3WYQA

Crystal structure of the low-immunogenic core streptavidin mutant lisa-314 (y22s/y83s/r84k/e101d/r103k/e116n) at 1.0 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
122
structure length
122
Chain Sequence
AEAGITGTWSNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNSKNAHSATTWSGQYVGGADAKINTQWLLTSGTTNANAWKSTLVGHDTFTKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biotin binding protein
molecule keywords Streptavidin
publication title Crystal structure of streptavidin mutant with low immunogenicity
pubmed doi rcsb
source organism Streptomyces avidinii
total genus 29
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3wyqA00
3RE5A 1VWBB 1SRGA 3RDMA 5CHKA 3T2XA 4GGZA 2RTIB 3WZQA 3WYPA 1LCVA 1LCWA 1SLDB 3VHMA 1SRHA 4U46A 1VWLB 1N9MA 2UZ2A 3RDQA 1VWPB 2IZJA 3SZHA 1SWHA 1N7YA 1Y52X 4Z28A 2AVIA 1VWGB 3T6LA 4GD9A 1DF8A 4CPEA 1SREA 1SWAA 1VWQB 2FHLA 2QCBA 4GJSA 1NC9A 3MG5A 1SRIA 1LUQA 1LELA 1KFFA 1SLGB 3RE6A 1SWDA 3SZJA 1WBIA 1PTSA 2GH7A 4Z27A 1VWNB 4BX5A 5B5GA 4Y5DA 1SWTA 2IZLB 2RTHB 4OKAA 3WZPA 5L3YA 2IZAA 2MF6A 3T2WA 3PK2A 1SWNA 2IZHB 2OF9A 4BX6B 3EW2A 4CPHB 3T6FA 3RY2A 4GJVA 2A8GA 2RTEB 1SWKA 2RTDB 1STRB 1RSUB 1SWJA 2IZKA 1VWDB 3WZOA 1VWJB 2A5BA 2FHNX 2IZBA 4CPFA 1SWRA 2RTPB 4Z2VA 2IZIA 1STPA 2OFAA 1VWFB 3WZNA 2RTCB 1SWBA 3MM0A 4BBOA 4Z2PA 3VHIA 1N4JA 1NDJA 4BX7B 1HXZA 1I9HA 1HXLA 1NBXA 1VWRB 2OF8A 2RTQB 1SWEA 5IRWA 5JD2A 4BCSA 1SRFA 2Y3EA 1RXJA 5CSEA 1VWEB 2BC3A 4GGTA 4I60A 1VWCB 1SWQA 2G5LA 3RDUA 2UYWA 3FDCA 1KL5A 1SWCA 2OFBA 4GGRA 1NQNA 1SLFB 4IRWA 1IJ8A 5IRUA 2IZFB 2RTKA 2IZEB 1SWSA 1MEPA 2C4IA 1AVDA 5IRAA 1STSB 2RTAA 3EW1A 3WYQA 1MOYA 1Y53X 1LDOA 3RY1A 1VWIB 1VWOB 2IZCB 1SRJA 4Y59A 1SWGA 4CPHA 4DNEA 2RTFB 4JNJA 1VWHB 4JO6A 1LDQA 1RXKA 2RTMA 2WPUA 2A5CA 2CAMA 1VYOA 1VWMB 2IZGB 4Z6JA 1SWUA 1N9YA 1KL3A 