2BS5A

Lectin from ralstonia solanacearum complexed with 2-fucosyllactose
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FUCOSE-BINDING LECTIN PROTEIN
publication title The Fucose-Binding Lectin from Ralstonia Solanacearum: A New Type of {Beta}-Propeller Architecture Formed by Oligomerization and Interacting with Fucoside, Fucosyllactose, and Plant Xyloglucan.
pubmed doi rcsb
source organism Ralstonia solanacearum
total genus 11
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.190 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bs5A01
3ZW1B 3ZW0B 2BT9A 4I6SA 3ZI8A 5AJBA 3ZW2A 3ZW0A 3ZZVA 3ZW1A 2BS6A 3ZWEA 2BS5A 5AJCA
chains in the Genus database with same CATH superfamily
2RTQB 4WFVA 3APXA 2GC9A 4ALOA 3L4RA 1DV9A 4IB6A 4KCAA 2AVIA 2I5ZO 4LKTA 4ODDA 1Y0GA 1STRB 2I5VO 4UU2A 4WFUA 1VWPB 3Q6LA 4YKMA 5D8JA 2BHVA 2JN3A 1DC9A 4BVMA 4COTA 3UEXA 2FRSA 5HCCC 4NNSA 1BM5A 1KL5A 1N0SA 4GRJA 1UYOX 2DJFA 3PH6A 4KC7A 4O3XB 2QO4A 3PH5A 4I9RA 2X56A 4YMYA 1HQQA 1PM1X 3APVA 2FGSA 2HZQA 3SZJA 2OL7A 1NGLA 1SY2A 2FHLA 4OS0A 1BSQA 1GGLA 3PQUA 2HYSA 3T1DA 3H3IA 5AJCA 1KT3A 5HAEA 2OVDA 2L9CA 2RTRB 5L3YA 3VGWA 1LKEA 3B2LA 4R0BA 1K24A 3T2XA 2A2UA 1SREA 4JHQA 3VU1A 3WXQA 1KT6A 1NBXA 3NQ9A 4Y59A 2IZCB 2RCTA 4XMCA 1LIEA 4GGZA 1R0UA 4CPEA 2OVSA 4JGLA 5HA1A 5H9LA 4BX6A 1KL4A 1GX9A 3BS2A 3PP6A 4DQ4A 3CQRA 1CBSA 1ZNEA 2RTJA 2FWVA 4XMGA 1GKAA 3SLOA 3WJCA 3BSZE 4Y0QA 1SXUA 2AF5A 2G78A 1DFVA 1HMRA 4YH0A 5HCEC 1PBOA 1KOIA 1ERXA 2HNXA 4ORSA 5HWZA 1YWBA 1YP7A 2C1QA 1UZ2X 2Q2MA 4AZRA 4O4XA 3PEDA 3NQKA 3P02A 1JMXA 4ORXA 2G8CO 3S5XA 1GX3A 4HPDA 3ZWEA 3UAQA 2RTNB 1IJ8A 1SWTA 3NBXX 1SWUA 2CBSA 1PBYA 1SWDA 1QABE 1YUPA 4YGHA 5F6ZA 1LELA 1BRQA 4ZCBA 3CWKA 1AVDA 1QQSA 2OY8A 3Q34A 1L6MA 4CPIA 1SA8A 5IO6A 5L8OA 3VHMA 5H9KA 2DM5A 2BSZA 1MX8A 4L3RA 3P6DA 3G7XA 2RA6A 2VFCA 1FENA 1ZNGA 2WQAE 3MVFA 2RQ0A 4OMWA 4LZUA 4YDAA 5H9NA 5LJGA 3WOVA 3PPTA 1S7DA 1GM6A 3ZUIA 1VWQB 2QCBA 3EW2A 1SWNA 5FQ7E 3RKGA 2NNEA 4IABA 2AT3X 2ZSCA 3HWDA 1TOWA 4QGWA 4Z2PA 1SWRA 2BS6A 5BVQA 2CAMA 3O2YA 4ORWA 1SWEA 4U8UN 4A1HA 4I95A 5IRAA 5C0NA 1SWHA 1N4JA 1HN2A 1QFVA 1X8QA 4L1NA 1RAVA 2OZQA 1VWOB 3NR3A 3NP1A 3PDFA 4BBOA 5B27A 2A5CA 5FQ6E 2BLGA 3ZW1B 3ZW0B 1SY0A 1SWFA 1SRIA 1Y52X 2AT5X 2W2BA 4YGGA 4NP1A 2WPUA 5B11O 2C1SA 2OY5O 2VFBA 4PJ2A 4AZQA 4TKBA 3FR2A 3WZNA 4GU8A 1NP4A 4LZVA 4GDAA 2OL8O 5B3MO 4TLJA 1DZPA 1SWSA 1LCZA 3HWGA 2RTLA 3S60A 1OBQA 1QFTA 3P6EA 1OEEA 1VWIB 1W5RA 1SWGA 2AKQA 2HKDA 4N7DA 3KVNA 2RD7C 4ES7A 1RSUB 5LJEA 3U0DA 3D95A 4GETA 1OPAA 3FELA 4CV7A 1SMPI 4AW8A 1BRPA 1E06A 3P6CA 2DJGA 1Y9TA 1X8UA 1HBPA 4YKOA 2RTHB 5H8TA 3BY0A 4N7CA 1AELA 1FJ1E 1I4UA 3IFBA 3RZYA 2MF6A 1O8VA 5KHPA 2JU8A 3RDMA 3TGAA 4CPHA 1WBIA 1U18A 1VWFB 2JMBA 2G5LA 3FA9A 4XMHA 3SLJA 2YMSA 5LKEA 1LNMA 1I06A 4ID2A 2HMBA 4YVBA 4K19A 1B56A 2W2FA 1VYFA 4YFRA 2FR3A 3D96A 3OD9A 5HBSA 4CSBA 2IZFB 4QQ1A 3SZHA 1EI5A 2M4LA 4GJVA 3CKFA 1D2UA 1VWAB 3HOLA 1AB0A 4BX7B 1IKEA 2X34A 1KT4A 4O3YA 4WBKA 5AEOA 2CM4A 3D4RA 5HTEA 2WR6A 4YFPA 1X89A 2ACOA 4Z6JA 2X32A 3E3CA 5DPQA 3DTQA 2FTBA 4Z27A 1JJXA 3VHHA 1FE3A 1GT5A 1W4TA 1LUQA 1RSTB 3LV4A 2GTFX 2OL6O 4I6SA 1ACDA 3ZW2A 5D48A 3D9WA 3RY1A 1K3BA 5K06A 1FEMA 3KFHA 5KIDA 3KFGA 2E4JA 4NYRA 3RE6A 2QOMA 5DG4A 4AZOA 4YFQA 3U03A 3WJDA 1VWJB 2XKLA 2AT6X 4U8UM 3WVMA 2PY1A 2OY7A 4BX5B 5CHKA 4M7MA 4EQAC 5EDBA 1ICNA 5FAZA 1SWKA 2MO5A 4O3WA 2OF9A 2X4MA 3STKA 1AVGI 1CBQA 3RY2A 2RCQA 2IZKA 1EIOA 1DF3A 3FEPA 3FR4A 2IZBA 3FA8A 2NP1A 4Z2VA 5BVTA 3BLGA 4OKAA 2X8SA 1EXSA 3PECA 3B2HA 2QO6A 1KT5A 3C77X 4B55A 5FFHA 1SLDB 1SWLA 3RDSA 1KQWA 3RDQA 1EPBA 2BT9A 2OFMX 2Z4IA 1SXYA 4YDBA 3VHIA 1JZUA 2RTMA 1VWCB 3X00A 2RTFB 4O4UA 1TVQA 2UYWA 1JBHA 4JO6A 4GNWA 1SY3A 3HPEA 2P8GA 5HZQA 2QO5A 1MUPA 1TXLA 1ZNLA 1KZXA 3SOTA 3VG4A 4NLJA 3FIDA 2CM9A 3AKMA 3K3LA 4A1YA 5L8IA 4O4OA 2VDFA 2Y32A 1MM9A 3TZSA 2F01A 3QQ2A 3O19A 1TW4A 5LJDA 3FMZA 5BYPA 2C4IA 2WWPA 5FQ8E 4ON1A 3WZPA 1BSYA 5JD2A 3T6LA 2Q4NA 3EBKA 4RUUA 1VWEB 2F73A 1W6FA 2NNQA 2IZAA 1AQBA 3VG2A 2OVEA 1SWAA 4BX6B 2FHNX 2W2AA 4RUNA 1U0XA 3RDOA 4MIRA 4PSQA 5HZ6A 3VE2A 3I17A 1SLGB 4O9SA 2JW1A 