2R74A

Crystal structure of the possum milk whey lipocalin trichosurin at ph 4.6
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
142
Chain Sequence
LRHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCIPLYLTAFKTEEARQFKLNYYGTNDVYYESSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Trichosurin
publication title Three-dimensional structure and ligand binding properties of trichosurin, a metatherian lipocalin from the milk whey of the common brushtail possum Trichosurus vulpecula
pubmed doi rcsb
source organism Trichosurus vulpecula
total genus 39
structure length 142
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2r74A00
2LB6A 2OVEA 2WEXA 4RUUA 4YCHA 3RSWA 5FENA 5HCCC 1OEKA 3S26A 1YUPA 3NPOA 1BWYA 3FELA 4YGZA 1ZNKA 2WUTA 4ZH6A 2NNDA 3O22A 4YBUA 5AQ6A 4QZTA 1SXUA 2DM5A 5H8TA 1TOWA 2HMBA 2CM9A 2MM3A 1ADLA 4NLJA 3WJFA 5FFHA 1DZJA 3UEXA 3P6EA 1LIDA 3BX7A 2Q2PA 4IAWA 1GX8A 1I06A 3C77X 3FEKA 2RCTA 3HWDA 4ZJ0A 3TGAA 1QFTA 2FTBA 1BRQA 1TVQA 3STNA 3KFIA 1QABE 1GT3A 4I3BA 3FA6A 4A1HA 2AT5X 1HQPA 1EALA 1RBPA 1XCAA 3C76X 3VG6A 2XSTA 4MVLA 1OPBA 1UZ2X 4EDEA 2GC9A 5BVSA 1LIFA 1OBPA 2QM9A 3CMPA 1X8OA 5BVQA 4A1YA 4ARHA 1IFCA 5HZ8A 3ELZA 3B2JA 2YG2A 4GH7A 2FR3A 4XMDA 1GT4A 4ALOA 2HYSA 1QWDA 1LKEA 2L67A 4BOEA 1VPRA 1SXWA 2AL0X 4AW8A 3SAOA 2G79A 1ZNHA 1LICA 1E06A 2HLVA 1BJ7A 2PY1A 3MVFA 3IFBA 2CZTA 3FR2A 1FEMA 4ALBA 3FA9A 1MDCA 4GNYA 1KXOA 5EDBA 3B2KA 3WJDA 1ACDA 2RQ0A 3ZQ3A 1PBOA 1E02A 3P6GA 1KZWA 3UEVA 4ZFXA 2N93A 1HMSA 1JV4A 1DFVA 4OMXA 1L6MA 1A18A 1MX7A 3Q6LA 3NQ3A 3VG4A 2R56A 1KT3A 2ACOA 4YGHA 5EPQA 3NQ9A 5H9AA 1YWDA 3HK1A 2QO6A 4TKBA 3CWKA 5LJGA 4NYRA 3CBCA 4D6AA 2K62A 1R0UA 2Q4NA 5DPQA 3FW4A 4XMCA 2OVDA 2WEWA 1EPAA 1FTPA 3JSQA 1OEJA 4N7CA 1PEEA 1B0OA 1HBPA 3ZUOA 4LKTA 1LIEA 4ZHDA 3U03A 1EIIA 2G78A 3VG7A 1PMPA 2CZUA 4ORRA 4ZH9A 1DZPA 1IFBA 1SY3A 1ZNDA 4ORYA 2ANSA 2RD7C 3FW5A 2A13A 5IO6A 3STKA 3CQRA 1A2DA 3NP1A 1U18A 1IW2A 1QG5A 4I9SA 3STMX 2G7BA 4DQ4A 4QZUA 3KZAA 1QY2A 1SY0A 4R0BA 1YP6A 1FELA 5HTDA 1ZNEA 4TLJA 1KQWA 4IB6A 5LJBA 4Y0RA 1BEBA 3CQNA 4ZCBA 3NX1A 4Y0QA 2OFMX 4WBKA 1E00A 1MUPA 1CBSA 2FR2A 2L5PA 3C78X 1AQBA 4BQUA 1N0SA 1O1UA 4LKPA 1LPJA 2RCQA 5D4AA 4I9RA 1ERBA 4YDBA 5HZ9A 1NGLA 1KT7A 1ZRYA 1U0XA 3APWA 1EUOA 1LNMA 4AZPA 4M6SA 2Q9SA 5F7GA 3RZYA 1DF3A 4WFUA 3BSZE 1I4UA 3NR3A 3WJGA 4IMOA 1TXLA 1ZNGA 5HZ5A 1X8NA 3K3LA 4AZMA 1IIUA 2JN3A 4N7DA 4EEJA 2EU7X 1P6PA 1Z24A 1LFOA 2W2AA 4A8ZA 4GKCA 3UEWA 2Q39A 2OFRX 4HPAA 2R73A 3HWFA 4NNTA 2NNEA 4A60A 3PEDA 3BS2A 1EQDA 5D47A 3VG5A 4KIIA 5F6ZA 4IBAA 2QOSC 2FRSA 3GAQA 1G74A 5F58A 1QY1A 4QYNA 3EBKA 3WJEA 5HZ6A 1LIBA 5KICA 1EPBA 4QYPA 2IFBA 1SY1A 3FA8A 4ZR2A 3EBWA 3EYCA 3FENA 4LZVA 2L68A 1AB0A 3APUA 2WR6A 4AZRA 2WQ9A 4PSQA 1A57A 1CBIA 5EEEA 4ZHCA 1AVGI 1G7NA 1HN2A 2P8GA 5B29A 1OEEA 1LF7A 3P6DA 4NP1A 1QQSA 1S7DA 2JU3A 4IAXA 1SA8A 2F73A 1NP1A 2CBRA 4IMNA 2AH7X 2AT3X 5EDCA 1GM6A 3KQ0A 4ORWA 1O1VA 5L8IA 5HCDC 3FR5A 2CM4A 2WSJA 1OPAA 2LKKA 2KT4B 4XMHA 3WJBA 1X8UA 5HA0A 1T68X 2X45A 1ALBA 1CRBA 5LJCA 4TNNA 5HTEA 1YWBA 2GTFX 4NLIA 4TKHA 5HBSA 1GXAA 3TGCA 3PPTA 1EXSA 1YWCA 4M7MA 4QAEA 4ES7A 1JYDA 1MVGA 2OZQA 5F6BA 1S2PA 1JBHA 5H9KA 1SY2A 2FLJA 4YCEA 1AELA 4MVKA 3I17A 2HNXA 2KTDA 3BU1A 4EFGA 4MVIA 2O62A 1SXYA 4ZHFA 1G5WA 4ORUA 3FIQA 5KIDA 1JJXA 2FT9A 1KGLA 3WXQA 5L8NA 3FA7A 3L4RA 3NADA 5JR8A 4YH0A 2ACPX 3PP6A 3D96A 2WWPA 1DZMA 4GE1A 3ZUIA 1DZKA 4AZQA 1HBQA 1I04A 4GETA 4ZHHA 4YFQA 2AKQA 3U0DA 2LBAA 3BU9A 1BSYA 5LJEA 3WJCA 1GT1A 1S44A 1YP7A 1KT4A 4NYQA 1EIOA 1YIVA 4IB8A 2ASNX 1HMRA 2HZRA 2A2UA 4QGWA 1B4MA 5H9NA 3TZSA 4XMGA 4D6BA 4TQ2A 4ODDA 4TKJA 4I3DA 1GT5A 3BLGA 1B8EA 1JYJA 5KHPA 4HFOA 4I3CA 1ERXA 1H91A 3CR6A 2AT0X 1BRPA 1ZNLA 5D48A 5IO5A 3KFGA 4AZNA 4QGVA 3PH5A 1ICMA 5LJHA 3VG3A 3BRNA 1BSOA 3VG2A 3ELXA 5LJKA 4CK4A 1CBQA 1BLRA 1BM5A 4GRJA 3U9PC 2A2GA 5HA1A 1CBRA 2FWVA 4OS3A 5EEDA 3KFFA 4YMYA 2Q2MA 1T8VA 2XKLA 2CBSA 2BLGA 5HWZA 3G7XA 1KT6A 4ORXA 3F8AA 4HPCA 3O19A 4QGXA 5LKEA 2AT6X 2FS6A 1I05A 2MJIA 1BSQA 1KQXA 5BVTA 4TJZA 1CJ5A 2JOZA 1GKAB 2JU7A 2AT8X 3O2YA 1FDQA 3UEUA 1DC9A 1JZUA 1TW4A 4OMWA 5C0NA 1MX8A 1O8VA 1YWAA 2NP1A 1QY0A 4HPBA 3DSZA 4ZHGA 4Y0SA 1T0VA 5HAEA 4YDAA 1SXXA 3AKNA 3BY0A 4OS8A 3HWEA 3CBSA 3FEPA 4YKOA 1ML7A 1G85A 1GX9A 4O9SA 4ORSA 1X89A 3P6CA 5LKFA 1VYFA 2RA6A 1D2UA 2JU8A 2QO5A 3NX2A 4OS0A 1GGLA 1X8QA 4YFPA 2MO5A 1U17A 1KT5A 4IB7A 1NP4A 3BDRA 3B2LA 3QKGA 2FS7A 3D97A 3JS1A 1X71A 1IKJA 1IKEA 1TOUA 4EXZA 2X46A 4XMEA 5H9LA 4IB9A 2E4JA 3IA8A 1KOIA 1E5PA 5B27A 4UU2A 4ZGUA 1FE3A 4YKMA 2L9CA 3EMMA 2LBVA 2ALLX 3BX8A 3P6FA 2WQAE 1JJJA 1XKIA 4RUNA 4Y0PA 4AYHA 1HMTA 3I0AA 2LFOA 3FMZA 3FLLA 3TGBA 3WVMA 1RLBE 1DV9A 1OBQA 1UREA 5IO7A 2A3FX 4YFRA 1OBUA 3HWGA 2NNQA 3P6HA 1EW3A 5K06A 4GNWA 5HZQA 4DQ3A 1KZXA 1D3SA 2R74A 3TF6A 1BBPA 4K19A 5DG4A 4BVMA 5D8JA 3B2HA 4XMFA 3APVA 1PM1X 5L8OA 1GKAA 1ICNA 4YBPA 5F1EA 3AKMA 4UU3A 2GJ5A 4YGGA 1QFVA 1FENA 3PH6A 5D45A 3MBTA 3PECA 3KFHA 3F9DA 3B2IA 3EM0A 2K23A 3OJYC 3APXA 2W2BA 1B56A 2QO4A 5FAZA 2A0AA 4WFVA 2AMMX 5HCEC 1X8PA 1A3YA 4HPDA 3T1DA 2HZQA 4AZOA 2W2FA 3D95A 1VYGA 3WBGA 4LZUA 5LJDA 5CE4A 4NNSA 3FR4A 5EZ2A 3DTQA 2POAA 2OVAA
chains in the Genus database with same CATH superfamily