1SWOA 2IZDB 2RTJA 2RTNB 3SZIA 1RAVA 1RSTB 5B5FA 1RXHA 2JGSA 4Z2OA 4JHQA 1HQQA 4BJ8A 1MK5A 1KL4A 4BX7A 1N43A 2RTGB 1Y55X 1AVEA 4CPIA 1SWPA 3RDXA 3VHHA 5F2BA 3RDSA 4BX5B 5K67A 1LCZA 4YVBA 2C1SA 2ZSCA 2RTBB 2Y32A 2C1QA 4GDAA 2Y3FA 1SLEB 2RTRB 4BX6A 1HY2A 3RDOA 5K68A 1SWLA 4EKVA 2F01A 1NQMA 3VGWA 1VWAB 1VWKB 1SWFA 2RTOB 1MM9A 3X00A 2RTLA
chains in the Genus database with same CATH superfamily
2POAA 2W2FA 4NLJA 3T1DA 4OELA 3UEVA 5F6BA 3VG5A 4AZMA 1N0SA 1SY3A 2CBSA 4ZHHA 1SRGA 1OBQA 1W5RA 3RDMA 4EFGA 4IBAA 4I3CA 4KIIA 3WYPA 3KQ0A 5HTEA 2GTLO 3D95A 1LCWA 1FEMA 4LZUA 3VHMA 2WSJA 4XMEA 4YKMA 4U46A 5EZ2A 2XKLA 5F58A 2Z4IA 3RDQA 4O4OA 1CBRA 3AKNA 2PY1A 1N7YA 4RUUA 1QQSA 3QQ2A 3T6LA 1YUPA 2X8FA 3WJBA 3JS1A 1A3YA 1ADLA 3ZW1B 4YFRA 5CE4A 3LV4A 1Y9LA 2AT0X 1LUQA 2DJFA 1LELA 1KFFA 1SLGB 2LKKA 3MG5A 5EPQA 3RE6A 4TLJA 4QZTA 3SZJA 2HMBA 3V8UA 4ZGUA 1PTSA 3BS2A 2GH7A 4QQ1A 4YFQA 5LJEA 3C77X 1W6FA 3PH5A 5B5GA 4Y5DA 2IZLB 2MJIA 2RN4A 4I9RA 1IW2A 4NP1A 4OKAA 3FW4A 3T2WA 1GT5A 4CPHB 2JU3A 3S60A 4ZCBA 2Q9SA 3RY2A 3WOVA 1AB0A 1TOUA 1RLBE 5CYBA 5EEDA 1X8OA 1SWKA 3EBKA 2RTDB 1STRB 1SWJA 3BU9A 2AT6X 2IZKA 3KVNA 4GETA 2X45A 1VWJB 2A5BA 2FS6A 4GE1A 2IZBA 1UREA 1LIEA 2L9CA 1SWRA 4CPFA 3TGBA 2IZIA 1JZUA 1ACDA 3TF6A 4ZHFA 2FKGA 2LA7A 2HYSA 2QOSC 2DM5A 2OL7A 1VYFA 2KT4B 4NYQA 4ORWA 4YBPA 5JR8A 1SY0A 1VWRB 3FIQA 2OF8A 1E02A 1OEJA 1ZNLA 2BSZA 1HN2A 5HZQA 5L8OA 1E2TA 1JYDA 1E06A 5CSEA 3KZAA 3FW5A 1VWEB 2BC3A 3P6CA 4GGTA 4LZVA 3P6GA 3P6FA 3ZW0A 5IO7A 1QFVA 1SA8A 3BDRA 2KTSA 1I78A 3EC5A 3ZQ3A 3DTQA 5IRUA 2WEXA 4YFPA 1EXSA 1TW4A 2OFMX 2IZEB 4K19A 1JV4A 4ZH9A 1MEPA 3SOTA 4ZHDA 5BYPA 4JGLA 2VDFA 1NP4A 2RTAA 2WWPA 1LKEA 1S44A 3PECA 4Y0PA 3APUA 1ZNGA 2P8GA 3B2HA 2R56A 4GZVA 4Y0QA 1U18A 2HZQA 2R74A 3KFGA 4JNJA 3P02A 3RZYA 2CBRA 1YWAA 2AL0X 4XMHA 1KT4A 1OPBA 2RTMA 3NADA 