3CKGA 5AQ6A 3RSWA 2HLVA 5IRUA 4ZGUA 2A5BA 4GH7A 5JR8A 4MISA 1X8NA 1JV4A 2RTKA 1LCVA 3FENA 1EQDA 1I78A 3GE2A 4TNNA 5HTDA 1T68X 2Q9SA 3BU9A 1A3YA 1EW3A 3EMMA 1N9MA 1ZRYA 2OFBA 3PK2A 3HWEA 3B2IA 3VPJE 3ZI8A 1AVEA 1JJUA 2JU3A 1LCWA 1STSB 4GDZA 4YCEA 5IO7A 3WJFA 2JGSA 1QY1A 1A18A 3NADA 1NQNA 1VWNB 4ZHDA 2FT9A 3FDCA 1QY2A 4O4SA 1HMTA 5AJBA 3ZW0A 4GD9A 1YP6A 3KZAA 1CRBA 3QKGA 4AYHA 2X45A 3APUA 1X8PA 2IZJA 4FBRA 2Q2PA 3AKNA 4YBPA 2NNDA 1E2TA 1RBPA 4ML7B 1IFBA 5B5FA 4XMDA 5EPQA 3JS1A 1O1UA 1BWYA 1DZJA 4NNTA 4ZH9A 4EFGA 2IZGB 2KTSA 3JSQA 4BOEA 1OBUA 2OVAA 4Y0RA 1MX7A 2KW1A 4IMOA 4C5PA 3NX2A 1ERBA 2Y3EA 4I3CA 4ZHCA 5B5GA 3UEUA 3WZQA 1RXJA 2F09A 1EALA 1JYJA 3CMPA 4I3DA 2IZIA 1G7NA 2X46A 1XKIA 4KT5A 5HZ5A 1E00A 1LPJA 1PTSA 4NLIA 2GTLN 5HZ9A 5HZ8A 2FKJA 2AT0X 4GJSA 1ZNKA 4I3BA 4M6SA 1SLFB 4DQ3A 4EEJA 3TGBA 1VWMB 5LKFA 1QG5A 2A2GA 4FQBB 1JIWI 3BU1A 3AEHA 3BX7A 1ZNDA 1KL3A 2HZRA 1I9HA 1FTPA 2IZHB 4OEMA 1ALBA 2QM9A 3S5VA 3VG3A 2JOZA 2ZAGA 1IFCA 4CDEA 3RDXA 1QWDA 1KFFA 2RTPB 1ADLA 1SY1A 4CPFA 5KICA 4INNA 1TOUA 2WSJA 3IA8A 4OS8A 2ANSA 3P24A 2IZLB 3TF6A 4OS3A 4FGIB 3SLTA 2MHDA 1LFOA 4I9SA 4TJZA 3WBGA 3FYFA 1QY0A 1X8OA 4AZMA 4CK4A 1LIFA 1B4MA 2OYBO 1SWQA 2G7BA 2KTDA 1G5WA 1HXLA 5K68A 4KIIA 1SWBA 5CYBA 2AH7X 2BC3A 2WQ9A 1NQMA 1ZNHA 2A8GA 3FIQA 1B8EA 2CZUA 2FR2A 5IO5A 4TKHA 1I05A 3F6ZB 1VPRA 2OFRX 1SRFA 2L67A 4QZTA 2LBVA 5IRWA 4IB9A 2X8FA 2EU7X 1GT1A 4QYPA 4U3QA 5L8NA 1LF7A 4IBAA 5H9AA 1RLBE 3MM0A 1GT3A 3P6HA 4BX5A 3C78X 1HY2A 4U8UO 1RXKA 2A0AA 3KFFA 4U9CA 3FEKA 3ZQ3A 5LJHA 1KZWA 5D45A 1XCAA 2RTBB 3HOEA 5B29A 3APWA 3AUMO 4GKCA 3ELXA 5F1EA 1PEEA 4GGTA 3DSZA 3SZIA 1OEJA 1LIDA 3WJBA 1YIVA 4CDFA 3WYPA 1OPBA 4IB8A 2ZAIA 2A3FX 4QRLA 1SRJA 1D3SA 3ZZVA 4QZUA 2WUTA 2G79A 1MEPA 1N7YA 3OE3A 1EIIA 1IKJA 2MWHA 3MX7A 2RN4A 3O22A 4BGFA 4BQUA 1SRGA 2ACPX 4DCBA 1MVGA 4XMFA 4CDCA 1VWLB 4U46A 3JQOA 1VWBB 1YWDA 4FBVA 1ICMA 1EUOA 2RTGB 2ASNX 3HWFA 4HPAA 1GT4A 4O3ZA 4D6AA 3KQ0A 5LJBA 3WZOA 1LDOA 3NX1A 4IB7A 4MVLA 3STMX 4Y0PA 5F2BA 4A8ZA 2GJ5A 2PI3O 1SXXA 4EDEA 4ORYA 1E02A 1P6PA 4ZFXA 2GTLM 1CBRA 1N9YA 2IFBA 3VG6A 2GTLO 2RTEB 1HMSA 4Y0SA 3VG7A 1YWAA 3NPOA 4MVEA 1OBPA 5D47A 4ZHFA 3ZUOA 4TQ2A 3CR6A 4LQZA 3RBYA 1MOYA 3MBTA 1STPA 3MG5A 3EM0A 2RTCB 1SWJA 1I04A 1SWOA 2A13A 4GNYA 5F7GA 4Z28A 1E5PA 1GKAB 1SRHA 2R73A 2AMMX 3T2WA 4AZPA 1B0OA 3ELZA 1X71A 3FLLA 3S26A 3V8UA 2OY1O 2IZDB 4GUZA 1LIBA 1U17A 2UZ2A 2JU7A 3VE1A 2Y3FA 1VWRB 2LBAA 3TGCA 4MVKA 1DZMA 5LJKA 2X8TA 4FBOA 1RXHA 3C76X 3RE5A 1MDCA 4D6BA 4EXZA 4KC8A 1LDQA 4NV7A 4ZHGA 1DF8A 4GE1A 3OBLA 1KT7A 5BVSA 5K67A 1SWPA 1BLRA 1NDJA 1S2PA 4ZHHA 1VYGA 1ML7A 5D4AA 1T8VA 3HK1A 4OMXA 4XMEA 2MJIA 3P6GA 3WJEA 1SWCA 3EYCA 3HTYA 5EEEA 5EEDA 3RWXA 1VYOA 2KT4B 5CSEA 2O62A 1KGLA 3BRNA 3ZW1A 3LTWA 5IXGA 2L68A 2FS7A 3WYQA 1NC9A 1NP1A 2FS6A 3EW1A 4QYNA 4WHIA 1A57A 1CBIA 1FELA 2LFOA 2R74A 2WEXA 3FA6A 1O1VA 1G74A 1KXOA 1A2DA 2GH7A 2LKKA 4MVIA 4IMNA 4KH8A 3I0AA 3B2KA 3FA7A 5F58A 4AZNA 1IW2A 1N43A 4DNEA 3D97A 1KQXA 4Z2OA 3NQ3A 1T0VA 1SLEB 1PMPA 2OFAA 5HA0A 3STNA 2CZTA 1OSPO 5CE4A 1Y53X 4NV8A 2RTAA 1Y9LA 2RTIB 4NW4A 1OEKA 5HCDC 1JQPA 2WEWA 4ZH6A 1JJJA 1JYDA 3BDRA 2L5PA 4EKVA 1BBPA 3UEVA 1WUBA 4TKJA 1VWKB 2N93A 3EC5A 1HBQA 1VWHB 1MK5A 4OELA 1YWCA 4BCSA 4GZVA 1Y55X 4ZGFA 2LB6A 4GGRA 3B2JA 3SAOA 1EPAA 2QOSC 5B2AO 5EDCA 2IZEB 2Z4HA 4QAEA 3CBSA 3F8AA 2ALLX 2MM3A 2LA7A 4GK9A 4LKPA 4YCHA 2CBRA 2KD2A 3PQSA 1SXWA 4I60A 4YGZA 3U9PC 1H91A 4ALBA 3F9DA 4IAWA 2AL0X 4BX7A 4Y5DA 4MEEA 4HPCA 3VG5A 3WJGA 1HQPA 4ZR2A 3BX8A 5FENA 4YBUA 2XSTA 3GAQA 3KFIA 4ORRA 4CPHB 3LHNA 3T6FA 4HPBA 1G85A 1FDQA 1VWDB 5F6BA 2FKGA 3FW5A 4HFOA 4IAXA 4CDDA 1LICA 3EBWA 1GX8A 3N91A 3CBCA 2BS5A 1BSOA 4IRWA 1HXZA 2K62A 2RTOB 4NYQA 4UU3A 2AT8X 4QNIA 4ARHA 5LJCA 5EZ2A 1VWGB 2QMIA 1UREA 3FW4A 4ZJ0A 1CJ5A 3CQNA 4O49A 2R56A 2Q39A 4HWMA 1DZKA 1UYNX 2POAA 1IIUA 2OF8A 4QGXA 4BJ8A 1BJ7A 1JMZA 2K23A 2X55A 2FLJA 3RDUA 4JNJA 2YG2A 3UEWA 5B10O 4A60A 2RTDB 3P6FA 1Z24A 4QGVA 4ORUA 3FR5A 3OJYC 1S44A 1GXAA 1BEBA
chains in the Genus database with same CATH topology