4QNIA 2LB6A 2OVEA 2WEXA 4RUUA 4YCHA 3RSWA 4CPHB 5FENA 5HCCC 1PBYA 1OEKA 2VFCA 3P02A 1YUPA 3NPOA 3S26A 1BWYA 3FELA 1N4JA 1VWNB 2IZDB 1ZNKA 2WUTA 4YGZA 4ZH6A 4GJSA 4QRLA 2NNDA 3O22A 4YBUA 3WZOA 2RTNB 4GDAA 1SXUA 4O4UA 1HXZA 2DM5A 2HKDA 4QZTA 5AQ6A 5H8TA 1TOWA 2HMBA 2OFBA 2OVSA 2CM9A 2MM3A 4BX6B 1DF8A 1ADLA 4NLJA 3WJFA 5FFHA 4O4SA 1DZJA 3UEXA 2AVIA 3P6EA 1LIDA 3BX7A 2Q2PA 4IAWA 2RTJA 1GX8A 1I06A 3C77X 3FEKA 2RCTA 2GTLM 3HWDA 4ZJ0A 3TGAA 1QFTA 2FTBA 1BRQA 1TVQA 3RDQA 1RAVA 3STNA 3KFIA 3ZW0A 1SWFA 1QABE 1GT3A 4I3BA 3FA6A 4O3XB 4A1HA 2AT5X 1HQPA 4U46A 1EALA 1RBPA 1XCAA 3C76X 3VG6A 2XSTA 4MVLA 1PTSA 1OPBA 1UZ2X 4EDEA 3S5XA 2GC9A 5BVSA 1LIFA 1OBPA 2QM9A 3F6ZB 3CMPA 1X8OA 4U8UN 3MG5A 5BVQA 4A1YA 4ARHA 1IFCA 4MIRA 5HZ8A 3ELZA 5B3MO 3B2JA 2YG2A 4GH7A 2FR3A 1SWDA 4XMDA 1GT4A 3N91A 1VWDB 4ALOA 2HYSA 1QWDA 1SLEB 1LKEA 4WHIA 2L67A 2A5CA 4BOEA 5K67A 1VPRA 1SXWA 2AL0X 2Z4HA 4AW8A 3SAOA 2G79A 1LCZA 4Z6JA 1ZNHA 2QCBA 1LICA 1E06A 2HLVA 4JNJA 1BJ7A 4ML7B 2PY1A 3MVFA 3IFBA 4GUZA 4CPFA 2CZTA 3FR2A 1FEMA 4ALBA 3FA9A 2X56A 1MDCA 4GNYA 1KXOA 2Y32A 5EDBA 3B2KA 3T6FA 3WJDA 3RDMA 1ACDA 2IZCB 1WUBA 3PQUA 4CDFA 2RQ0A 3ZQ3A 2ZAIA 1PBOA 2MF6A 2PI3O 3EC5A 3VGWA 1E02A 3P6GA 1KL5A 3E3CA 1KZWA 3UEVA 4DCBA 2RTRB 4ZFXA 3KVNA 2N93A 1HMSA 1JV4A 4IABA 5AEOA 1DFVA 1MK5A 1VWHB 4OMXA 4CPHA 1NBXA 2GTLO 1VYOA 1L6MA 2A5BA 1A18A 1MX7A 1SMPI 3Q6LA 2RTQB 3NQ3A 1RXHA 2JMBA 2R56A 3VG4A 1KT3A 2ACOA 2RTEB 2Z4IA 5FQ6E 3S5VA 4GGRA 1LDOA 1W4TA 4YGHA 5EPQA 3NQ9A 5IRUA 4BGFA 5H9AA 2X8FA 4QQ1A 1YWDA 3HK1A 2QO6A 4TKBA 3CWKA 5LJGA 1IJ8A 4NYRA 3CBCA 4D6AA 1SREA 1SWJA 2K62A 1R0UA 1NQMA 5CYBA 2Q4NA 1SWQA 5DPQA 4KH8A 3FW4A 2RTOB 2IZAA 2IZGB 1SWHA 2OVDA 1EPAA 1FTPA 2WEWA 3JSQA 4XMCA 5FQ8E 1OEJA 4N7CA 2IZLB 1PEEA 1B0OA 1HBPA 5FQ7E 3ZUOA 2RN4A 1LIEA 4LKTA 3WYQA 4ZHDA 3U03A 4O49A 2G78A 3VHMA 1EIIA 3VG7A 4OEMA 1PMPA 2C4IA 2CZUA 2QOMA 4JHQA 4ORRA 4ZH9A 3SOTA 1DZPA 1IFBA 1MOYA 1SY3A 1ZNDA 2ANSA 2RD7C 3FW5A 2A13A 4ORYA 5IO6A 3STKA 3CQRA 2QMIA 3RE5A 1A2DA 3NP1A 1U18A 5AJBA 1IW2A 1QG5A 4I9SA 3STMX 2G7BA 4DQ4A 1STRB 4QZUA 3KZAA 1QY2A 2X34A 1N9MA 1SY0A 1EI5A 1VWLB 2RTMA 4R0BA 1YP6A 1FELA 5HTDA 1ZNEA 4TLJA 1KQWA 4GU8A 2I5VO 4IB6A 2OY1O 3WOVA 5LJBA 4Y0RA 1BEBA 3CQNA 3RE6A 2MHDA 5BYPA 3RWXA 4ZCBA 3NX1A 1SWKA 1UYOX 2KTSA 1E00A 2OFMX 4WBKA 4Y0QA 1MUPA 2BS6A 1CBSA 2FR2A 2L5PA 3C78X 1AQBA 4HWMA 3AUMO 4BQUA 1VWKB 1HXLA 1N0SA 1O1UA 4L1NA 1LPJA 2RCQA 4LKPA 5D4AA 4I9RA 1ERBA 4YDBA 5HZ9A 2C1QA 1NGLA 1KT7A 1ZRYA 1U0XA 2IZIA 3APWA 1EUOA 3HTYA 1LNMA 2FHNX 3PK2A 4AZPA 4M6SA 2Q9SA 5F7GA 3RZYA 5IXGA 1DF3A 1NQNA 4WFUA 3BSZE 1I4UA 3NR3A 3WJGA 1SLGB 4IMOA 4FBVA 1TXLA 1ZNGA 5HZ5A 1X8NA 3K3LA 1JMXA 4GK9A 4OKAA 4AZMA 1IIUA 1SWCA 2JN3A 4N7DA 4EEJA 2EU7X 1P6PA 3WZQA 1SWEA 1RXKA 1Z24A 1LFOA 1RSTB 2W2AA 4A8ZA 2RTLA 2LA7A 4GKCA 3GE2A 5B2AO 3RY2A 3UEWA 2Q39A 2OFRX 4HPAA 2R73A 1VWMB 3HWFA 4NNTA 4B55A 1SWBA 4KT5A 2NNEA 4L3RA 4A60A 3ZW1A 3PEDA 3BS2A 1EQDA 5D47A 3VG5A 3WYPA 1STSB 2UZ2A 4KIIA 5B10O 1NDJA 3T2XA 4GZVA 5F6ZA 4IBAA 2QOSC 2G8CO 4LQZA 2FHLA 1Y9LA 2FRSA 3GAQA 1G74A 4O3WA 1QY1A 5F58A 4QYNA 3EBKA 2BS5A 2RTKA 3FYFA 3WJEA 1LIBA 4CSBA 5HZ6A 4EQAC 5KICA 1EPBA 4QYPA 3T2WA 2RTAA 4U8UM 2IFBA 1SY1A 3FA8A 4I6SA 4ZR2A 3S60A 4CDDA 2IZKA 3EBWA 3EYCA 3FENA 4LZVA 4BCSA 1SRGA 2L68A 2X32A 1AB0A 3APUA 2WR6A 5IRAA 1I9HA 3SLTA 4AZRA 2WQ9A 4PSQA 2OF9A 1CBIA 4GGZA 5EEEA 1A57A 4ZHCA 1AVGI 1G7NA 2Y3EA 3PDFA 1VWCB 1VWGB 3QQ2A 1HN2A 2IZEB 2P8GA 3RDXA 3VHHA 5B29A 5L3YA 1OEEA 1LF7A 3P6DA 4NP1A 4OELA 1QQSA 1S7DA 2JU3A 3D9WA 1SA8A 2F73A 1NP1A 2CBRA 2FKGA 4IAXA 4IMNA 2AT3X 2AH7X 5EDCA 3SZHA 1GM6A 3KQ0A 4ORWA 1O1VA 5L8IA 4DNEA 3RDOA 5HCDC 3FR5A 2CM4A 2WSJA 1OPAA 2LKKA 2KT4B 4XMHA 3P24A 3WJBA 1X8UA 4GJVA 4BX5B 5HA0A 1T68X 2X45A 5K68A 1ALBA 1CRBA 5LJCA 1SRJA 4TNNA 5HTEA 1YWBA 2OFAA 2GTFX 2RTPB 4BX6A 4CPIA 4CDEA 4NLIA 4TKHA 5HBSA 3CKFA 1GXAA 3TGCA 1K3BA 3PPTA 4O4OA 4ID2A 1EXSA 2OL8O 2RTIB 3ZW2A 2AF5A 4FBOA 3ZZVA 4MVEA 1YWCA 4M7MA 4QAEA 2JGSA 4ES7A 1JYDA 1MVGA 2OZQA 5F6BA 1S2PA 1SLDB 5H9KA 1JBHA 1SY2A 2FLJA 4YCEA 3SLJA 1HY2A 1AELA 4MVKA 1SWPA 3I17A 2HNXA 2KTDA 4NW4A 2BSZA 3HPEA 3H3IA 3BU1A 4EFGA 4MVIA 4U8UO 2O62A 1SXYA 4ZHFA 1G5WA 1SWAA 2ZAGA 3FIQA 1K24A 4ORUA 2OY7A 2X55A 1E2TA 4NV8A 5KIDA 1WBIA 2BHVA 2FT9A 3WXQA 1MM9A 1JJXA 1JJUA 2WPUA 5L8NA 1NC9A 3FA7A 3L4RA 2DJFA 3NADA 4YH0A 5JR8A 1LCVA 1GX3A 2ACPX 3PP6A 3D96A 4I95A 2WWPA 1DZMA 3NQKA 2G5LA 4GE1A 1DZKA 1STPA 3ZUIA 2UYWA 4CV7A 4AZQA 1HBQA 1I04A 4GETA 4KC7A 4ZHHA 1HQQA 1Y53X 4O4XA 3OE3A 4YFQA 5AJCA 2OYBO 1SWTA 2AKQA 2OL6O 4I60A 1VWEB 3U0DA 2LBAA 3BU9A 1BSYA 2BT9A 3D4RA 3WJCA 1SLFB 5LJEA 1VWRB 4Z27A 3SZIA 1GT1A 4AYHA 2RTCB 3ZI8A 1S44A 1YP7A 1KT4A 4NYQA 4FBRA 1YIVA 3HOEA 4EKVA 4IB8A 1EIOA 2ASNX 1HMRA 2HZRA 2A2UA 4QGWA 1B4MA 1N9YA 4ON1A 2CAMA 5H9NA 3TZSA 4XMGA 4D6BA 4TQ2A 4ODDA 4TKJA 4I3DA 1GT5A 3OBLA 3BLGA 1KFFA 1B8EA 1JYJA 5KHPA 4HFOA 3MX7A 4I3CA 1ERXA 3WZPA 5B5GA 1H91A 3CR6A 2AT0X 1N43A 1BRPA 1KL3A 1ZNLA 5D48A 3T6LA 3KFGA 5IO5A 4AZNA 1LDQA 4QGVA 3PH5A 2KD2A 1LCWA 1ICMA 5LJHA 1SWNA 3CKGA 3VG3A 3BRNA 4COTA 1BSOA 2FGSA 3ELXA 3VG2A 5LJKA 2GTLN 4CK4A 1CBQA 1W5RA 3OD9A 4PJ2A 4CPEA 1BLRA 1BM5A 4GRJA 3U9PC 2I5ZO 2A2GA 4YVBA 4JO6A 1CBRA 5HA1A 2RTHB 2FWVA 4OS3A 5EEDA 3KFFA 4YMYA 1SWLA 1VWFB 2Q2MA 3SZJA 1T8VA 2XKLA 2CBSA 3EW1A 2BLGA 4KC8A 3G7XA 1KT6A 3Q34A 4ORXA 3F8AA 3RY1A 3ZWEA 5HWZA 4HPCA 3O19A 4QGXA 5LKEA 2FKJA 2AT6X 2FS6A 1I05A 2MJIA 1BSQA 1KQXA 5BVTA 1AVEA 4TJZA 1CJ5A 1Y0GA 2JOZA 3VHIA 1VWBB 4Y5DA 1GKAB 2JU7A 2AT8X 3O2YA 1FDQA 2YMSA 4KCAA 1DC9A 3UEUA 1TW4A 4Z2OA 1JZUA 2DJGA 4OMWA 1Y52X 1SRFA 1MX8A 5C0NA 4BX7B 1O8VA 1YWAA 2NP1A 3AEHA 4NV7A 1QY0A 1VWIB 3DSZA 4HPBA 5B5FA 5F2BA 4ZHGA 4Y0SA 1T0VA 3VE1A 2VDFA 3EW2A 4O3ZA 4YDAA 1Y9TA 5HAEA 1SXXA 3AKNA 2F01A 3BY0A 4OS8A 1Y55X 3CBSA 3FEPA 3HWEA 3MM0A 1ML7A 