2A5CA 3B2KA 3OD9A 1VYOA 4O3ZA 2K62A 1X89A 3PDFA 5D4AA 4QYNA 4YGHA 1SWOA 3SLOA 1A18A 4QGVA 4M6SA 3MX7A 1MK5A 1KL4A 4BX7A 3VG6A 2JW1A 2AT5X 2HLVA 1OEEA 2ALLX 2HKDA 2WQAE 1G7NA 1TOWA 2X8SA 3AKMA 4NW4A 1E00A 1OBUA 4MVEA 2JMBA 2KTDA 3ZW0B 3CKFA 1LCZA 5DPQA 2C1SA 4YVBA 3UEWA 2C1QA 4ODDA 4EXZA 3OE3A 1I05A 2RTRB 3WJFA 2KW1A 1KGLA 1LIFA 2AH7X 2MHDA 1VWAB 2OL8O 3EBWA 1ZNDA 3LTWA 4MVLA 1MM9A 5FQ8E 3UAQA 1GX9A 3RE5A 3ZZVA 1MX8A 1VWBB 1AQBA 4TJZA 1ICNA 1PBOA 5HCEC 5CHKA 3SLTA 2Q39A 4GGZA 4IABA 3WZQA 1LCVA 1GX8A 3WXQA 1SLDB 4A8ZA 1SRHA 4GNWA 3L4RA 4YBUA 5FAZA 1IKEA 1DC9A 1OBPA 2UZ2A 2MWHA 3BU1A 2IZJA 4WHIA 1YIVA 4CSBA 1SWHA 1EIOA 2AVIA 3U0DA 1HQPA 1FELA 1VWGB 3MVFA 2MM3A 1FTPA 1SREA 3NQKA 4GNYA 4U8UO 2LBVA 5H9KA 3WBGA 4GJSA 4O4UA 4BGFA 1SRIA 1SWDA 2OYBO 5H8TA 4PSQA 4UU3A 2X4MA 2GTFX 4Z27A 4BX5A 5BVQA 4EQAC 1KQXA 1SWTA 4IAWA 4YMYA 4D6BA 2MF6A 5LJCA 1SWNA 1TVQA 2OF9A 3IFBA 3EW2A 5HZ8A 5L8NA 2OVAA 3HOLA 1VPRA 3T6FA 3FIDA 1E5PA 1JIWI 2AT3X 4U3QA 2RTEB 1K3BA 1U0XA 1XCAA 1L6MA 1YP6A 1D2UA 4AZOA 1LIDA 1K24A 2FHNX 1EQDA 3FEKA 3Q6LA 3TGCA 2RTPB 3G7XA 3P24A 3PH6A 2PI3O 3WJGA 3UEXA 1SWBA 4O3WA 4Z2PA 3CQNA 3NX2A 3VHIA 1NDJA 1B0OA 4HPAA 1I06A 3CKGA 4I9SA 2DJGA 3NR3A 5IRWA 5JD2A 1JQPA 4AZPA 4BCSA 4CV7A 5L8IA 1RXJA 3C76X 3NP1A 4L1NA 2VFBA 4I60A 4NV7A 3VG3A 1BSYA 1QABE 1BRPA 1SWQA 2HZRA 3DSZA 1UYOX 3FDCA 2OY8A 4QNIA 1AVGI 1CRBA 2OVDA 1AELA 3NPOA 1A2DA 4GH7A 4IRWA 2FS7A 2CZUA 2G8CO 2RTKA 3FA9A 3B2IA 1GKAB 2X34A 4ID2A 3CQRA 1SWSA 3D96A 1AVDA 1STSB 3FR5A 3EW1A 3STKA 4QZUA 4O9SA 5HAEA 2ACPX 1VWOB 4ES7A 2E4JA 4YDBA 4DNEA 4FBRA 1T0VA 3KFIA 3RBYA 3OBLA 4I3DA 4JO6A 4GK9A 1IFBA 3E3CA 4PJ2A 3NX1A 1JMZA 4Z6JA 1ALBA 1YP7A 3F6ZB 4O3YA 3S5VA 3STNA 3U03A 1A57A 2FT9A 2IZDB 3GAQA 4YDAA 1X8QA 1YWDA 2FTBA 3STMX 3BLGA 1S7DA 4JHQA 2I5ZO 5AJCA 2JOZA 5FQ6E 1QY1A 4BJ8A 2I5VO 