4WFVA 3APXA 2GC9A 4ALOA 3L4RA 1DV9A 4IB6A 4KCAA 4LKTA 4ODDA 4WFUA 4YKMA 4UU2A 3Q6LA 5D8JA 2BHVA 2JN3A 1DC9A 4BVMA 4COTA 3UEXA 2FRSA 5HCCC 4NNSA 1BM5A 1N0SA 4GRJA 4KC7A 3PH6A 4O3XB 2QO4A 3PH5A 4I9RA 4YMYA 1PM1X 3APVA 2HZQA 1NGLA 1SY2A 4OS0A 1BSQA 1GGLA 3PQUA 2HYSA 3T1DA 3H3IA 5AJCA 1KT3A 5HAEA 2OVDA 2L9CA 1LKEA 3B2LA 4R0BA 2A2UA 3VU1A 3WXQA 1KT6A 3NQ9A 2RCTA 4XMCA 1LIEA 1R0UA 2OVSA 4JGLA 5HA1A 5H9LA 1GX9A 3BS2A 3PP6A 4DQ4A 3CQRA 1CBSA 1ZNEA 2FWVA 4XMGA 1GKAA 3WJCA 3BSZE 4Y0QA 1SXUA 2G78A 4YH0A 1DFVA 1HMRA 5HCEC 1PBOA 1KOIA 1ERXA 2HNXA 4ORSA 5HWZA 1YWBA 1YP7A 1UZ2X 2Q2MA 4AZRA 4O4XA 3PEDA 3NQKA 3P02A 4ORXA 3S5XA 3ZWEA 4HPDA 3UAQA 3NBXX 2CBSA 1QABE 1YUPA 4YGHA 5F6ZA 1BRQA 4ZCBA 3CWKA 1QQSA 1L6MA 1SA8A 5IO6A 5L8OA 5H9KA 2DM5A 1MX8A 4L3RA 3P6DA 3G7XA 2RA6A 1FENA 1ZNGA 2WQAE 3MVFA 2RQ0A 4OMWA 4LZUA 4YDAA 5H9NA 5LJGA 3WOVA 3PPTA 1S7DA 1GM6A 3ZUIA 5FQ7E 3RKGA 2NNEA 4IABA 2AT3X 3HWDA 1TOWA 4QGWA 2BS6A 5BVQA 3O2YA 4U8UN 4ORWA 4A1HA 4I95A 5C0NA 1HN2A 1QFVA 1X8QA 4L1NA 2OZQA 3NR3A 3NP1A 5B27A 2BLGA 3ZW1B 3ZW0B 1SY0A 2AT5X 4YGGA 2W2BA 4NP1A 4PJ2A 4AZQA 4TKBA 3FR2A 4GU8A 1NP4A 4LZVA 4TLJA 1DZPA 3HWGA 3S60A 1OBQA 1QFTA 3P6EA 1OEEA 2AKQA 4ES7A 4N7DA 5LJEA 2RD7C 3U0DA 3D95A 4GETA 1OPAA 3FELA 4CV7A 1SMPI 4AW8A 1BRPA 1E06A 3P6CA 1Y9TA 1X8UA 1HBPA 4YKOA 5H8TA 3BY0A 4N7CA 1AELA 1I4UA 3IFBA 3RZYA 5KHPA 1O8VA 2JU8A 3TGAA 1U18A 2JMBA 4XMHA 3FA9A 2YMSA 5LKEA 1LNMA 1I06A 4ID2A 2HMBA 4K19A 1B56A 2W2FA 1VYFA 4YFRA 2FR3A 3D96A 3OD9A 5HBSA 4CSBA 4QQ1A 1EI5A 2M4LA 1D2UA 3HOLA 1AB0A 1IKEA 4O3YA 1KT4A 4WBKA 5AEOA 2CM4A 3D4RA 5HTEA 2WR6A 4YFPA 1X89A 2ACOA 3E3CA 5DPQA 3DTQA 2FTBA 1JJXA 1FE3A 1GT5A 3LV4A 2GTFX 4I6SA 1ACDA 3ZW2A 5D48A 5K06A 1FEMA 3KFHA 5KIDA 3KFGA 2E4JA 4NYRA 4AZOA 5DG4A 4YFQA 3U03A 3WJDA 2XKLA 2AT6X 4U8UM 3WVMA 2PY1A 4M7MA 4EQAC 5EDBA 1ICNA 5FAZA 4O3WA 2MO5A 3STKA 1AVGI 1CBQA 2RCQA 1EIOA 1DF3A 3FEPA 3FR4A 3FA8A 2NP1A 5BVTA 3BLGA 2X8SA 1EXSA 3PECA 3B2HA 2QO6A 1KT5A 3C77X 5FFHA 1KQWA 1JZUA 1EPBA 2BT9A 2OFMX 2Z4IA 1SXYA 4YDBA 4O4UA 1TVQA 1JBHA 4GNWA 1SY3A 2P8GA 5HZQA 2QO5A 1MUPA 1TXLA 1ZNLA 1KZXA 3SOTA 3VG4A 4NLJA 2CM9A 3AKMA 3K3LA 4A1YA 5L8IA 4O4OA 3TZSA 5LJDA 3O19A 1TW4A 3FMZA 2WWPA 5FQ8E 4ON1A 1BSYA 2Q4NA 3EBKA 4RUUA 2F73A 2NNQA 1AQBA 3VG2A 2OVEA 2W2AA 4RUNA 1U0XA 4MIRA 4PSQA 5HZ6A 3VE2A 3I17A 4O9SA 2JW1A 5AQ6A 3RSWA 2HLVA 5JR8A 4ZGUA 4GH7A 4MISA 1X8NA 1JV4A 3FENA 1EQDA 3GE2A 4TNNA 5HTDA 1T68X 2Q9SA 3BU9A 1A3YA 1EW3A 3EMMA 1ZRYA 3HWEA 3B2IA 3VPJE 3ZI8A 4GDZA 2JU3A 4YCEA 5IO7A 3WJFA 1QY1A 1A18A 3NADA 4ZHDA 2FT9A 4O4SA 1QY2A 1HMTA 5AJBA 3ZW0A 4AYHA 1YP6A 3KZAA 1CRBA 3QKGA 2X45A 3APUA 1X8PA 4FBRA 2Q2PA 3AKNA 4YBPA 2NNDA 4ML7B 1RBPA 1IFBA 4XMDA 5EPQA 3JS1A 1O1UA 1BWYA 1DZJA 4NNTA 4ZH9A 4EFGA 2KTSA 3JSQA 4BOEA 1OBUA 2OVAA 4Y0RA 1MX7A 2KW1A 4IMOA 4ZHCA 3NX2A 1ERBA 4I3CA 3UEUA 2F09A 1EALA 1JYJA 3CMPA 4I3DA 1G7NA 2X46A 1XKIA 4KT5A 5HZ5A 1E00A 1LPJA 5HZ8A 4NLIA 2GTLN 5HZ9A 2AT0X 4DQ3A 1ZNKA 4I3BA 4M6SA 4EEJA 3TGBA 5LKFA 1QG5A 2A2GA 4FQBB 1JIWI 3BU1A 3BX7A 1ZNDA 2HZRA 3VG3A 1FTPA 3S5VA 1ALBA 2QM9A 2JOZA 2ZAGA 1IFCA 1QWDA 1ADLA 1SY1A 4INNA 1TOUA 2WSJA 3IA8A 4OS8A 2ANSA 3P24A 3TF6A 4OS3A 4FGIB 2MHDA 1LFOA 4I9SA 4TJZA 3WBGA 3FYFA 1QY0A 1X8OA 4AZMA 4CK4A 1LIFA 1B4MA 2G7BA 2KTDA 1G5WA 4KIIA 5CYBA 2AH7X 2WQ9A 1ZNHA 3FIQA 1B8EA 2CZUA 2FR2A 5IO5A 4TKHA 1I05A 3F6ZB 1VPRA 2OFRX 2L67A 4QZTA 2LBVA 4IB9A 2X8FA 2EU7X 1GT1A 4QYPA 4U3QA 5L8NA 1LF7A 4IBAA 5H9AA 1RLBE 3P6HA 1GT3A 5KICA 3C78X 4U8UO 4U9CA 2A0AA 3KFFA 3ZQ3A 5LJHA 3FEKA 1KZWA 5D45A 1XCAA 3HOEA 5B29A 3APWA 4GKCA 5F1EA 3ELXA 1PEEA 3DSZA 1OEJA 1LIDA 3WJBA 1YIVA 1OPBA 4IB8A 2ZAIA 2A3FX 4QRLA 1D3SA 3ZZVA 4QZUA 2WUTA 2G79A 1EIIA 3OE3A 1IKJA 2MWHA 3MX7A 2RN4A 3O22A 4BQUA 2ACPX 1MVGA 4XMFA 3JQOA 1YWDA 4FBVA 4D6AA 1ICMA 1EUOA 4O3ZA 2ASNX 3HWFA 4HPAA 1GT4A 5LJBA 3KQ0A 3NX1A 4IB7A 4MVLA 3STMX 4Y0PA 4A8ZA 4EDEA 2GJ5A 1SXXA 4ORYA 1E02A 1P6PA 4ZFXA 2GTLM 1CBRA 2IFBA 3VG6A 2GTLO 4Y0SA 1HMSA 3VG7A 1YWAA 3NPOA 4MVEA 1OBPA 5D47A 4ZHFA 3ZUOA 4TQ2A 3CR6A 4LQZA 3RBYA 3MBTA 3EM0A 1I04A 2A13A 4GNYA 5F7GA 1E5PA 1GKAB 2R73A 2AMMX 4AZPA 1B0OA 3ELZA 1X71A 3FLLA 3S26A 3V8UA 1LIBA 1U17A 2JU7A 3VE1A 2LBAA 3TGCA 4MVKA 1DZMA 