4YKOA 1G85A 1GX9A 4O9SA 4ORSA 2RTFB 3LHNA 3LV4A 1X89A 4INNA 5CHKA 1VWAB 4FGIB 3P6CA 5B11O 1VYFA 2RA6A 5LKFA 1JMZA 3FIDA 1D2UA 1VWQB 2JU8A 4FQBB 2GH7A 2QO5A 2RTBB 3NX2A 4OS0A 1GGLA 1X8QA 1LELA 2IZJA 2MO5A 4U9CA 1SWOA 4YFPA 1U17A 4BJ8A 1KT5A 2IZFB 1NP4A 3BDRA 1RXJA 3B2LA 1W6FA 3QKGA 2FS7A 4IB7A 3D97A 3JS1A 1JIWI 1SWGA 4CDCA 5JD2A 4MEEA 1X71A 4Z2PA 2IZHB 1IKJA 1IKEA 1TOUA 3UAQA 4EXZA 2X46A 4GD9A 3VPJE 2X4MA 3WZNA 2JW1A 3NBXX 1FJ1E 4XMEA 4Z2VA 5H9LA 1RSUB 4IB9A 2E4JA 4C5PA 1MEPA 2Y3FA 3IA8A 1KOIA 1VWJB 3VE2A 1E5PA 5B27A 4UU2A 3RDSA 4ZGUA 2X8SA 1FE3A 1N7YA 1VWPB 2L9CA 4U3QA 4YKMA 3EMMA 3RDUA 3VU1A 2RTGB 2LBVA 2ALLX 3BX8A 3P6FA 1I78A 2WQAE 1JJJA 1XKIA 4RUNA 4Y0PA 1KL4A 1HMTA 3I0AA 2LFOA 3FMZA 3JQOA 3LTWA 3RBYA 4JGLA 3FLLA 2M4LA 3ZW0B 2OY5O 3TGBA 3WVMA 1RLBE 3RKGA 1DV9A 1OBQA 1UREA 2MWHA 2OF8A 5IO7A 4BBOA 1OSPO 2A3FX 4YFRA 1OBUA 2BC3A 3FDCA 3HWGA 2X8TA 2NNQA 3P6HA 3ZW1B 1EW3A 5K06A 2A8GA 4MISA 4GNWA 5HZQA 4DQ3A 1KZXA 1D3SA 4GGTA 2R74A 4Z28A 1BBPA 3TF6A 2ZSCA 1UYNX 2VFBA 1VWOB 4K19A 5DG4A 4BVMA 5D8JA 3B2HA 4XMFA 1KGLA 3APVA 4GDZA 1PM1X 1SWUA 1GKAA 3X00A 1ICNA 4YBPA 5L8OA 2KW1A 3PQSA 5F1EA 4O3YA 2IZBA 3AKMA 4UU3A 2GJ5A 4YGGA 1QFVA 1FENA 3PH6A 2F09A 3MBTA 5D45A 4BX7A 3PECA 3KFHA 1JQPA 3F9DA 3B2IA 3EM0A 4ZGFA 2K23A 3OJYC 2C1SA 3APXA 3SLOA 3V8UA 2W2BA 3HOLA 1B56A 1SWSA 2QO4A 5FAZA 1SRIA 2A0AA 4WFVA 2AMMX 5HCEC 1X8PA 1A3YA 4HPDA 3T1DA 2HZQA 2OL7A 1SWRA 4Y59A 4AZOA 5IRWA 2W2FA 3D95A 1VYGA 1LUQA 1AVDA 3WBGA 5CSEA 1SRHA 4LZUA 2RTDB 5LJDA 4IRWA 5CE4A 4NNSA 3FR4A 5EZ2A 3DTQA 2OY8A 4BX5A 2POAA 2OVAA
chains in the Genus database with same CATH topology
4QNIA 2LB6A 2OVEA 2WEXA 4RUUA 4YCHA 3RSWA 5FENA 5HCCC 1OEKA 3P02A 1YUPA 3NPOA 3S26A 1BWYA 3FELA 4YGZA 1ZNKA 2WUTA 4ZH6A 4QRLA 2NNDA 3O22A 4YBUA 4O4UA 4QZTA 1SXUA 5AQ6A 2DM5A 5H8TA 1TOWA 2HMBA 2OVSA 2CM9A 2MM3A 1ADLA 4NLJA 3WJFA 5FFHA 4O4SA 1DZJA 3UEXA 3P6EA 1LIDA 3BX7A 2Q2PA 4IAWA 1GX8A 1I06A 3C77X 3FEKA 2RCTA 2GTLM 3HWDA 4ZJ0A 3TGAA 1QFTA 2FTBA 1BRQA 1TVQA 3STNA 3KFIA 3ZW0A 1QABE 1GT3A 4I3BA 3FA6A 4O3XB 4A1HA 2AT5X 1HQPA 1EALA 1RBPA 1XCAA 3C76X 3VG6A 2XSTA 4MVLA 1OPBA 1UZ2X 4EDEA 3S5XA 2GC9A 5BVSA 1LIFA 1OBPA 2QM9A 3F6ZB 3CMPA 1X8OA 4U8UN 5BVQA 4A1YA 4ARHA 1IFCA 4MIRA 5HZ8A 3ELZA 3B2JA 2YG2A 4GH7A 2FR3A 4XMDA 1GT4A 3N91A 4ALOA 2HYSA 1QWDA 4WHIA 1LKEA 2L67A 4BOEA 1VPRA 1SXWA 2AL0X 2Z4HA 4AW8A 3SAOA 2G79A 1ZNHA 1LICA 1E06A 2HLVA 1BJ7A 4ML7B 2PY1A 3MVFA 3IFBA 2CZTA 3FR2A 1FEMA 4ALBA 3FA9A 1MDCA 4GNYA 1KXOA 5EDBA 3B2KA 3WJDA 1ACDA 3PQUA 2RQ0A 3ZQ3A 2ZAIA 1PBOA 1E02A 3P6GA 3E3CA 1KZWA 3UEVA 4ZFXA 2N93A 1HMSA 1JV4A 4IABA 5AEOA 1DFVA 4OMXA 2GTLO 1L6MA 1A18A 1MX7A 1SMPI 3Q6LA 3NQ3A 2JMBA 2R56A 3VG4A 1KT3A 2ACOA 2Z4IA 5FQ6E 3S5VA 4YGHA 5EPQA 3NQ9A 5H9AA 2X8FA 4QQ1A 1YWDA 3HK1A 2QO6A 4TKBA 3CWKA 5LJGA 4NYRA 3CBCA 4D6AA 2K62A 1R0UA 5CYBA 2Q4NA 5DPQA 4KH8A 3FW4A 4XMCA 2OVDA 1EPAA 1FTPA 2WEWA 3JSQA 5FQ8E 1OEJA 4N7CA 1PEEA 1B0OA 1HBPA 5FQ7E 3ZUOA 2RN4A 1LIEA 4LKTA 4ZHDA 3U03A 4O49A 2G78A 1EIIA 3VG7A 1PMPA 2CZUA 4ORRA 4ZH9A 3SOTA 1DZPA 1IFBA 1SY3A 1ZNDA 4ORYA 2ANSA 2RD7C 3FW5A 2A13A 5IO6A 3STKA 3CQRA 2QMIA 1A2DA 3NP1A 1U18A 5AJBA 1IW2A 1QG5A 4I9SA 3STMX 2G7BA 4DQ4A 4QZUA 3KZAA 1QY2A 1SY0A 1EI5A 4R0BA 1YP6A 1FELA 5HTDA 1ZNEA 4TLJA 1KQWA 4GU8A 4IB6A 3WOVA 5LJBA 4Y0RA 1BEBA 3CQNA 2MHDA 5BYPA 3RWXA 4ZCBA 3NX1A 2KTSA 2OFMX 4WBKA 1E00A 4Y0QA 1MUPA 2BS6A 1CBSA 2FR2A 2L5PA 3C78X 1AQBA 4HWMA 4BQUA 1N0SA 1O1UA 4L1NA 1LPJA 2RCQA 4LKPA 5D4AA 4I9RA 1ERBA 4YDBA 5HZ9A 3HTYA 1NGLA 1KT7A 1ZRYA 1U0XA 3APWA 1EUOA 1LNMA 4AZPA 4M6SA 2Q9SA 5F7GA 3RZYA 1DF3A 4WFUA 3BSZE 1I4UA 3NR3A 3WJGA 4IMOA 4FBVA 1TXLA 1ZNGA 5HZ5A 1X8NA 3K3LA 4GK9A 4AZMA 1IIUA 2JN3A 4N7DA 4EEJA 2EU7X 1P6PA 1Z24A 1LFOA 2W2AA 4A8ZA 2LA7A 4GKCA 3GE2A 3UEWA 2Q39A 2OFRX 4HPAA 2R73A 3HWFA 4NNTA 4KT5A 2NNEA 4L3RA 4A60A 3ZW1A 3PEDA 3BS2A 1EQDA 5D47A 3VG5A 4KIIA 4GZVA 5F6ZA 4IBAA 2QOSC 4LQZA 1Y9LA 2FRSA 3GAQA 1G74A 4O3WA 1QY1A 5F58A 4QYNA 3EBKA 2BS5A 4CSBA 3FYFA 3WJEA 1LIBA 5HZ6A 4EQAC 5KICA 1EPBA 4QYPA 4U8UM 2IFBA 1SY1A 3FA8A 4I6SA 4ZR2A 3S60A 3EBWA 3EYCA 3FENA 4LZVA 2L68A 1AB0A 3APUA 2WR6A 4AZRA 2WQ9A 4PSQA 1A57A 1CBIA 5EEEA 4ZHCA 1AVGI 1G7NA 1HN2A 2P8GA 5B29A 1OEEA 1LF7A 3P6DA 4NP1A 1QQSA 1S7DA 2JU3A 4IAXA 1SA8A 2F73A 1NP1A 2CBRA 4IMNA 2AH7X 2AT3X 5EDCA 1GM6A 3KQ0A 4ORWA 1O1VA 5L8IA 5HCDC 3FR5A 2CM4A 2WSJA 1OPAA 2LKKA 2KT4B 4XMHA 3P24A 3WJBA 1X8UA 5HA0A 1T68X 2X45A 1ALBA 1CRBA 5LJCA 4TNNA 5HTEA 1YWBA 2GTFX 4NLIA 4TKHA 5HBSA 1GXAA 3TGCA 3PPTA 4O4OA 4ID2A 1EXSA 3ZW2A 4FBOA 3ZZVA 4MVEA 1YWCA 4M7MA 4QAEA 4ES7A 1JYDA 1MVGA 2OZQA 5F6BA 1S2PA 1JBHA 5H9KA 1SY2A 2FLJA 4YCEA 1AELA 4MVKA 3I17A 2HNXA 2KTDA 4NW4A 3H3IA 3BU1A 4EFGA 4MVIA 4U8UO 2O62A 1SXYA 4ZHFA 1G5WA 2ZAGA 3FIQA 4ORUA 5KIDA 1JJXA 2FT9A 2BHVA 3WXQA 1KGLA 5L8NA 3FA7A 3L4RA 3NADA 5JR8A 4YH0A 2ACPX 3PP6A 3D96A 4I95A 2WWPA 1DZMA 3NQKA 4GE1A 3ZUIA 1DZKA 4CV7A 4AZQA 1HBQA 1I04A 4GETA 4KC7A 4ZHHA 4O4XA 3OE3A 4YFQA 5AJCA 2AKQA 3U0DA 2LBAA 3BU9A 1BSYA 2BT9A 3D4RA 3WJCA 5LJEA 1GT1A 3ZI8A 1S44A 1YP7A 1KT4A 4NYQA 4FBRA 1YIVA 3HOEA 1EIOA 4IB8A 2ASNX 1HMRA 2HZRA 2A2UA 4QGWA 1B4MA 4ON1A 5H9NA 3TZSA 4XMGA 4D6BA 4TQ2A 4ODDA 4TKJA 4I3DA 1GT5A 3OBLA 3BLGA 1B8EA 1JYJA 5KHPA 4HFOA 3MX7A 4I3CA 1ERXA 1H91A 3CR6A 2AT0X 1BRPA 1ZNLA 5D48A 5IO5A 3KFGA 4AZNA 4QGVA 3PH5A 2KD2A 1ICMA 5LJHA 3VG3A 3BRNA 4COTA 1BSOA 3VG2A 3ELXA 5LJKA 2GTLN 4CK4A 1CBQA 3OD9A 4PJ2A 1BLRA 1BM5A 4GRJA 3U9PC 2A2GA 5HA1A 1CBRA 2FWVA 4OS3A 5EEDA 3KFFA 4YMYA 2Q2MA 1T8VA 2XKLA 