GXA A;  4CSB A;  4AW8 A;  4Y0P A;  3C76 X;  1TOW A;  2X45 A;  2FR2 A;  3OE3 A;  1X8O A;  2JU7 A;  4ZHF A;  4GK9 A;  2AT3 X;  1E06 A;  1SY2 A;  2G78 A;  1O8V A;  3AKN A;  4IBA A;  5F6B A;  4ORR A;  4ID2 A;  2BT9 A;  4MVI A;  5HTE A;  5KIC A;  2G79 A;  3I0A A;  3FA9 A;  4WBK A;  3VG7 A;  1S2P A;  3B2I A;  2AMM X;  2M4L A;  2LA7 A;  3FR2 A;  5FEN A;  4MVK A;  3PP6 A;  1LKE A;  3KFI A;  4WFU A;  3WJE A;  2ACP X;  3FR4 A;  2CZU A;  2A13 A;  1CRB A;  1EI5 A;  1CBI A;  1XCA A;  2YG2 A;  5L8O A;  4HPD A;  3V8U A;  5FFH A;  1JJX A;  2X8S A;  1KOI A;  3S26 A;  5HZ9 A;  3NQK A;  4N7C A;  4MVL A;  1ACD A;  3DSZ A;  1SXX A;  1FEL A;  1YP7 A;  1DZP A;  4N7D A;  1ERB A;  3T1D A;  1X8N A;  2OZQ A;  2A2G A;  4QZU A;  2OVA A;  1JIW I;  5HWZ A;  5IO6 A;  1GM6 A;  4QRL A;  3U9P C;  1U0X A;  5D4A A;  1UZ2 X;  3ZW2 A;  5LJE A;  2QO4 A;  2YMS A;  4DQ4 A;  3FEP A;  1OEK A;  1VPR A;  3FA8 A;  4LKP A;  4ORY A;  2LB6 A;  3ZZV A;  1IIU A;  2O62 A;  4KC8 A;  1JYJ A;  3UAQ A;  4BQU A;  4GZV A;  2WEX A;  4I3D A;  3NP1 A;  4GKC A;  4U8U M;  1IW2 A;  2A3F X;  1G74 A;  1PBO A;  5BVT A;  4MVE A;  1FE3 A;  2CM9 A;  2JOZ A;  1DZK A;  3RWX A;  1HBP A;  1MUP A;  1CJ5 A;  4TKJ A;  3KFG A;  3SAO A;  4HPC A;  1EPB A;  4R0B A;  2GTL M;  2FS7 A;  3FW5 A;  3F8A A;  3F6Z B;  3BRN A;  2OVD A;  4UU2 A;  1FDQ A;  4YFQ A;  3CBS A;  4IMN A;  1LIC A;  2ASN X;  2L9C A;  4U8U O;  3UEV A;  1YWB A;  1R0U A;  1GX8 A;  3NAD A;  4BOE A;  4TKH A;  3L4R A;  3O19 A;  2X46 A;  1D3S A;  3NQ3 A;  1QG5 A;  4NYQ A;  5K06 A;  4CV7 A;  1EXS A;  2MJI A;  1GKA B;  4LZV A;  4U3Q A;  5DG4 A;  4GET A;  4ZHD A;  4OS3 A;  5HA0 A;  5D47 A;  2MM3 A;  1A3Y A;  2KW1 A;  3O22 A;  4NNT A;  3RSW A;  4I9R A;  3FLL A;  2HYS A;  3QKG A;  4GNY A;  3STM X;  3C78 X;  1HMS A;  1LFO A;  4EQA C;  2A2U A;  3CQR A;  3BU9 A;  2Q39 A;  2WEW A;  5KID A;  4OS8 A;  4WFV A;  5AQ6 A;  5AJC A;  1KZX A;  1IFB A;  2W2F A;  3BSZ E;  2L5P A;  5H9L A;  3VG3 A;  5HCD C;  2FT9 A;  2R74 A;  1TVQ A;  2JU8 A;  5HAE A;  2CBS A;  4ZR2 A;  1OPB A;  3B2L A;  2WR6 A;  1MVG A;  4YKO A;  1ICN A;  3FW4 A;  3CBC A;  1OBQ A;  5LJH A;  4FGI B;  1LPJ A;  1MX7 A;  1ZNK A;  2AL0 X;  4U8U N;  1GT1 A;  2ANS A;  4COT A;  4UU3 A;  4OMX A;  1FEN A;  2X8F A;  3U0D A;  1B0O A;  2OVE A;  2W2A A;  3JSQ A;  4XMG A;  1PEE A;  1MX8 A;  2PY1 A;  1A57 A;  1KT6 A;  2Q9S A;  4FBO A;  2IFB A;  1EAL A;  1CBS A;  4IMO A;  2X8T A;  4KH8 A;  1EII A;  1BM5 A;  4ZH9 A;  3EMM A;  1Y9L A;  4NNS A;  3HTY A;  4I3C A;  3TGC A;  4YGH A;  4TNN A;  3U03 A;  4O4X A;  4XMF A;  4YFP A;  4L3R A;  1OPA A;  5EDC A;  3FEN A;  1BWY A;  4YGG A;  4EDE A;  3FA7 A;  2POA A;  2WQ9 A;  2Q4N A;  1QFV A;  3C77 X;  3NR3 A;  3MX7 A;  2LFO A;  1ADL A;  4Y0Q A;  3G7X A;  4M6S A;  4O4S A;  3ZW1 B;  4DQ3 A;  1ICM A;  3N91 A;  4QGW A;  4WHI A;  3VG5 A;  2RA6 A;  4Y0R A;  1ML7 A;  1QY1 A;  3D96 A;  3ZUO A;  2BLG A;  2K62 A;  2WWP A;  4AZM A;  2WQA E;  1PM1 X;  1ZNH A;  4QYP A;  1SY1 A;  1CBQ A;  4TLJ A;  5HZQ A;  1KQW A;  2OVS A;  1KZW A;  1E5P A;  2QOS C;  4HFO A;  4YGZ A;  5IO7 A;  1EIO A;  3IFB A;  5L8I A;  1LIE A;  5AJB A;  3STK A;  5AEO A;  1OEJ A;  3WJF A;  3D4R A;  1BJ7 A;  3UEX A;  1X71 A;  5FQ8 E;  4ZFX A;  1BSY A;  3CQN A;  1FTP A;  1T68 X;  3D97 A;  3P6C A;  1YIV A;  4AZR A;  3OBL A;  1SA8 A;  3STN A;  1ZNE A;  3ELX A;  1IFC A;  4IAB A;  3EM0 A;  2KD2 A;  2Q2P A;  5FAZ A;  3WVM A;  2FWV A;  4ORU A;  4YCH A;  1DC9 A;  3O2Y A;  4I95 A;  3TGB A;  4TQ2 A;  3P6G A;  1AVG I;  5H8T A;  1EUO A;  4L1N A;  1HMR A;  1XKI A;  5D48 A;  2Z4H A;  2JMB A;  2AKQ A;  5HZ5 A;  1SMP I;  3OJY C;  1A2D A;  1O1U A;  3Q6L A;  5EZ2 A;  3NBX X;  5F58 A;  4AZQ A;  1SY3 A;  2N93 A;  4OS0 A;  5EDB A;  5BVQ A;  3MBT A;  3RBY A;  3FIQ A;  3CMP A;  1YUP A;  1QWD A;  1EPA A;  3CWK A;  1O1V A;  4YDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...