5LJKA 2X8TA 4FBOA 3C76X 4EXZA 4ZHGA 1MDCA 4D6BA 4KC8A 4GE1A 3OBLA 1KT7A 5BVSA 1BLRA 1S2PA 4ZHHA 1VYGA 1ML7A 5D4AA 1T8VA 3HK1A 4OMXA 4XMEA 2MJIA 3P6GA 3WJEA 3EYCA 3HTYA 5EEEA 5EEDA 3RWXA 2KT4B 2O62A 1KGLA 3BRNA 3ZW1A 2L68A 2FS7A 1NP1A 2FS6A 4WHIA 1A57A 4QYNA 1CBIA 1FELA 2LFOA 2R74A 2WEXA 3FA6A 1O1VA 1G74A 1KXOA 1A2DA 2LKKA 4MVIA 5BYPA 4IMNA 4KH8A 3I0AA 3B2KA 3FA7A 5F58A 4AZNA 1IW2A 3D97A 1KQXA 3NQ3A 1T0VA 1PMPA 5HA0A 3STNA 2CZTA 5CE4A 1Y9LA 4NW4A 1OEKA 5HCDC 2WEWA 4ZH6A 1JJJA 1JYDA 3BDRA 2L5PA 1BBPA 3UEVA 4TKJA 2N93A 1HBQA 1YWCA 4GZVA 4ZGFA 2LB6A 3B2JA 3SAOA 1EPAA 2QOSC 5EDCA 4QAEA 2Z4HA 5FQ6E 3CBSA 3F8AA 2ALLX 2MM3A 2LA7A 4GK9A 4LKPA 4YCHA 2CBRA 2KD2A 3PQSA 1SXWA 4YGZA 3U9PC 1H91A 4ALBA 3F9DA 4IAWA 2AL0X 4HPCA 3VG5A 3WJGA 1HQPA 4ZR2A 3BX8A 5FENA 4YBUA 2XSTA 3GAQA 3KFIA 4ORRA 3LHNA 4HPBA 1G85A 1FDQA 5F6BA 3FW5A 4HFOA 4IAXA 1LICA 3EBWA 1GX8A 3N91A 3CBCA 2BS5A 1BSOA 2K62A 4UU3A 4NYQA 4ARHA 2AT8X 4QNIA 5LJCA 5EZ2A 2QMIA 4ZJ0A 1UREA 3FW4A 1CJ5A 3CQNA 4O49A 2R56A 2Q39A 4HWMA 1DZKA 2POAA 1IIUA 4QGXA 1BJ7A 2K23A 2FLJA 2YG2A 3UEWA 4A60A 3P6FA 1Z24A 4QGVA 4ORUA 3FR5A 3OJYC 1S44A 1GXAA 1BEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW1 B;  3ZW0 B;  2BT9 A;  4I6S A;  3ZI8 A;  5AJB A;  3ZW2 A;  3ZW0 A;  3ZZV A;  3ZW1 A;  2BS6 A;  3ZWE A;  2BS5 A;  5AJC A; 
#chains in the Genus database with same CATH topology
 2RTQ B;  4WFV A;  3APX A;  2GC9 A;  4ALO A;  3L4R A;  1DV9 A;  4IB6 A;  4KCA A;  2AVI A;  2I5Z O;  4LKT A;  4ODD A;  1Y0G A;  1STR B;  2I5V O;  4UU2 A;  4WFU A;  1VWP B;  3Q6L A;  4YKM A;  5D8J A;  2BHV A;  2JN3 A;  1DC9 A;  4BVM A;  4COT A;  3UEX A;  2FRS A;  5HCC C;  4NNS A;  1BM5 A;  1KL5 A;  1N0S A;  4GRJ A;  1UYO X;  2DJF A;  3PH6 A;  4KC7 A;  4O3X B;  2QO4 A;  3PH5 A;  4I9R A;  2X56 A;  4YMY A;  1HQQ A;  1PM1 X;  3APV A;  2FGS A;  2HZQ A;  3SZJ A;  2OL7 A;  1NGL A;  1SY2 A;  2FHL A;  4OS0 A;  1BSQ A;  1GGL A;  3PQU A;  2HYS A;  3T1D A;  3H3I A;  5AJC A;  1KT3 A;  5HAE A;  2OVD A;  2L9C A;  2RTR B;  5L3Y A;  3VGW A;  1LKE A;  3B2L A;  4R0B A;  1K24 A;  3T2X A;  2A2U A;  1SRE A;  4JHQ A;  3VU1 A;  3WXQ A;  1KT6 A;  1NBX A;  3NQ9 A;  4Y59 A;  2IZC B;  2RCT A;  4XMC A;  1LIE A;  4GGZ A;  1R0U A;  4CPE A;  2OVS A;  4JGL A;  5HA1 A;  5H9L A;  4BX6 A;  1KL4 A;  1GX9 A;  3BS2 A;  3PP6 A;  4DQ4 A;  3CQR A;  1CBS A;  1ZNE A;  2RTJ A;  2FWV A;  4XMG A;  1GKA A;  3SLO A;  3WJC A;  3BSZ E;  4Y0Q A;  1SXU A;  2AF5 A;  2G78 A;  1DFV A;  1HMR A;  4YH0 A;  5HCE C;  1PBO A;  1KOI A;  1ERX A;  2HNX A;  4ORS A;  5HWZ A;  1YWB A;  1YP7 A;  2C1Q A;  1UZ2 X;  2Q2M A;  4AZR A;  4O4X A;  3PED A;  3NQK A;  3P02 A;  1JMX A;  4ORX A;  2G8C O;  3S5X A;  1GX3 A;  4HPD A;  3ZWE A;  3UAQ A;  2RTN B;  1IJ8 A;  1SWT A;  3NBX X;  1SWU A;  2CBS A;  1PBY A;  1SWD A;  1QAB E;  1YUP A;  4YGH A;  5F6Z A;  1LEL A;  1BRQ A;  4ZCB A;  3CWK A;  1AVD A;  1QQS A;  2OY8 A;  3Q34 A;  1L6M A;  4CPI A;  1SA8 A;  5IO6 A;  5L8O A;  3VHM A;  5H9K A;  2DM5 A;  2BSZ A;  1MX8 A;  4L3R A;  3P6D A;  3G7X A;  2RA6 A;  2VFC A;  1FEN A;  1ZNG A;  2WQA E;  3MVF A;  2RQ0 A;  4OMW A;  4LZU A;  4YDA A;  5H9N A;  5LJG A;  3WOV A;  3PPT A;  1S7D A;  1GM6 A;  3ZUI A;  1VWQ B;  2QCB A;  3EW2 A;  1SWN A;  5FQ7 E;  3RKG A;  2NNE A;  4IAB A;  2AT3 X;  2ZSC A;  3HWD A;  1TOW A;  4QGW A;  4Z2P A;  1SWR A;  2BS6 A;  5BVQ A;  2CAM A;  3O2Y A;  4ORW A;  1SWE A;  4U8U N;  4A1H A;  4I95 A;  5IRA A;  5C0N A;  1SWH A;  1N4J A;  1HN2 A;  1QFV A;  1X8Q A;  4L1N A;  1RAV A;  2OZQ A;  1VWO B;  3NR3 A;  3NP1 A;  3PDF A;  4BBO A;  5B27 A;  2A5C A;  5FQ6 E;  2BLG A;  3ZW1 B;  3ZW0 B;  1SY0 A;  1SWF A;  1SRI A;  1Y52 X;  2AT5 X;  2W2B A;  4YGG A;  4NP1 A;  2WPU A;  5B11 O;  2C1S A;  2OY5 O;  2VFB A;  4PJ2 A;  4AZQ A;  4TKB A;  3FR2 A;  3WZN A;  4GU8 A;  1NP4 A;  4LZV A;  4GDA A;  2OL8 O;  5B3M O;  4TLJ A;  1DZP A;  1SWS A;  1LCZ A;  3HWG A;  2RTL A;  3S60 A;  1OBQ A;  1QFT A;  3P6E A;  1OEE A;  1VWI B;  1W5R A;  1SWG A;  2AKQ A;  2HKD A;  4N7D A;  3KVN A;  2RD7 C;  4ES7 A;  1RSU B;  5LJE A;  3U0D A;  3D95 A;  4GET A;  1OPA