2CBSA 2BLGA 4KC8A 3G7XA 1KT6A 4ORXA 3ZWEA 3F8AA 5HWZA 4HPCA 3O19A 4QGXA 5LKEA 2AT6X 2FS6A 1I05A 2MJIA 1BSQA 1KQXA 5BVTA 4TJZA 1CJ5A 2JOZA 1GKAB 2JU7A 2AT8X 3O2YA 1FDQA 2YMSA 4KCAA 1DC9A 3UEUA 1TW4A 1JZUA 4OMWA 5C0NA 1MX8A 1O8VA 1YWAA 2NP1A 1QY0A 4HPBA 3DSZA 4ZHGA 4Y0SA 1T0VA 3VE1A 4O3ZA 4YDAA 1Y9TA 5HAEA 1SXXA 3AKNA 3BY0A 4OS8A 3HWEA 3CBSA 3FEPA 4YKOA 1ML7A 1G85A 1GX9A 4O9SA 4ORSA 3LHNA 3LV4A 1X89A 4INNA 4FGIB 3P6CA 5LKFA 1VYFA 2RA6A 1D2UA 2JU8A 4FQBB 2QO5A 3NX2A 4OS0A 1GGLA 1X8QA 4U9CA 2MO5A 4YFPA 1U17A 1KT5A 4IB7A 1NP4A 3BDRA 3B2LA 3QKGA 2FS7A 3D97A 3JS1A 1JIWI 1X71A 1IKJA 1IKEA 1TOUA 3UAQA 4EXZA 2X46A 3VPJE 2JW1A 3NBXX 4XMEA 5H9LA 4IB9A 2E4JA 3IA8A 3VE2A 1KOIA 1E5PA 5B27A 4UU2A 4ZGUA 2X8SA 1FE3A 4U3QA 4YKMA 2L9CA 3EMMA 3VU1A 2LBVA 2ALLX 3BX8A 3P6FA 2WQAE 1JJJA 1XKIA 4RUNA 4Y0PA 4AYHA 1HMTA 3I0AA 2LFOA 3FMZA 3JQOA 3RBYA 4JGLA 3FLLA 2M4LA 3ZW0B 3TGBA 3WVMA 1RLBE 3RKGA 1DV9A 1OBQA 1UREA 2MWHA 5IO7A 2A3FX 4YFRA 1OBUA 3HWGA 2X8TA 2NNQA 3P6HA 3ZW1B 1EW3A 5K06A 4MISA 4GNWA 5HZQA 4DQ3A 1KZXA 1D3SA 2R74A 3TF6A 1BBPA 4K19A 5DG4A 4BVMA 5D8JA 3B2HA 4XMFA 3APVA 4GDZA 1PM1X 5L8OA 1GKAA 1ICNA 4YBPA 2KW1A 3PQSA 5F1EA 4O3YA 3AKMA 4UU3A 2GJ5A 4YGGA 1QFVA 1FENA 3PH6A 2F09A 3MBTA 5D45A 3PECA 3KFHA 3F9DA 3B2IA 3EM0A 4ZGFA 2K23A 3OJYC 3APXA 3V8UA 2W2BA 3HOLA 1B56A 2QO4A 5FAZA 2A0AA 4WFVA 2AMMX 5HCEC 1X8PA 1A3YA 4HPDA 3T1DA 2HZQA 4AZOA 2W2FA 3D95A 1VYGA 3WBGA 4LZUA 5LJDA 5CE4A 4NNSA 3FR4A 5EZ2A 3DTQA 2POAA 2OVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LB6 A;  2OVE A;  2WEX A;  4RUU A;  4YCH A;  3RSW A;  5FEN A;  5HCC C;  1OEK A;  3S26 A;  1YUP A;  3NPO A;  1BWY A;  3FEL A;  4YGZ A;  1ZNK A;  2WUT A;  4ZH6 A;  2NND A;  3O22 A;  4YBU A;  5AQ6 A;  4QZT A;  1SXU A;  2DM5 A;  5H8T A;  1TOW A;  2HMB A;  2CM9 A;  2MM3 A;  1ADL A;  4NLJ A;  3WJF A;  5FFH A;  1DZJ A;  3UEX A;  3P6E A;  1LID A;  3BX7 A;  2Q2P A;  4IAW A;  1GX8 A;  1I06 A;  3C77 X;  3FEK A;  2RCT A;  3HWD A;  4ZJ0 A;  3TGA A;  1QFT A;  2FTB A;  1BRQ A;  1TVQ A;  3STN A;  3KFI A;  1QAB E;  1GT3 A;  4I3B A;  3FA6 A;  4A1H A;  2AT5 X;  1HQP A;  1EAL A;  1RBP A;  1XCA A;  3C76 X;  3VG6 A;  2XST A;  4MVL A;  1OPB A;  1UZ2 X;  4EDE A;  2GC9 A;  5BVS A;  1LIF A;  1OBP A;  2QM9 A;  3CMP A;  1X8O A;  5BVQ A;  4A1Y A;  4ARH A;  1IFC A;  5HZ8 A;  3ELZ A;  3B2J A;  2YG2 A;  4GH7 A;  2FR3 A;  4XMD A;  1GT4 A;  4ALO A;  2HYS A;  1QWD A;  1LKE A;  2L67 A;  4BOE A;  1VPR A;  1SXW A;  2AL0 X;  4AW8 A;  3SAO A;  2G79 A;  1ZNH A;  1LIC A;  1E06 A;  2HLV A;  1BJ7 A;  2PY1 A;  3MVF A;  3IFB A;  2CZT A;  3FR2 A;  1FEM A;  4ALB A;  3FA9 A;  1MDC A;  4GNY A;  1KXO A;  5EDB A;  3B2K A;  3WJD A;  1ACD A;  2RQ0 A;  3ZQ3 A;  1PBO A;  1E02 A;  3P6G A;  1KZW A;  3UEV A;  4ZFX A;  2N93 A;  1HMS A;  1JV4 A;  1DFV A;  4OMX A;  1L6M A;  1A18 A;  1MX7 A;  3Q6L A;  3NQ3 A;  3VG4 A;  2R56 A;  1KT3 A;  2ACO A;  4YGH A;  5EPQ A;  3NQ9 A;  5H9A A;  1YWD A;  3HK1 A;  2QO6 A;  4TKB A;  3CWK A;  5LJG A;  4NYR A;  3CBC A;  4D6A A;  2K62 A;  1R0U A;  2Q4N A;  5DPQ A;  3FW4 A;  4XMC A;  2OVD A;  2WEW A;  1EPA A;  1FTP A;  3JSQ A;  1OEJ A;  4N7C A;  1PEE A;  1B0O A;  1HBP A;  3ZUO A;  4LKT A;  1LIE A;  4ZHD A;  3U03 A;  1EII A;  2G78 A;  3VG7 A;  1PMP A;  2CZU A;  4ORR A;  4ZH9 A;  1DZP A;  1IFB A;  1SY3 A;  1ZND A;  4ORY A;  2ANS A;  2RD7 C;  3FW5 A;  2A13 A;  5IO6 A;  3STK A;  3CQR A;  1A2D A;  3NP1 A;  1U18 A;  1IW2 A;  1QG5 A;  4I9S A;  3STM X;  2G7B A;  4DQ4 A;  4QZU A;  3KZA A;  1QY2 A;  1SY0 A;  4R0B A;  1YP6 A;  1FEL A;  5HTD A;  1ZNE A;  4TLJ A;  1KQW A;  4IB6 A;  5LJB A;  4Y0R A;  1BEB A;  3CQN A;  4ZCB A;  3NX1 A;  4Y0Q A;  2OFM X;  4WBK A;  1E00 A;  1MUP A;  1CBS A;  2FR2 A;  2L5P A;  3C78 X;  1AQB A;  4BQU A;  1N0S A;  1O1U A;  4LKP A;  1LPJ A;  2RCQ A;  5D4A A;  4I9R A;  1ERB A;  4YDB A;  5HZ9 A;  1NGL A;  1KT7 A;  1ZRY A;  1U0X A;  3APW A;  1EUO A;  1LNM A;  4AZP A;  4M6S A;  2Q9S A;  5F7G A;  3RZY A;  1DF3 A;  4WFU A;  3BSZ E;  1I4U A;  3NR3 A;  3WJG A;  4IMO A;  1TXL A;  1ZNG A;  5HZ5 A;  1X8N A;  3K3L A;  4AZM A;  1IIU A;  2JN3 A;  4N7D A;  4EEJ A;  2EU7 X;  1P6P A;  1Z24 A;  1LFO A;  2W2A A;  4A8Z A;  4GKC A;  3UEW A;  2Q39 A;  2OFR X;  4HPA A;  2R73 A;  3HWF A;  4NNT A;  2NNE A;  4A60 A;  3PED A;  3BS2 A;  1EQD A;  5D47 A;  3VG5 A;  4KII A;  5F6Z A;  4IBA A;  2QOS C;  2FRS A;  3GAQ A;  1G74 A;  5F58 A;  1QY1 A;  4QYN A;  3EBK A;  3WJE A;  5HZ6 A;  1LIB A;  5KIC A;  1EPB A;  4QYP A;  2IFB A;  1SY1 A;  3FA8 A;  4ZR2 A;  3EBW A;  3EYC A;  3FEN A;  4LZV A;  2L68 A;  1AB0 A;  3APU A;  2WR6 A;  4AZR A;  2WQ9 A;  4PSQ A;  1A57 A;  1CBI A;  5EEE A;  4ZHC A;  1AVG I;  1G7N A;  1HN2 A;  2P8G A;  5B29 A;  1OEE A;  1LF7 A;  3P6D A;  4NP1 A;  1QQS A;  1S7D A;  2JU3 A;  4IAX A;  1SA8 A;  2F73 A;  1NP1 A;  2CBR A;  4IMN A;  2AH7 X;  2AT3 X;  5EDC A;  1GM6 A;  3KQ0 A;  4ORW A;  1O1V A;  5L8I A;  5HCD C;  3FR5 A;  2CM4 A;  2WSJ A;  1OPA A;  2LKK A;  2KT4 B;  4XMH A;  3WJB A;  1X8U A;  5HA0 A;  1T68 X;  2X45 A;  1ALB A;  1CRB A;  5LJC A;  4TNN A;  5HTE A;  1YWB A;  2GTF X;  4NLI A;  4TKH A;  5HBS A;  1GXA A;  3TGC A;  3PPT A;  1EXS A;  1YWC A;  4M7M A;  4QAE A;  4ES7 A;  1JYD A;  1MVG A;  2OZQ A;  5F6B A;  1S2P A;  1JBH A;  5H9K A;  1SY2 A;  2FLJ A;  4YCE A;  1AEL A;  4MVK A;  3I17 A;  2HNX A;  2KTD A;  3BU1 A;  4EFG A;  4MVI A;  2O62 A;  1SXY A;  4ZHF A;  1G5W A;  4ORU A;  3FIQ A;  5KID A;  1JJX A;  2FT9 A;  1KGL A;  3WXQ A;  