A;  3FEL A;  4CV7 A;  1SMP I;  4AW8 A;  1BRP A;  1E06 A;  3P6C A;  2DJG A;  1Y9T A;  1X8U A;  1HBP A;  4YKO A;  2RTH B;  5H8T A;  3BY0 A;  4N7C A;  1AEL A;  1FJ1 E;  1I4U A;  3IFB A;  3RZY A;  2MF6 A;  1O8V A;  5KHP A;  2JU8 A;  3RDM A;  3TGA A;  4CPH A;  1WBI A;  1U18 A;  1VWF B;  2JMB A;  2G5L A;  3FA9 A;  4XMH A;  3SLJ A;  2YMS A;  5LKE A;  1LNM A;  1I06 A;  4ID2 A;  2HMB A;  4YVB A;  4K19 A;  1B56 A;  2W2F A;  1VYF A;  4YFR A;  2FR3 A;  3D96 A;  3OD9 A;  5HBS A;  4CSB A;  2IZF B;  4QQ1 A;  3SZH A;  1EI5 A;  2M4L A;  4GJV A;  3CKF A;  1D2U A;  1VWA B;  3HOL A;  1AB0 A;  4BX7 B;  1IKE A;  2X34 A;  1KT4 A;  4O3Y A;  4WBK A;  5AEO A;  2CM4 A;  3D4R A;  5HTE A;  2WR6 A;  4YFP A;  1X89 A;  2ACO A;  4Z6J A;  2X32 A;  3E3C A;  5DPQ A;  3DTQ A;  2FTB A;  4Z27 A;  1JJX A;  3VHH A;  1FE3 A;  1GT5 A;  1W4T A;  1LUQ A;  1RST B;  3LV4 A;  2GTF X;  2OL6 O;  4I6S A;  1ACD A;  3ZW2 A;  5D48 A;  3D9W A;  3RY1 A;  1K3B A;  5K06 A;  1FEM A;  3KFH A;  5KID A;  3KFG A;  2E4J A;  4NYR A;  3RE6 A;  2QOM A;  5DG4 A;  4AZO A;  4YFQ A;  3U03 A;  3WJD A;  1VWJ B;  2XKL A;  2AT6 X;  4U8U M;  3WVM A;  2PY1 A;  2OY7 A;  4BX5 B;  5CHK A;  4M7M A;  4EQA C;  5EDB A;  1ICN A;  5FAZ A;  1SWK A;  2MO5 A;  4O3W A;  2OF9 A;  2X4M A;  3STK A;  1AVG I;  1CBQ A;  3RY2 A;  2RCQ A;  2IZK A;  1EIO A;  1DF3 A;  3FEP A;  3FR4 A;  2IZB A;  3FA8 A;  2NP1 A;  4Z2V A;  5BVT A;  3BLG A;  4OKA A;  2X8S A;  1EXS A;  3PEC A;  3B2H A;  2QO6 A;  1KT5 A;  3C77 X;  4B55 A;  5FFH A;  1SLD B;  1SWL A;  3RDS A;  1KQW A;  3RDQ A;  1EPB A;  2BT9 A;  2OFM X;  2Z4I A;  1SXY A;  4YDB A;  3VHI A;  1JZU A;  2RTM A;  1VWC B;  3X00 A;  2RTF B;  4O4U A;  1TVQ A;  2UYW A;  1JBH A;  4JO6 A;  4GNW A;  1SY3 A;  3HPE A;  2P8G A;  5HZQ A;  2QO5 A;  1MUP A;  1TXL A;  1ZNL A;  1KZX A;  3SOT A;  3VG4 A;  4NLJ A;  3FID A;  2CM9 A;  3AKM A;  3K3L A;  4A1Y A;  5L8I A;  4O4O A;  2VDF A;  2Y32 A;  1MM9 A;  3TZS A;  2F01 A;  3QQ2 A;  3O19 A;  1TW4 A;  5LJD A;  3FMZ A;  5BYP A;  2C4I A;  2WWP A;  5FQ8 E;  4ON1 A;  3WZP A;  1BSY A;  5JD2 A;  3T6L A;  2Q4N A;  3EBK A;  4RUU A;  1VWE B;  2F73 A;  1W6F A;  2NNQ A;  2IZA A;  1AQB A;  3VG2 A;  2OVE A;  1SWA A;  4BX6 B;  2FHN X;  2W2A A;  4RUN A;  1U0X A;  3RDO A;  4MIR A;  4PSQ A;  5HZ6 A;  3VE2 A;  3I17 A;  1SLG B;  4O9S A;  2JW1 A;  3CKG A;  5AQ6 A;  3RSW A;  2HLV A;  5IRU A;  4ZGU A;  2A5B A;  4GH7 A;  5JR8 A;  4MIS A;  1X8N A;  1JV4 A;  2RTK A;  1LCV A;  3FEN A;  1EQD A;  1I78 A;  3GE2 A;  4TNN A;  5HTD A;  1T68 X;  2Q9S A;  3BU9 A;  1A3Y A;  1EW3 A;  3EMM A;  1N9M A;  1ZRY A;  2OFB A;  3PK2 A;  3HWE A;  3B2I A;  3VPJ E;  3ZI8 A;  1AVE A;  1JJU A;  2JU3 A;  1LCW A;  1STS B;  4GDZ A;  4YCE A;  5IO7 A;  3WJF A;  2JGS A;  1QY1 A;  1A18 A;  3NAD A;  1NQN A;  1VWN B;  4ZHD A;  2FT9 A;  3FDC A;  1QY2 A;  4O4S A;  1HMT A;  5AJB A;  3ZW0 A;  4GD9 A;  1YP6 A;  3KZA A;  1CRB A;  3QKG A;  4AYH A;  2X45 A;  3APU A;  1X8P A;  2IZJ A;  4FBR A;  2Q2P A;  3AKN A;  4YBP A;  2NND A;  1E2T A;  1RBP A;  4ML7 B;  1IFB A;  5B5F A;  4XMD A;  5EPQ A;  3JS1 A;  1O1U A;  1BWY A;  1DZJ A;  4NNT A;  4ZH9 A;  4EFG A;  2IZG B;  2KTS A;  3JSQ A;  4BOE A;  1OBU A;  2OVA A;  4Y0R A;  1MX7 A;  2KW1 A;  4IMO A;  4C5P A;  3NX2 A;  1ERB A;  2Y3E A;  4I3C A;  4ZHC A;  5B5G A;  3UEU A;  3WZQ A;  1RXJ A;  2F09 A;  1EAL A;  1JYJ A;  3CMP A;  4I3D A;  2IZI A;  1G7N A;  2X46 A;  1XKI A;  4KT5 A;  5HZ5 A;  1E00 A;  1LPJ A;  1PTS A;  4NLI A;  2GTL N;  5HZ9 A;  5HZ8 A;  2FKJ A;  2AT0 X;  4GJS A;  1ZNK A;  4I3B A;  4M6S A;  1SLF B;  4DQ3 A;  4EEJ A;  3TGB A;  1VWM B;  5LKF A;  1QG5 A;  2A2G A;  4FQB B;  1JIW I;  3BU1 A;  3AEH A;  3BX7 A;  1ZND A;  1KL3 A;  2HZR A;  1I9H A;  1FTP A;  2IZH B;  4OEM A;  1ALB A;  2QM9 A;  3S5V A;  3VG3 A;  2JOZ A;  2ZAG A;  1IFC A;  4CDE A;  3RDX A;  1QWD A;  1KFF A;  2RTP B;  1ADL A;  1SY1 A;  4CPF A;  5KIC A;  4INN A;  1TOU A;  2WSJ A;  3IA8 A;  4OS8 A;  2ANS A;  3P24 A;  2IZL B;  3TF6 A;  4OS3 A;  4FGI B;  3SLT A;  2MHD A;  1LFO A;  4I9S A;  4TJZ A;  3WBG A;  3FYF A;  1QY0 A;  1X8O A;  4AZM A;  4CK4 A;  1LIF A;  1B4M A;  2OYB O;  1SWQ A;  2G7B A;  2KTD A;  1G5W A;  1HXL A;  5K68 A;  4KII A;  1SWB A;  5CYB A;  2AH7 X;  2BC3 A;  2WQ9 A;  1NQM A;  1ZNH A;  2A8G A;  3FIQ A;  1B8E A;  2CZU A;  2FR2 A;  5IO5 A;  4TKH A;  1I05 A;  3F6Z B;  1VPR A;  2OFR X;  1SRF A;  2L67 A;  4QZT A;  2LBV A;  5IRW A;  4IB9 A;  2X8F A;  2EU7 X;  1GT1 A;  4QYP A;  4U3Q A;  5L8N A;  1LF7 A;  4IBA A;  5H9A A;  1RLB E;  3MM0 A;  1GT3 A;  3P6H A;  4BX5 A;  3C78 X;  1HY2 A;  4U8U O;  1RXK A;  2A0A A;  3KFF A;  4U9C A;  3FEK A;  3ZQ3 A;  5LJH A;  1KZW A;  5D45 A;  1XCA A;  2RTB B;  3HOE A;  5B29 A;  3APW A;  3AUM O;  4GKC A;  3ELX A;  5F1E A;  1PEE A;  4GGT A;  3DSZ A;  3SZI A;  1OEJ A;  1LID A;  3WJB A;  1YIV A;  4CDF A;  3WYP A;  1OPB A;  4IB8 A;  2ZAI A;  2A3F X;  4QRL A;  1SRJ A;  1D3S A;  3ZZV A;  4QZU A;  2WUT A;  2G79 A;  1MEP A;  1N7Y A;  3OE3 A;  1EII A;  1IKJ A;  2MWH A;  3MX7 A;  2RN4 A;  3O22 A;  4BGF A;  4BQU A;  1SRG A;  2ACP X;  4DCB A;  1MVG A;  4XMF A;  4CDC A;  1VWL B;  4U46 A;  3JQO A;  1VWB B;  1YWD A;  4FBV A;  1ICM A;  1EUO A;  2RTG B;  2ASN X;  3HWF A;  4HPA A;  1GT4 A;  4O3Z A;  4D6A A;  3KQ0 A;  5LJB A;  3WZO A;  1LDO A;  3NX1 A;  4IB7 A;  4MVL A;  3STM X;  4Y0P A;  5F2B A;  4A8Z A;  2GJ5 A;  2PI3 O;  1SXX A;  4EDE A;  4ORY A;  1E02 A;  1P6P A;  4ZFX A;  2GTL M;  1CBR A;  1N9Y A;  2IFB A;  3VG6 A;  2GTL O;  2RTE B;  1HMS A;  4Y0S A;  3VG7 A;  1YWA A;  3NPO A;  4MVE A;  1OBP A;  5D47 A;  4ZHF A;  3ZUO A;  4TQ2 A;  3CR6 A;  4LQZ A;  3RBY A;  1MOY A;  3MBT A;  1STP A;  3MG5 A;  3EM0 A;  2RTC B;  1SWJ A;  1I04 A;  1SWO A;  2A13 A;  4GNY A;  5F7G A;  4Z28 A;  1E5P A;  1GKA B;  1SRH A;  2R73 A;  2AMM X;  3T2W A;  4AZP A;  1B0O A;  3ELZ A;  1X71 A;  3FLL A;  3S26 A;  3V8U A;  2OY1 O;  2IZD B;  4GUZ A;  1LIB A;  1U17 A;  2UZ2 A;  2JU7 A;  3VE1 A;  2Y3F A;  1VWR B;  2LBA A;  3TGC A;  4MVK A;  1DZM A;  5LJK A;  2X8T A;  4FBO A;  1RXH A;  3C76 X;  3RE5 A;  1MDC A;  4D6B A;  4EXZ A;  4KC8 A;  1LDQ A;  4NV7 A;  4ZHG A;  1DF8 A;  4GE1 A;  3OBL A;  1KT7 A;  5BVS A;  5K67 A;  1SWP A;  1BLR A;  1NDJ A;  1S2P A;  4ZHH A;  1VYG A;  1ML7 A;  5D4A A;  1T8V A;  3HK1 A;  4OMX A;  4XME A;  2MJI A;  3P6G A;  3WJE A;  1SWC A;  3EYC A;  3HTY A;  5EEE A;  5EED A;  3RWX A;  1VYO A;  2KT4 B;  5CSE A;  2O62 A;  1KGL A;  3BRN A;  3ZW1 A;  3LTW A;  5IXG A;  2L68 A;  2FS7 A;  3WYQ A;  1NC9 A;  1NP1 A;  2FS6 A;  3EW1 A;  4QYN A;  4WHI A;  1A57 A;  1CBI A;  1FEL A;  2LFO A;  2R74 A;  2WEX A;  3FA6 A;  1O1V A;  1G74 A;  1KXO A;  1A2D A;  2GH7 A;  2LKK A;  4MVI A;  4IMN A;  4KH8 A;  3I0A A;  3B2K A;  3FA7 A;  5F58 A;  4AZN A;  1IW2 A;  1N43 A;  4DNE A;  3D97 A;  1KQX A;  4Z2O A;  3NQ3 A;  1T0V A;  1SLE B;  1PMP A;  2OFA A;  5HA0 A;  3STN A;  2CZT A;  1OSP O;  5CE4 A;  1Y53 X;  4NV8 A;  2RTA A;  1Y9L A;  2RTI B;  4NW4 A;  1OEK A;  5HCD C;  1JQP A;  2WEW A;  4ZH6 A;  1JJJ A;  1JYD A;  3BDR A;  2L5P A;  4EKV A;  1BBP A;  3UEV A;  1WUB A;  4TKJ A;  1VWK B;  2N93 A;  3EC5 A;  1HBQ A;  1VWH B;  1MK5 A;  4OEL A;  1YWC A;  4BCS A;  4GZV A;  1Y55 X;  4ZGF A;  2LB6 A;  4GGR A;  3B2J A;  3SAO A;  1EPA A;  2QOS C;  5B2A O;  5EDC A;  2IZE B;  2Z4H A;  4QAE A;  3CBS A;  3F8A A;  2ALL X;  2MM3 A;  2LA7 A;  4GK9 A;  4LKP A;  4YCH A;  2CBR A;  2KD2 A;  3PQS A;  1SXW A;  4I60 A;  4YGZ A;  3U9P C;  1H91 A;  4ALB A;  3F9D A;  4IAW A;  2AL0 X;  4BX7 A;  4Y5D A;  4MEE A;  4HPC A;  3VG5 A;  3WJG A;  1HQP A;  4ZR2 A;  3BX8 A;  5FEN A;  4YBU A;  2XST A;  3GAQ A;  3KFI A;  4ORR A;  4CPH B;  3LHN A;  3T6F A;  4HPB A;  1G85 A;  1FDQ A;  1VWD B;  5F6B A;  2FKG A;  3FW5 A;  4HFO A;  4IAX A;  4CDD A;  1LIC A;  3EBW A;  1GX8 A;  3N91 A;  3CBC A;  2BS5 A;  1BSO A;  4IRW A;  1HXZ A;  2K62 A;  2RTO B;  4NYQ A;  4UU3 A;  2AT8 X;  4QNI A;  4ARH A;  5LJC A;  5EZ2 A;  1VWG B;  2QMI A;  1URE A;  3FW4 A;  4ZJ0 A;  1CJ5 A;  3CQN A;  4O49 A;  2R56 A;  2Q39 A;  4HWM A;  1DZK A;  1UYN X;  2POA A;  1IIU A;  2OF8 A;  4QGX A;  4BJ8 A;  1BJ7 A;  1JMZ A;  2K23 A;  2X55 A;  2FLJ A;  3RDU A;  4JNJ A;  2YG2 A;  3UEW A;  5B10 O;  4A60 A;  2RTD B;  3P6F A;  1Z24 A;  4QGV A;  4ORU A;  3FR5 A;  3OJY C;  1S44 A;  1GXA A;  1BEB A; 