5L8N A;  3FA7 A;  3L4R A;  3NAD A;  5JR8 A;  4YH0 A;  2ACP X;  3PP6 A;  3D96 A;  2WWP A;  1DZM A;  4GE1 A;  3ZUI A;  1DZK A;  4AZQ A;  1HBQ A;  1I04 A;  4GET A;  4ZHH A;  4YFQ A;  2AKQ A;  3U0D A;  2LBA A;  3BU9 A;  1BSY A;  5LJE A;  3WJC A;  1GT1 A;  1S44 A;  1YP7 A;  1KT4 A;  4NYQ A;  1EIO A;  1YIV A;  4IB8 A;  2ASN X;  1HMR A;  2HZR A;  2A2U A;  4QGW A;  1B4M A;  5H9N A;  3TZS A;  4XMG A;  4D6B A;  4TQ2 A;  4ODD A;  4TKJ A;  4I3D A;  1GT5 A;  3BLG A;  1B8E A;  1JYJ A;  5KHP A;  4HFO A;  4I3C A;  1ERX A;  1H91 A;  3CR6 A;  2AT0 X;  1BRP A;  1ZNL A;  5D48 A;  5IO5 A;  3KFG A;  4AZN A;  4QGV A;  3PH5 A;  1ICM A;  5LJH A;  3VG3 A;  3BRN A;  1BSO A;  3VG2 A;  3ELX A;  5LJK A;  4CK4 A;  1CBQ A;  1BLR A;  1BM5 A;  4GRJ A;  3U9P C;  2A2G A;  5HA1 A;  1CBR A;  2FWV A;  4OS3 A;  5EED A;  3KFF A;  4YMY A;  2Q2M A;  1T8V A;  2XKL A;  2CBS A;  2BLG A;  5HWZ A;  3G7X A;  1KT6 A;  4ORX A;  3F8A A;  4HPC A;  3O19 A;  4QGX A;  5LKE A;  2AT6 X;  2FS6 A;  1I05 A;  2MJI A;  1BSQ A;  1KQX A;  5BVT A;  4TJZ A;  1CJ5 A;  2JOZ A;  1GKA B;  2JU7 A;  2AT8 X;  3O2Y A;  1FDQ A;  3UEU A;  1DC9 A;  1JZU A;  1TW4 A;  4OMW A;  5C0N A;  1MX8 A;  1O8V A;  1YWA A;  2NP1 A;  1QY0 A;  4HPB A;  3DSZ A;  4ZHG A;  4Y0S A;  1T0V A;  5HAE A;  4YDA A;  1SXX A;  3AKN A;  3BY0 A;  4OS8 A;  3HWE A;  3CBS A;  3FEP A;  4YKO A;  1ML7 A;  1G85 A;  1GX9 A;  4O9S A;  4ORS A;  1X89 A;  3P6C A;  5LKF A;  1VYF A;  2RA6 A;  1D2U A;  2JU8 A;  2QO5 A;  3NX2 A;  4OS0 A;  1GGL A;  1X8Q A;  4YFP A;  2MO5 A;  1U17 A;  1KT5 A;  4IB7 A;  1NP4 A;  3BDR A;  3B2L A;  3QKG A;  2FS7 A;  3D97 A;  3JS1 A;  1X71 A;  1IKJ A;  1IKE A;  1TOU A;  4EXZ A;  2X46 A;  4XME A;  5H9L A;  4IB9 A;  2E4J A;  3IA8 A;  1KOI A;  1E5P A;  5B27 A;  4UU2 A;  4ZGU A;  1FE3 A;  4YKM A;  2L9C A;  3EMM A;  2LBV A;  2ALL X;  3BX8 A;  3P6F A;  2WQA E;  1JJJ A;  1XKI A;  4RUN A;  4Y0P A;  4AYH A;  1HMT A;  3I0A A;  2LFO A;  3FMZ A;  3FLL A;  3TGB A;  3WVM A;  1RLB E;  1DV9 A;  1OBQ A;  1URE A;  5IO7 A;  2A3F X;  4YFR A;  1OBU A;  3HWG A;  2NNQ A;  3P6H A;  1EW3 A;  5K06 A;  4GNW A;  5HZQ A;  4DQ3 A;  1KZX A;  1D3S A;  2R74 A;  3TF6 A;  1BBP A;  4K19 A;  5DG4 A;  4BVM A;  5D8J A;  3B2H A;  4XMF A;  3APV A;  1PM1 X;  5L8O A;  1GKA A;  1ICN A;  4YBP A;  5F1E A;  3AKM A;  4UU3 A;  2GJ5 A;  4YGG A;  1QFV A;  1FEN A;  3PH6 A;  5D45 A;  3MBT A;  3PEC A;  3KFH A;  3F9D A;  3B2I A;  3EM0 A;  2K23 A;  3OJY C;  3APX A;  2W2B A;  1B56 A;  2QO4 A;  5FAZ A;  2A0A A;  4WFV A;  2AMM X;  5HCE C;  1X8P A;  1A3Y A;  4HPD A;  3T1D A;  2HZQ A;  4AZO A;  2W2F A;  3D95 A;  1VYG A;  3WBG A;  4LZU A;  5LJD A;  5CE4 A;  4NNS A;  3FR4 A;  5EZ2 A;  3DTQ A;  2POA A;  2OVA A; 
#chains in the Genus database with same CATH topology
 4QNI A;  2LB6 A;  2OVE A;  2WEX A;  4RUU A;  4YCH A;  3RSW A;  4CPH B;  5FEN A;  5HCC C;  1PBY A;  1OEK A;  2VFC A;  3P02 A;  1YUP A;  3NPO A;  3S26 A;  1BWY A;  3FEL A;  1N4J A;  1VWN B;  2IZD B;  1ZNK A;  2WUT A;  4YGZ A;  4ZH6 A;  4GJS A;  4QRL A;  2NND A;  3O22 A;  4YBU A;  3WZO A;  2RTN B;  4GDA A;  1SXU A;  4O4U A;  1HXZ A;  2DM5 A;  2HKD A;  4QZT A;  5AQ6 A;  5H8T A;  1TOW A;  2HMB A;  2OFB A;  2OVS A;  2CM9 A;  2MM3 A;  4BX6 B;  1DF8 A;  1ADL A;  4NLJ A;  3WJF A;  5FFH A;  4O4S A;  1DZJ A;  3UEX A;  2AVI A;  3P6E A;  1LID A;  3BX7 A;  2Q2P A;  4IAW A;  2RTJ A;  1GX8 A;  1I06 A;  3C77 X;  3FEK A;  2RCT A;  2GTL M;  3HWD A;  4ZJ0 A;  3TGA A;  1QFT A;  2FTB A;  1BRQ A;  1TVQ A;  3RDQ A;  1RAV A;  3STN A;  3KFI A;  3ZW0 A;  1SWF A;  1QAB E;  1GT3 A;  4I3B A;  3FA6 A;  4O3X B;  4A1H A;  2AT5 X;  1HQP A;  4U46 A;  1EAL A;  1RBP A;  1XCA A;  3C76 X;  3VG6 A;  2XST A;  4MVL A;  1PTS A;  1OPB A;  1UZ2 X;  4EDE A;  3S5X A;  2GC9 A;  5BVS A;  1LIF A;  1OBP A;  2QM9 A;  3F6Z B;  3CMP A;  1X8O A;  4U8U N;  3MG5 A;  5BVQ A;  4A1Y A;  4ARH A;  1IFC A;  4MIR A;  5HZ8 A;  3ELZ A;  5B3M O;  3B2J A;  2YG2 A;  4GH7 A;  2FR3 A;  1SWD A;  4XMD A;  1GT4 A;  3N91 A;  1VWD B;  4ALO A;  2HYS A;  1QWD A;  1SLE B;  1LKE A;  4WHI A;  2L67 A;  2A5C A;  4BOE A;  5K67 A;  1VPR A;  1SXW A;  2AL0 X;  2Z4H A;  4AW8 A;  3SAO A;  2G79 A;  1LCZ A;  4Z6J A;  1ZNH A;  2QCB A;  1LIC A;  1E06 A;  2HLV A;  4JNJ A;  1BJ7 A;  4ML7 B;  2PY1 A;  3MVF A;  3IFB A;  4GUZ A;  4CPF A;  2CZT A;  3FR2 A;  1FEM A;  4ALB A;  3FA9 A;  2X56 A;  1MDC A;  4GNY A;  1KXO A;  2Y32 A;  5EDB A;  3B2K A;  3T6F A;  3WJD A;  3RDM A;  1ACD A;  2IZC B;  1WUB A;  3PQU A;  4CDF A;  2RQ0 A;  3ZQ3 A;  2ZAI A;  1PBO A;  2MF6 A;  2PI3 O;  3EC5 A;  3VGW A;  1E02 A;  3P6G A;  1KL5 A;  3E3C A;  1KZW A;  3UEV A;  4DCB A;  2RTR B;  4ZFX A;  3KVN A;  2N93 A;  1HMS A;  1JV4 A;  4IAB A;  5AEO A;  1DFV A;  1MK5 A;  1VWH B;  4OMX A;  4CPH A;  1NBX A;  2GTL O;  1VYO A;  1L6M A;  2A5B A;  1A18 A;  1MX7 A;  1SMP I;  3Q6L A;  2RTQ B;  3NQ3 A;  1RXH A;  2JMB A;  2R56 A;  3VG4 A;  1KT3 A;  2ACO A;  2RTE B;  2Z4I A;  5FQ6 E;  3S5V A;  4GGR A;  1LDO A;  1W4T A;  4YGH A;  5EPQ A;  3NQ9 A;  5IRU A;  4BGF A;  5H9A A;  2X8F A;  4QQ1 A;  1YWD A;  3HK1 A;  2QO6 A;  4TKB A;  3CWK A;  5LJG A;  1IJ8 A;  4NYR A;  3CBC A;  4D6A A;  1SRE A;  1SWJ A;  2K62 A;  1R0U A;  1NQM A;  5CYB A;  2Q4N A;  1SWQ A;  5DPQ A;  4KH8 A;  3FW4 A;  2RTO B;  2IZA A;  2IZG B;  1SWH A;  2OVD A;  1EPA A;  1FTP A;  2WEW A;  3JSQ A;  4XMC A;  5FQ8 E;  1OEJ A;  4N7C A;  2IZL B;  1PEE A;  1B0O A;  1HBP A;  5FQ7 E;  3ZUO A;  2RN4 A;  1LIE A;  4LKT