#chains in the Genus database with same CATH homology
 4WFV A;  3APX A;  2GC9 A;  4ALO A;  3L4R A;  1DV9 A;  4IB6 A;  4KCA A;  4LKT A;  4ODD A;  4WFU A;  4YKM A;  4UU2 A;  3Q6L A;  5D8J A;  2BHV A;  2JN3 A;  1DC9 A;  4BVM A;  4COT A;  3UEX A;  2FRS A;  5HCC C;  4NNS A;  1BM5 A;  1N0S A;  4GRJ A;  4KC7 A;  3PH6 A;  4O3X B;  2QO4 A;  3PH5 A;  4I9R A;  4YMY A;  1PM1 X;  3APV A;  2HZQ A;  1NGL A;  1SY2 A;  4OS0 A;  1BSQ A;  1GGL A;  3PQU A;  2HYS A;  3T1D A;  3H3I A;  5AJC A;  1KT3 A;  5HAE A;  2OVD A;  2L9C A;  1LKE A;  3B2L A;  4R0B A;  2A2U A;  3VU1 A;  3WXQ A;  1KT6 A;  3NQ9 A;  2RCT A;  4XMC A;  1LIE A;  1R0U A;  2OVS A;  4JGL A;  5HA1 A;  5H9L A;  1GX9 A;  3BS2 A;  3PP6 A;  4DQ4 A;  3CQR A;  1CBS A;  1ZNE A;  2FWV A;  4XMG A;  1GKA A;  3WJC A;  3BSZ E;  4Y0Q A;  1SXU A;  2G78 A;  4YH0 A;  1DFV A;  1HMR A;  5HCE C;  1PBO A;  1KOI A;  1ERX A;  2HNX A;  4ORS A;  5HWZ A;  1YWB A;  1YP7 A;  1UZ2 X;  2Q2M A;  4AZR A;  4O4X A;  3PED A;  3NQK A;  3P02 A;  4ORX A;  3S5X A;  3ZWE A;  4HPD A;  3UAQ A;  3NBX X;  2CBS A;  1QAB E;  1YUP A;  4YGH A;  5F6Z A;  1BRQ A;  4ZCB A;  3CWK A;  1QQS A;  1L6M A;  1SA8 A;  5IO6 A;  5L8O A;  5H9K A;  2DM5 A;  1MX8 A;  4L3R A;  3P6D A;  3G7X A;  2RA6 A;  1FEN A;  1ZNG A;  2WQA E;  3MVF A;  2RQ0 A;  4OMW A;  4LZU A;  4YDA A;  5H9N A;  5LJG A;  3WOV A;  3PPT A;  1S7D A;  1GM6 A;  3ZUI A;  5FQ7 E;  3RKG A;  2NNE A;  4IAB A;  2AT3 X;  3HWD A;  1TOW A;  4QGW A;  2BS6 A;  5BVQ A;  3O2Y A;  4U8U N;  4ORW A;  4A1H A;  4I95 A;  5C0N A;  1HN2 A;  1QFV A;  1X8Q A;  4L1N A;  2OZQ A;  3NR3 A;  3NP1 A;  5B27 A;  2BLG A;  3ZW1 B;  3ZW0 B;  1SY0 A;  2AT5 X;  4YGG A;  2W2B A;  4NP1 A;  4PJ2 A;  4AZQ A;  4TKB A;  3FR2 A;  4GU8 A;  1NP4 A;  4LZV A;  4TLJ A;  1DZP A;  3HWG A;  3S60 A;  1OBQ A;  1QFT A;  3P6E A;  1OEE A;  2AKQ A;  4ES7 A;  4N7D A;  5LJE A;  2RD7 C;  3U0D A;  3D95 A;  4GET A;  1OPA A;  3FEL A;  4CV7 A;  1SMP I;  4AW8 A;  1BRP A;  1E06 A;  3P6C A;  1Y9T A;  1X8U A;  1HBP A;  4YKO A;  5H8T A;  3BY0 A;  4N7C A;  1AEL A;  1I4U A;  3IFB A;  3RZY A;  5KHP A;  1O8V A;  2JU8 A;  3TGA A;  1U18 A;  2JMB A;  4XMH A;  3FA9 A;  2YMS A;  5LKE A;  1LNM A;  1I06 A;  4ID2 A;  2HMB A;  4K19 A;  1B56 A;  2W2F A;  1VYF A;  4YFR A;  2FR3 A;  3D96 A;  3OD9 A;  5HBS A;  4CSB A;  4QQ1 A;  1EI5 A;  2M4L A;  1D2U A;  3HOL A;  1AB0 A;  1IKE A;  4O3Y A;  1KT4 A;  4WBK A;  5AEO A;  2CM4 A;  3D4R A;  5HTE A;  2WR6 A;  4YFP A;  1X89 A;  2ACO A;  3E3C A;  5DPQ A;  3DTQ A;  2FTB A;  1JJX A;  1FE3 A;  1GT5 A;  3LV4 A;  2GTF X;  4I6S A;  1ACD A;  3ZW2 A;  5D48 A;  5K06 A;  1FEM A;  3KFH A;  5KID A;  3KFG A;  2E4J A;  4NYR A;  4AZO A;  5DG4 A;  4YFQ A;  3U03 A;  3WJD A;  2XKL A;  2AT6 X;  4U8U M;  3WVM A;  2PY1 A;  4M7M A;  4EQA C;  5EDB A;  1ICN A;  5FAZ A;  4O3W A;  2MO5 A;  3STK A;  1AVG I;  1CBQ A;  2RCQ A;  1EIO A;  1DF3 A;  3FEP A;  3FR4 A;  3FA8 A;  2NP1 A;  5BVT A;  3BLG A;  2X8S A;  1EXS A;  3PEC A;  3B2H A;  2QO6 A;  1KT5 A;  3C77 X;  5FFH A;  1KQW A;  1JZU A;  1EPB A;  2BT9 A;  2OFM X;  2Z4I A;  1SXY A;  4YDB A;  4O4U A;  1TVQ A;  1JBH A;  4GNW A;  1SY3 A;  2P8G A;  5HZQ A;  2QO5 A;  1MUP A;  1TXL A;  1ZNL A;  1KZX A;  3SOT A;  3VG4 A;  4NLJ A;  2CM9 A;  3AKM A;  3K3L A;  4A1Y A;  5L8I A;  4O4O A;  3TZS A;  5LJD A;  3O19 A;  1TW4 A;  3FMZ A;  2WWP A;  5FQ8 E;  4ON1 A;  1BSY A;  2Q4N A;  3EBK A;  4RUU A;  2F73 A;  2NNQ A;  1AQB A;  3VG2 A;  2OVE A;  2W2A A;  4RUN A;  1U0X A;  4MIR A;  4PSQ A;  5HZ6 A;  3VE2 A;  3I17 A;  4O9S A;  2JW1 A;  5AQ6 A;  3RSW A;  2HLV A;  5JR8 A;  4ZGU A;  4GH7 A;  4MIS A;  1X8N A;  1JV4 A;  3FEN A;  1EQD A;  3GE2 A;  4TNN A;  5HTD A;  1T68 X;  2Q9S A;  3BU9 A;  1A3Y A;  1EW3 A;  3EMM A;  1ZRY A;  3HWE A;  3B2I A;  3VPJ E;  3ZI8 A;  4GDZ A;  2JU3 A;  4YCE A;  5IO7 A;  3WJF A;  1QY1 A;  1A18 A;  3NAD A;  4ZHD A;  2FT9 A;  4O4S A;  1QY2 A;  1HMT A;  5AJB A;  3ZW0 A;  4AYH A;  1YP6 A;  3KZA A;  1CRB A;  3QKG A;  2X45 A;  3APU