A;  3WYQ A;  4ZHD A;  3U03 A;  4O49 A;  2G78 A;  3VHM A;  1EII A;  3VG7 A;  4OEM A;  1PMP A;  2C4I A;  2CZU A;  2QOM A;  4JHQ A;  4ORR A;  4ZH9 A;  3SOT A;  1DZP A;  1IFB A;  1MOY A;  1SY3 A;  1ZND A;  2ANS A;  2RD7 C;  3FW5 A;  2A13 A;  4ORY A;  5IO6 A;  3STK A;  3CQR A;  2QMI A;  3RE5 A;  1A2D A;  3NP1 A;  1U18 A;  5AJB A;  1IW2 A;  1QG5 A;  4I9S A;  3STM X;  2G7B A;  4DQ4 A;  1STR B;  4QZU A;  3KZA A;  1QY2 A;  2X34 A;  1N9M A;  1SY0 A;  1EI5 A;  1VWL B;  2RTM A;  4R0B A;  1YP6 A;  1FEL A;  5HTD A;  1ZNE A;  4TLJ A;  1KQW A;  4GU8 A;  2I5V O;  4IB6 A;  2OY1 O;  3WOV A;  5LJB A;  4Y0R A;  1BEB A;  3CQN A;  3RE6 A;  2MHD A;  5BYP A;  3RWX A;  4ZCB A;  3NX1 A;  1SWK A;  1UYO X;  2KTS A;  1E00 A;  2OFM X;  4WBK A;  4Y0Q A;  1MUP A;  2BS6 A;  1CBS A;  2FR2 A;  2L5P A;  3C78 X;  1AQB A;  4HWM A;  3AUM O;  4BQU A;  1VWK B;  1HXL A;  1N0S A;  1O1U A;  4L1N A;  1LPJ A;  2RCQ A;  4LKP A;  5D4A A;  4I9R A;  1ERB A;  4YDB A;  5HZ9 A;  2C1Q A;  1NGL A;  1KT7 A;  1ZRY A;  1U0X A;  2IZI A;  3APW A;  1EUO A;  3HTY A;  1LNM A;  2FHN X;  3PK2 A;  4AZP A;  4M6S A;  2Q9S A;  5F7G A;  3RZY A;  5IXG A;  1DF3 A;  1NQN A;  4WFU A;  3BSZ E;  1I4U A;  3NR3 A;  3WJG A;  1SLG B;  4IMO A;  4FBV A;  1TXL A;  1ZNG A;  5HZ5 A;  1X8N A;  3K3L A;  1JMX A;  4GK9 A;  4OKA A;  4AZM A;  1IIU A;  1SWC A;  2JN3 A;  4N7D A;  4EEJ A;  2EU7 X;  1P6P A;  3WZQ A;  1SWE A;  1RXK A;  1Z24 A;  1LFO A;  1RST B;  2W2A A;  4A8Z A;  2RTL A;  2LA7 A;  4GKC A;  3GE2 A;  5B2A O;  3RY2 A;  3UEW A;  2Q39 A;  2OFR X;  4HPA A;  2R73 A;  1VWM B;  3HWF A;  4NNT A;  4B55 A;  1SWB A;  4KT5 A;  2NNE A;  4L3R A;  4A60 A;  3ZW1 A;  3PED A;  3BS2 A;  1EQD A;  5D47 A;  3VG5 A;  3WYP A;  1STS B;  2UZ2 A;  4KII A;  5B10 O;  1NDJ A;  3T2X A;  4GZV A;  5F6Z A;  4IBA A;  2QOS C;  2G8C O;  4LQZ A;  2FHL A;  1Y9L A;  2FRS A;  3GAQ A;  1G74 A;  4O3W A;  1QY1 A;  5F58 A;  4QYN A;  3EBK A;  2BS5 A;  2RTK A;  3FYF A;  3WJE A;  1LIB A;  4CSB A;  5HZ6 A;  4EQA C;  5KIC A;  1EPB A;  4QYP A;  3T2W A;  2RTA A;  4U8U M;  2IFB A;  1SY1 A;  3FA8 A;  4I6S A;  4ZR2 A;  3S60 A;  4CDD A;  2IZK A;  3EBW A;  3EYC A;  3FEN A;  4LZV A;  4BCS A;  1SRG A;  2L68 A;  2X32 A;  1AB0 A;  3APU A;  2WR6 A;  5IRA A;  1I9H A;  3SLT A;  4AZR A;  2WQ9 A;  4PSQ A;  2OF9 A;  1CBI A;  4GGZ A;  5EEE A;  1A57 A;  4ZHC A;  1AVG I;  1G7N A;  2Y3E A;  3PDF A;  1VWC B;  1VWG B;  3QQ2 A;  1HN2 A;  2IZE B;  2P8G A;  3RDX A;  3VHH A;  5B29 A;  5L3Y A;  1OEE A;  1LF7 A;  3P6D A;  4NP1 A;  4OEL A;  1QQS A;  1S7D A;  2JU3 A;  3D9W A;  1SA8 A;  2F73 A;  1NP1 A;  2CBR A;  2FKG A;  4IAX A;  4IMN A;  2AT3 X;  2AH7 X;  5EDC A;  3SZH A;  1GM6 A;  3KQ0 A;  4ORW A;  1O1V A;  5L8I A;  4DNE A;  3RDO A;  5HCD C;  3FR5 A;  2CM4 A;  2WSJ A;  1OPA A;  2LKK A;  2KT4 B;  4XMH A;  3P24 A;  3WJB A;  1X8U A;  4GJV A;  4BX5 B;  5HA0 A;  1T68 X;  2X45 A;  5K68 A;  1ALB A;  1CRB A;  5LJC A;  1SRJ A;  4TNN A;  5HTE A;  1YWB A;  2OFA A;  2GTF X;  2RTP B;  4BX6 A;  4CPI A;  4CDE A;  4NLI A;  4TKH A;  5HBS A;  3CKF A;  1GXA A;  3TGC A;  1K3B A;  3PPT A;  4O4O A;  4ID2 A;  1EXS A;  2OL8 O;  2RTI B;  3ZW2 A;  2AF5 A;  4FBO A;  3ZZV A;  4MVE A;  1YWC A;  4M7M A;  4QAE A;  2JGS A;  4ES7 A;  1JYD A;  1MVG A;  2OZQ A;  5F6B A;  1S2P A;  1SLD B;  5H9K A;  1JBH A;  1SY2 A;  2FLJ A;  4YCE A;  3SLJ A;  1HY2 A;  1AEL A;  4MVK A;  1SWP A;  3I17 A;  2HNX A;  2KTD A;  4NW4 A;  2BSZ A;  3HPE A;  3H3I A;  3BU1 A;  4EFG A;  4MVI A;  4U8U O;  2O62 A;  1SXY A;  4ZHF A;  1G5W A;  1SWA A;  2ZAG A;  3FIQ A;  1K24 A;  4ORU A;  2OY7 A;  2X55 A;  1E2T A;  4NV8 A;  5KID A;  1WBI A;  2BHV A;  2FT9 A;  3WXQ A;  1MM9 A;  1JJX A;  1JJU A;  2WPU A;  5L8N A;  1NC9 A;  3FA7 A;  3L4R A;  2DJF A;  3NAD A;  4YH0 A;  5JR8 A;  1LCV A;  1GX3 A;  2ACP X;  3PP6 A;  3D96 A;  4I95 A;  2WWP A;  1DZM A;  3NQK A;  2G5L A;  4GE1 A;  1DZK A;  1STP A;  3ZUI A;  2UYW A;  4CV7 A;  4AZQ A;  1HBQ A;  1I04 A;  4GET A;  4KC7 A;  4ZHH A;  1HQQ A;  1Y53 X;  4O4X A;  3OE3 A;  4YFQ A;  5AJC A;  2OYB O;  1SWT A;  2AKQ A;  2OL6 O;  4I60 A;  1VWE B;  3U0D A;  2LBA A;  3BU9 A;  1BSY A;  2BT9 A;  3D4R A;  3WJC A;  1SLF B;  5LJE A;  1VWR B;  4Z27 A;  3SZI A;  1GT1 A;  4AYH A;  2RTC B;  3ZI8 A;  1S44 A;  1YP7 A;  1KT4 A;  4NYQ A;  4FBR A;  1YIV A;  3HOE A;  4EKV A;  4IB8 A;  1EIO A;  2ASN X;  1HMR A;  2HZR A;  2A2U A;  4QGW A;  1B4M A;  1N9Y A;  4ON1 A;  2CAM A;  5H9N A;  3TZS A;  4XMG A;  4D6B A;  4TQ2 A;  4ODD A;  4TKJ A;  4I3D A;  1GT5 A;  3OBL A;  3BLG A;  1KFF A;  1B8E A;  1JYJ A;  5KHP A;  4HFO A;  3MX7 A;  4I3C A;  1ERX A;  3WZP A;  5B5G A;  1H91 A;  3CR6 A;  2AT0 X;  1N43 A;  1BRP A;  1KL3 A;  1ZNL A;  5D48 A;  3T6L A;  3KFG A;  5IO5 A;  4AZN A;  1LDQ A;  4QGV A;  3PH5 A;  2KD2 A;  1LCW A;  1ICM A;  5LJH A;  1SWN A;  3CKG A;  3VG3 A;  3BRN A;  4COT A;  1BSO A;  2FGS A;  3ELX A;  3VG2 A;  5LJK A;  2GTL N;  4CK4 A;  1CBQ A;  1W5R A;  3OD9 A;  4PJ2 A;  4CPE A;  1BLR A;  1BM5 A;  4GRJ A;  3U9P C;  2I5Z O;  2A2G A;  4YVB A;  4JO6 A;  1CBR A;  5HA1 A;  2RTH B;  2FWV A;  4OS3 A;  5EED A;  3KFF A;  4YMY A;  1SWL A;  1VWF B;  2Q2M A;  3SZJ A;  1T8V A;  2XKL A;  2CBS A;  3EW1 A;  2BLG A;  4KC8 A;  3G7X A;  1KT6 A;  3Q34 A;  4ORX A;  3F8A A;  3RY1 A;  3ZWE A;  5HWZ A;  4HPC A;  3O19 A;  4QGX A;  5LKE A;  2FKJ A;  2AT6 X;  2FS6 A;  1I05 A;  2MJI A;  1BSQ A;  1KQX A;  5BVT A;  1AVE A;  4TJZ A;  1CJ5 A;  1Y0G A;  2JOZ A;  3VHI A;  1VWB B;  4Y5D