A;  1X8P A;  4FBR A;  2Q2P A;  3AKN A;  4YBP A;  2NND A;  4ML7 B;  1RBP A;  1IFB A;  4XMD A;  5EPQ A;  3JS1 A;  1O1U A;  1BWY A;  1DZJ A;  4NNT A;  4ZH9 A;  4EFG A;  2KTS A;  3JSQ A;  4BOE A;  1OBU A;  2OVA A;  4Y0R A;  1MX7 A;  2KW1 A;  4IMO A;  4ZHC A;  3NX2 A;  1ERB A;  4I3C A;  3UEU A;  2F09 A;  1EAL A;  1JYJ A;  3CMP A;  4I3D A;  1G7N A;  2X46 A;  1XKI A;  4KT5 A;  5HZ5 A;  1E00 A;  1LPJ A;  5HZ8 A;  4NLI A;  2GTL N;  5HZ9 A;  2AT0 X;  4DQ3 A;  1ZNK A;  4I3B A;  4M6S A;  4EEJ A;  3TGB A;  5LKF A;  1QG5 A;  2A2G A;  4FQB B;  1JIW I;  3BU1 A;  3BX7 A;  1ZND A;  2HZR A;  3VG3 A;  1FTP A;  3S5V A;  1ALB A;  2QM9 A;  2JOZ A;  2ZAG A;  1IFC A;  1QWD A;  1ADL A;  1SY1 A;  4INN A;  1TOU A;  2WSJ A;  3IA8 A;  4OS8 A;  2ANS A;  3P24 A;  3TF6 A;  4OS3 A;  4FGI B;  2MHD A;  1LFO A;  4I9S A;  4TJZ A;  3WBG A;  3FYF A;  1QY0 A;  1X8O A;  4AZM A;  4CK4 A;  1LIF A;  1B4M A;  2G7B A;  2KTD A;  1G5W A;  4KII A;  5CYB A;  2AH7 X;  2WQ9 A;  1ZNH A;  3FIQ A;  1B8E A;  2CZU A;  2FR2 A;  5IO5 A;  4TKH A;  1I05 A;  3F6Z B;  1VPR A;  2OFR X;  2L67 A;  4QZT A;  2LBV A;  4IB9 A;  2X8F A;  2EU7 X;  1GT1 A;  4QYP A;  4U3Q A;  5L8N A;  1LF7 A;  4IBA A;  5H9A A;  1RLB E;  3P6H A;  1GT3 A;  5KIC A;  3C78 X;  4U8U O;  4U9C A;  2A0A A;  3KFF A;  3ZQ3 A;  5LJH A;  3FEK A;  1KZW A;  5D45 A;  1XCA A;  3HOE A;  5B29 A;  3APW A;  4GKC A;  5F1E A;  3ELX A;  1PEE A;  3DSZ A;  1OEJ A;  1LID A;  3WJB A;  1YIV A;  1OPB A;  4IB8 A;  2ZAI A;  2A3F X;  4QRL A;  1D3S A;  3ZZV A;  4QZU A;  2WUT A;  2G79 A;  1EII A;  3OE3 A;  1IKJ A;  2MWH A;  3MX7 A;  2RN4 A;  3O22 A;  4BQU A;  2ACP X;  1MVG A;  4XMF A;  3JQO A;  1YWD A;  4FBV A;  4D6A A;  1ICM A;  1EUO A;  4O3Z A;  2ASN X;  3HWF A;  4HPA A;  1GT4 A;  5LJB A;  3KQ0 A;  3NX1 A;  4IB7 A;  4MVL A;  3STM X;  4Y0P A;  4A8Z A;  4EDE A;  2GJ5 A;  1SXX A;  4ORY A;  1E02 A;  1P6P A;  4ZFX A;  2GTL M;  1CBR A;  2IFB A;  3VG6 A;  2GTL O;  4Y0S A;  1HMS A;  3VG7 A;  1YWA A;  3NPO A;  4MVE A;  1OBP A;  5D47 A;  4ZHF A;  3ZUO A;  4TQ2 A;  3CR6 A;  4LQZ A;  3RBY A;  3MBT A;  3EM0 A;  1I04 A;  2A13 A;  4GNY A;  5F7G A;  1E5P A;  1GKA B;  2R73 A;  2AMM X;  4AZP A;  1B0O A;  3ELZ A;  1X71 A;  3FLL A;  3S26 A;  3V8U A;  1LIB A;  1U17 A;  2JU7 A;  3VE1 A;  2LBA A;  3TGC A;  4MVK A;  1DZM A;  5LJK A;  2X8T A;  4FBO A;  3C76 X;  4EXZ A;  4ZHG A;  1MDC A;  4D6B A;  4KC8 A;  4GE1 A;  3OBL A;  1KT7 A;  5BVS A;  1BLR A;  1S2P A;  4ZHH A;  1VYG A;  1ML7 A;  5D4A A;  1T8V A;  3HK1 A;  4OMX A;  4XME A;  2MJI A;  3P6G A;  3WJE A;  3EYC A;  3HTY A;  5EEE A;  5EED A;  3RWX A;  2KT4 B;  2O62 A;  1KGL A;  3BRN A;  3ZW1 A;  2L68 A;  2FS7 A;  1NP1 A;  2FS6 A;  4WHI A;  1A57 A;  4QYN A;  1CBI A;  1FEL A;  2LFO A;  2R74 A;  2WEX A;  3FA6 A;  1O1V A;  1G74 A;  1KXO A;  1A2D A;  2LKK A;  4MVI A;  5BYP A;  4IMN A;  4KH8 A;  3I0A A;  3B2K A;  3FA7 A;  5F58 A;  4AZN A;  1IW2 A;  3D97 A;  1KQX A;  3NQ3 A;  1T0V A;  1PMP A;  5HA0 A;  3STN A;  2CZT A;  5CE4 A;  1Y9L A;  4NW4 A;  1OEK A;  5HCD C;  2WEW A;  4ZH6 A;  1JJJ A;  1JYD A;  3BDR A;  2L5P A;  1BBP A;  3UEV A;  4TKJ A;  2N93 A;  1HBQ A;  1YWC A;  4GZV A;  4ZGF A;  2LB6 A;  3B2J A;  3SAO A;  1EPA A;  2QOS C;  5EDC A;  4QAE A;  2Z4H A;  5FQ6 E;  3CBS A;  3F8A A;  2ALL X;  2MM3 A;  2LA7 A;  4GK9 A;  4LKP A;  4YCH A;  2CBR A;  2KD2 A;  3PQS A;  1SXW A;  4YGZ A;  3U9P C;  1H91 A;  4ALB A;  3F9D A;  4IAW A;  2AL0 X;  4HPC A;  3VG5 A;  3WJG A;  1HQP A;  4ZR2 A;  3BX8 A;  5FEN A;  4YBU A;  2XST A;  3GAQ A;  3KFI A;  4ORR A;  3LHN A;  4HPB A;  1G85 A;  1FDQ A;  5F6B A;  3FW5 A;  4HFO A;  4IAX A;  1LIC A;  3EBW A;  1GX8 A;  3N91 A;  3CBC A;  2BS5 A;  1BSO A;  2K62 A;  4UU3 A;  4NYQ A;  4ARH A;  2AT8 X;  4QNI A;  5LJC A;  5EZ2 A;  2QMI A;  4ZJ0 A;  1URE A;  3FW4 A;  1CJ5 A;  3CQN A;  4O49 A;  2R56 A;  2Q39 A;  4HWM A;  1DZK A;  2POA A;  1IIU A;  4QGX A;  1BJ7 A;  2K23 A;  2FLJ A;  2YG2 A;  3UEW A;  4A60 A;  3P6F A;  1Z24 A;  4QGV A;  4ORU A;  3FR5 A;  3OJY C;  1S44 A;  1GXA A;  1BEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...