A;  1GKA B;  2JU7 A;  2AT8 X;  3O2Y A;  1FDQ A;  2YMS A;  4KCA A;  1DC9 A;  3UEU A;  1TW4 A;  4Z2O A;  1JZU A;  2DJG A;  4OMW A;  1Y52 X;  1SRF A;  1MX8 A;  5C0N A;  4BX7 B;  1O8V A;  1YWA A;  2NP1 A;  3AEH A;  4NV7 A;  1QY0 A;  1VWI B;  3DSZ A;  4HPB A;  5B5F A;  5F2B A;  4ZHG A;  4Y0S A;  1T0V A;  3VE1 A;  2VDF A;  3EW2 A;  4O3Z A;  4YDA A;  1Y9T A;  5HAE A;  1SXX A;  3AKN A;  2F01 A;  3BY0 A;  4OS8 A;  1Y55 X;  3CBS A;  3FEP A;  3HWE A;  3MM0 A;  1ML7 A;  4YKO A;  1G85 A;  1GX9 A;  4O9S A;  4ORS A;  2RTF B;  3LHN A;  3LV4 A;  1X89 A;  4INN A;  5CHK A;  1VWA B;  4FGI B;  3P6C A;  5B11 O;  1VYF A;  2RA6 A;  5LKF A;  1JMZ A;  3FID A;  1D2U A;  1VWQ B;  2JU8 A;  4FQB B;  2GH7 A;  2QO5 A;  2RTB B;  3NX2 A;  4OS0 A;  1GGL A;  1X8Q A;  1LEL A;  2IZJ A;  2MO5 A;  4U9C A;  1SWO A;  4YFP A;  1U17 A;  4BJ8 A;  1KT5 A;  2IZF B;  1NP4 A;  3BDR A;  1RXJ A;  3B2L A;  1W6F A;  3QKG A;  2FS7 A;  4IB7 A;  3D97 A;  3JS1 A;  1JIW I;  1SWG A;  4CDC A;  5JD2 A;  4MEE A;  1X71 A;  4Z2P A;  2IZH B;  1IKJ A;  1IKE A;  1TOU A;  3UAQ A;  4EXZ A;  2X46 A;  4GD9 A;  3VPJ E;  2X4M A;  3WZN A;  2JW1 A;  3NBX X;  1FJ1 E;  4XME A;  4Z2V A;  5H9L A;  1RSU B;  4IB9 A;  2E4J A;  4C5P A;  1MEP A;  2Y3F A;  3IA8 A;  1KOI A;  1VWJ B;  3VE2 A;  1E5P A;  5B27 A;  4UU2 A;  3RDS A;  4ZGU A;  2X8S A;  1FE3 A;  1N7Y A;  1VWP B;  2L9C A;  4U3Q A;  4YKM A;  3EMM A;  3RDU A;  3VU1 A;  2RTG B;  2LBV A;  2ALL X;  3BX8 A;  3P6F A;  1I78 A;  2WQA E;  1JJJ A;  1XKI A;  4RUN A;  4Y0P A;  1KL4 A;  1HMT A;  3I0A A;  2LFO A;  3FMZ A;  3JQO A;  3LTW A;  3RBY A;  4JGL A;  3FLL A;  2M4L A;  3ZW0 B;  2OY5 O;  3TGB A;  3WVM A;  1RLB E;  3RKG A;  1DV9 A;  1OBQ A;  1URE A;  2MWH A;  2OF8 A;  5IO7 A;  4BBO A;  1OSP O;  2A3F X;  4YFR A;  1OBU A;  2BC3 A;  3FDC A;  3HWG A;  2X8T A;  2NNQ A;  3P6H A;  3ZW1 B;  1EW3 A;  5K06 A;  2A8G A;  4MIS A;  4GNW A;  5HZQ A;  4DQ3 A;  1KZX A;  1D3S A;  4GGT A;  2R74 A;  4Z28 A;  1BBP A;  3TF6 A;  2ZSC A;  1UYN X;  2VFB A;  1VWO B;  4K19 A;  5DG4 A;  4BVM A;  5D8J A;  3B2H A;  4XMF A;  1KGL A;  3APV A;  4GDZ A;  1PM1 X;  1SWU A;  1GKA A;  3X00 A;  1ICN A;  4YBP A;  5L8O A;  2KW1 A;  3PQS A;  5F1E A;  4O3Y A;  2IZB A;  3AKM A;  4UU3 A;  2GJ5 A;  4YGG A;  1QFV A;  1FEN A;  3PH6 A;  2F09 A;  3MBT A;  5D45 A;  4BX7 A;  3PEC A;  3KFH A;  1JQP A;  3F9D A;  3B2I A;  3EM0 A;  4ZGF A;  2K23 A;  3OJY C;  2C1S A;  3APX A;  3SLO A;  3V8U A;  2W2B A;  3HOL A;  1B56 A;  1SWS A;  2QO4 A;  5FAZ A;  1SRI A;  2A0A A;  4WFV A;  2AMM X;  5HCE C;  1X8P A;  1A3Y A;  4HPD A;  3T1D A;  2HZQ A;  2OL7 A;  1SWR A;  4Y59 A;  4AZO A;  5IRW A;  2W2F A;  3D95 A;  1VYG A;  1LUQ A;  1AVD A;  3WBG A;  5CSE A;  1SRH A;  4LZU A;  2RTD B;  5LJD A;  4IRW A;  5CE4 A;  4NNS A;  3FR4 A;  5EZ2 A;  3DTQ A;  2OY8 A;  4BX5 A;  2POA A;  2OVA A; 
#chains in the Genus database with same CATH homology
 4QNI A;  2LB6 A;  2OVE A;  2WEX A;  4RUU A;  4YCH A;  3RSW A;  5FEN A;  5HCC C;  1OEK A;  3P02 A;  1YUP A;  3NPO A;  3S26 A;  1BWY A;  3FEL A;  4YGZ A;  1ZNK A;  2WUT A;  4ZH6 A;  4QRL A;  2NND A;  3O22 A;  4YBU A;  4O4U A;  4QZT A;  1SXU A;  5AQ6 A;  2DM5 A;  5H8T A;  1TOW A;  2HMB A;  2OVS A;  2CM9 A;  2MM3 A;  1ADL A;  4NLJ A;  3WJF A;  5FFH A;  4O4S A;  1DZJ A;  3UEX A;  3P6E A;  1LID A;  3BX7 A;  2Q2P A;  4IAW A;  1GX8 A;  1I06 A;  3C77 X;  3FEK A;  2RCT A;  2GTL M;  3HWD A;  4ZJ0 A;  3TGA A;  1QFT A;  2FTB A;  1BRQ A;  1TVQ A;  3STN A;  3KFI A;  3ZW0 A;  1QAB E;  1GT3 A;  4I3B A;  3FA6 A;  4O3X B;  4A1H A;  2AT5 X;  1HQP A;  1EAL A;  1RBP A;  1XCA A;  3C76 X;  3VG6 A;  2XST A;  4MVL A;  1OPB A;  1UZ2 X;  4EDE A;  3S5X A;  2GC9 A;  5BVS A;  1LIF A;  1OBP A;  2QM9 A;  3F6Z B;  3CMP A;  1X8O A;  4U8U N;  5BVQ A;  4A1Y A;  4ARH A;  1IFC A;  4MIR A;  5HZ8 A;  3ELZ A;  3B2J A;  2YG2 A;  4GH7 A;  2FR3 A;  4XMD A;  1GT4 A;  3N91 A;  4ALO A;  2HYS A;  1QWD A;  4WHI A;  1LKE A;  2L67 A;  4BOE A;  1VPR A;  1SXW A;  2AL0 X;  2Z4H A;  4AW8 A;  3SAO A;  2G79 A;  1ZNH A;  1LIC A;  1E06 A;  2HLV A;  1BJ7 A;  4ML7 B;  2PY1 A;  3MVF A;  3IFB A;  2CZT A;  3FR2 A;  1FEM A;  4ALB A;  3FA9 A;  1MDC A;  4GNY A;  1KXO A;  5EDB A;  3B2K A;  3WJD A;  1ACD A;  3PQU A;  2RQ0 A;  3ZQ3 A;  2ZAI A;  1PBO A;  1E02 A;  3P6G A;  3E3C A;  1KZW A;  3UEV A;  4ZFX A;  2N93 A;  1HMS A;  1JV4 A;  4IAB A;  5AEO A;  1DFV A;  4OMX A;  2GTL O;  1L6M A;  1A18 A;  1MX7 A;  1SMP I;  3Q6L A;  3NQ3 A;  2JMB A;  2R56 A;  3VG4 A;  1KT3 A;  2ACO A;  2Z4I A;  5FQ6 E;  3S5V A;  4YGH A;  5EPQ A;  3NQ9 A;  5H9A A;  2X8F A;  4QQ1 A;  1YWD A;  3HK1 A;  2QO6 A;  4TKB A;  3CWK A;  5LJG A;  4NYR A;  3CBC A;  4D6A A;  2K62 A;  1R0U A;  5CYB A;  2Q4N A;  5DPQ A;  4KH8 A;  3FW4 A;  4XMC A;  2OVD A;  1EPA A;  1FTP A;  2WEW A;  3JSQ A;  5FQ8 E;  1OEJ A;  4N7C A;  1PEE A;  1B0O A;  1HBP A;  5FQ7 E;  3ZUO A;  2RN4 A;  1LIE A;  4LKT A;  4ZHD A;  3U03 A;  4O49 A;  2G78 A;  1EII A;  3VG7 A;  1PMP A;  2CZU A;  4ORR A;  4ZH9 A;  3SOT A;  1DZP A;  1IFB A;  1SY3 A;  1ZND A;  4ORY A;  2ANS A;  2RD7 C;  3FW5 A;  2A13 A;  5IO6 A;  3STK A;  3CQR A;  2QMI A;  1A2D A;  3NP1 A;  1U18 A;  5AJB A;  1IW2 A;  1QG5 A;  4I9S A;  3STM X;  2G7B A;  4DQ4 A;  4QZU A;  3KZA A;  1QY2 A;  1SY0 A;  1EI5 A;  4R0B A;  1YP6 A;  1FEL A;  5HTD A;  1ZNE A;  4TLJ A;  1KQW A;  4GU8 A;  4IB6 A;  3WOV A;  5LJB A;  4Y0R A;  1BEB A;  3CQN A;  2MHD A;  5BYP A;  3RWX A;  4ZCB A;  3NX1 A;  2KTS A;  2OFM X;  4WBK A;  1E00 A;  4Y0Q A;  1MUP A;  2BS6 A;  1CBS A;  2FR2 A;  2L5P A;  3C78 X;  1AQB A;  4HWM A;  4BQU A;  1N0S A;  1O1U A;  4L1N A;  1LPJ A;  2RCQ A;  4LKP A;  5D4A A;  4I9R A;  1ERB A;  4YDB A;  5HZ9 A;  3HTY A;  1NGL A;  1KT7 A;  1ZRY A;  1U0X A;  3APW A;  1EUO A;  1LNM A;  4AZP A;  4M6S A;  2Q9S A;  5F7G A;  3RZY A;  1DF3 A;  4WFU A;  3BSZ E;  1I4U A;  3NR3 A;  3WJG A;  4IMO A;  4FBV A;  1TXL A;  1ZNG A;  5HZ5 A;  1X8N A;  3K3L A;  4GK9 A;  4AZM A;  1IIU A;  2JN3 A;  4N7D A;  4EEJ A;  2EU7 X;  1P6P A;  1Z24 A;  1LFO A;  2W2A A;  4A8Z A;  2LA7 A;  4GKC A;  3GE2 A;  3UEW A;  2Q39 A;  2OFR X;  4HPA A;  2R73 A;  3HWF A;  4NNT A;  4KT5 A;  2NNE A;  4L3R A;  4A60 A;  3ZW1 A;  3PED A;  3BS2 A;  1EQD A;  5D47 A;  3VG5 A;  4KII A;  4GZV A;  5F6Z A;  4IBA A;  2QOS C;  4LQZ A;  1Y9L A;  2FRS A;  3GAQ A;  1G74 A;  4O3W A;  1QY1 A;  5F58 A;  4QYN A;  3EBK A;  2BS5 A;  4CSB A;  3FYF A;  3WJE A;  1LIB A;  5HZ6 A;  4EQA C;  5KIC A;  1EPB A;  4QYP A;  4U8U M;  2IFB A;  1SY1 A;  3FA8 A;  4I6S A;  4ZR2 A;  3S60 A;  3EBW A;  3EYC A;  3FEN A;  4LZV A;  2L68 A;  1AB0 A;  3APU A;  2WR6 A;  4AZR A;  2WQ9 A;  4PSQ A;  1A57 A;  1CBI A;  5EEE A;  4ZHC A;  1AVG I;  1G7N A;  1HN2 A;  2P8G A;  5B29 A;  1OEE A;  1LF7 A;  3P6D A;  4NP1 A;  1QQS A;  1S7D A;  2JU3 A;  4IAX A;  1SA8 A;  2F73 A;  1NP1 A;  2CBR A;  4IMN A;  2AH7 X;  2AT3 X;  5EDC A;  1GM6 A;  3KQ0 A;  4ORW A;  1O1V A;  5L8I A;  5HCD C;  3FR5 A;  2CM4 A;  2WSJ A;  1OPA A;  2LKK A;  2KT4 B;  4XMH A;  3P24 A;  3WJB A;  1X8U A;  5HA0 A;  1T68 X;  2X45 A;  1ALB A;  1CRB A;  5LJC A;  4TNN A;  5HTE A;  1YWB A;  2GTF X;  4NLI A;  4TKH A;  5HBS A;  1GXA A;  3TGC A;  3PPT A;  4O4O A;  4ID2 A;  1EXS A;  3ZW2 A;  4FBO A;  3ZZV A;  4MVE A;  1YWC A;  4M7M A;  4QAE A;  4ES7 A;  1JYD A;  1MVG A;  2OZQ A;  5F6B A;  1S2P A;  1JBH A;  5H9K A;  1SY2 A;  2FLJ A;  4YCE A;  1AEL A;  4MVK A;  3I17 A;  2HNX A;  2KTD A;  4NW4 A;  3H3I A;  3BU1 A;  4EFG A;  4MVI A;  4U8U O;  2O62 A;  1SXY A;  4ZHF A;  1G5W A;  2ZAG A;  3FIQ A;  4ORU A;  5KID A;  1JJX A;  2FT9 A;  2BHV A;  3WXQ A;  1KGL A;  5L8N A;  3FA7 A;  3L4R A;  3NAD A;  5JR8 A;  4YH0 A;  2ACP X;  3PP6 A;  3D96 A;  4I95 A;  2WWP A;  1DZM A;  3NQK A;  4GE1 A;  3ZUI A;  1DZK A;  4CV7 A;  4AZQ A;  1HBQ A;  1I04 A;  4GET A;  4KC7 A;  4ZHH A;  4O4X A;  3OE3 A;  4YFQ A;  5AJC A;  2AKQ A;  3U0D A;  2LBA A;  3BU9 A;  1BSY A;  2BT9 A;  3D4R A;  3WJC A;  5LJE A;  1GT1 A;  3ZI8 A;  1S44 A;  1YP7 A;  1KT4 A;  4NYQ A;  4FBR A;  1YIV A;  3HOE A;  1EIO A;  4IB8 A;  2ASN X;  1HMR A;  2HZR A;  2A2U A;  4QGW A;  1B4M A;  4ON1 A;  5H9N A;  3TZS A;  4XMG A;  4D6B A;  4TQ2 A;  4ODD A;  4TKJ A;  4I3D A;  1GT5 A;  3OBL A;  3BLG A;  1B8E A;  1JYJ A;  5KHP A;  4HFO A;  3MX7 A;  4I3C A;  1ERX A;  1H91 A;  3CR6 A;  2AT0 X;  1BRP A;  1ZNL A;  5D48 A;  5IO5 A;  3KFG A;  4AZN A;  4QGV A;  3PH5 A;  2KD2 A;  1ICM A;  5LJH A;  3VG3 A;  3BRN A;  4COT A;  1BSO A;  3VG2 A;  3ELX A;  5LJK A;  2GTL N;  4CK4 A;  1CBQ A;  3OD9 A;  4PJ2 A;  1BLR A;  1BM5 A;  4GRJ A;  3U9P C;  2A2G A;  5HA1 A;  1CBR A;  2FWV A;  4OS3 A;  5EED A;  3KFF A;  4YMY A;  2Q2M A;  1T8V A;  2XKL A;  2CBS A;  2BLG A;  4KC8 A;  3G7X A;  1KT6 A;  4ORX A;  3ZWE A;  3F8A A;  5HWZ A;  4HPC A;  3O19 A;  4QGX A;  5LKE A;  2AT6 X;  2FS6 A;  1I05 A;  2MJI A;  1BSQ A;  1KQX A;  5BVT A;  4TJZ A;  1CJ5 A;  2JOZ A;  1GKA B;  2JU7 A;  2AT8 X;  3O2Y A;  1FDQ A;  2YMS A;  4KCA A;  1DC9 A;  3UEU A;  1TW4 A;  1JZU A;  4OMW A;  5C0N A;  1MX8 A;  1O8V A;  1YWA A;  2NP1 A;  1QY0 A;  4HPB A;  3DSZ A;  4ZHG A;  4Y0S A;  1T0V A;  3VE1 A;  4O3Z A;  4YDA A;  1Y9T A;  5HAE A;  1SXX A;  3AKN A;  3BY0 A;  4OS8 A;  3HWE A;  3CBS A;  3FEP A;  4YKO A;  1ML7 A;  1G85 A;  1GX9 A;  4O9S A;  4ORS A;  3LHN A;  3LV4 A;  1X89 A;  4INN A;  4FGI B;  3P6C A;  5LKF A;  1VYF A;  2RA6 A;  1D2U A;  2JU8 A;  4FQB B;  2QO5 A;  3NX2 A;  4OS0 A;  1GGL A;  1X8Q A;  4U9C A;  2MO5 A;  4YFP A;  1U17 A;  1KT5 A;  4IB7 A;  1NP4 A;  3BDR A;  3B2L A;  3QKG A;  2FS7 A;  3D97 A;  3JS1 A;  1JIW I;  1X71 A;  1IKJ A;  1IKE A;  1TOU A;  3UAQ A;  4EXZ A;  2X46 A;  3VPJ E;  2JW1 A;  3NBX X;  4XME A;  5H9L A;  4IB9 A;  2E4J A;  3IA8 A;  3VE2 A;  1KOI A;  1E5P A;  5B27 A;  4UU2 A;  4ZGU A;  2X8S A;  1FE3 A;  4U3Q A;  4YKM A;  2L9C A;  3EMM A;  3VU1 A;  2LBV A;  2ALL X;  3BX8 A;  3P6F A;  2WQA E;  1JJJ A;  1XKI A;  4RUN A;  4Y0P A;  4AYH A;  1HMT A;  3I0A A;  2LFO A;  3FMZ A;  3JQO A;  3RBY A;  4JGL A;  3FLL A;  2M4L A;  3ZW0 B;  3TGB A;  3WVM A;  1RLB E;  3RKG A;  1DV9 A;  1OBQ A;  1URE A;  2MWH A;  5IO7 A;  2A3F X;  4YFR A;  1OBU A;  3HWG A;  2X8T A;  2NNQ A;  3P6H A;  3ZW1 B;  1EW3 A;  5K06 A;  4MIS A;  4GNW A;  5HZQ A;  4DQ3 A;  1KZX A;  1D3S A;  2R74 A;  3TF6 A;  1BBP A;  4K19 A;  5DG4 A;  4BVM A;  5D8J A;  3B2H A;  4XMF A;  3APV A;  4GDZ A;  1PM1 X;  5L8O A;  1GKA A;  1ICN A;  4YBP A;  2KW1 A;  3PQS A;  5F1E A;  4O3Y A;  3AKM A;  4UU3 A;  2GJ5 A;  4YGG A;  1QFV A;  1FEN A;  3PH6 A;  2F09 A;  3MBT A;  5D45 A;  3PEC A;  3KFH A;  3F9D A;  3B2I A;  3EM0 A;  4ZGF A;  2K23 A;  3OJY C;  3APX A;  3V8U A;  2W2B A;  3HOL A;  1B56 A;  2QO4 A;  5FAZ A;  2A0A A;  4WFV A;  2AMM X;  5HCE C;  1X8P A;  1A3Y A;  4HPD A;  3T1D A;  2HZQ A;  4AZO A;  2W2F A;  3D95 A;  1VYG A;  3WBG A;  4LZU A;  5LJD A;  5CE4 A;  4NNS A;  3FR4 A;  5EZ2 A;  3DTQ A;  2POA A;  2OVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...