5LKFA 4Y0RA 2RTGB 4YH0A 1Y55X 4IMOA 1HBQA 4ZJ0A 1U17A 3VHHA 4QGXA 1JBHA 2ZSCA 2JN3A 4YGGA 4R0BA 2Y32A 4IAXA 3BY0A 1SY2A 1JJJA 4GDAA 4ORYA 1X8UA 2WEWA 4U9CA 4BX6A 3O22A 1MDCA 3HWDA 1JMXA 2F01A 3VGWA 3FA7A 5D48A 1DZKA 1ICMA 1XKIA 1SWFA 4UU2A 4AYHA 2A13A 2RTOB 4MEEA 2A3FX 1O1VA 2FKJA 2YMSA 3ZUIA 4TQ2A 1KZXA 5HA1A 4ORRA 5B11O 3VU1A 3WVMA 1EALA 5IO6A 2F73A 2X46A 1GX3A 1VYGA 4OS3A 1JYJA 1KT7A 3T2XA 2ZAIA 3ZI8A 1HMSA 3BRNA 3OJYC 3VG4A 1Z24A 2KD2A 2OVSA 1LIBA 5D45A 1R0UA 1UZ2X 2L67A 1N9MA 2Z4HA 3FR4A 1G5WA 1ML7A 2NNQA 2QO4A 4QRLA 1O8VA 1LNMA 2OY7A 2A2GA 1ERBA 3EM0A 5KICA 1YWCA 4CDDA 1YWBA 3HPEA 5D47A 1DF8A 4CPEA 1ZNHA 1VWQB 4BVMA 1ZRYA 2QCBA 3APXA 3AEHA 3APWA 2Q2PA 1GT1A 5C0NA 2A0AA 2M4LA 3FEPA 4MISA 5HCCC 3UEUA 1GGLA 3WJCA 3BSZE 3WZPA 5L3YA 2L5PA 2IZAA 3PK2A 1DZJA 4HWMA 4BX6B 4KT5A 5BVTA 1T68X 2W2AA 1BLRA 3O19A 4GJVA 1BRQA 3FLLA 2A8GA 4TKBA 3EMMA 1LICA 1PM1X 1RSUB 2X55A 4KC8A 2YG2A 4OEMA 4HFOA 2R73A 3PPTA 2RD7C 2RCTA 1HMTA 1SXXA 3RKGA 3TGAA 4KC7A 3WZNA 3WJEA 2ANSA 2JU8A 1O1UA 3MM0A 3P6DA 5LJDA 3S26A 1TXLA 3ZWEA 1N4JA 4BBOA 4BX7B 5K06A 1I9HA 1BEBA 1NBXA 2FWVA 5B3MO 1QFTA 1CBQA 1SWEA 2QMIA 4O3XB 4RUNA 2XSTA 3I0AA 1SRFA 2Y3EA 4XMDA 3RSWA 4AZRA 4DCBA 3FR2A 1VWCB 1PEEA 4YCHA 2G5LA 3H3IA 5HZ6A 3CBCA 4WBKA 5HCDC 1KL5A 1SWCA 2CZTA 2OFBA 3F9DA 4GGRA 1IJ8A 3U9PC 3D97A 3WJDA 4OS0A 1G85A 4Y0SA 5B2AO 4LKPA 3EYCA 3LHNA 2FRSA 4CPIA 1FE3A 1GXAA 1T8VA 2C4IA 2QO5A 3C78X 5IO5A 1EI5A 1MOYA 1Y53X 1LDOA 4OMWA 3VE2A 3APVA 3RY1A 1FJ1E 4B55A 1HBPA 2IZCB 2K23A 1SRJA 2WUTA 1NP1A 1SWGA 1I04A 3ELXA 3FYFA 4CPHA 1BSOA 4DQ4A 1FDQA 4HPCA 3NQ9A 1DF3A 1LDQA 1RXKA 2GTLN 3FA6A 4XMCA 1GT4A 2OVEA 2WPUA 1EIIA 1VWMB 5DG4A 1SWUA 4O4XA 4ON1A 4ZHGA 5D8JA 4IB7A 4XMFA 1N9YA 3PQUA 2FLJA 2G7BA 4U8UM 3SZIA 5KIDA 3HWGA 1ERXA 1RXHA 2JGSA 4GKCA 4Z2OA 4EEJA 2CM9A 1EW3A 2OFRX 2X56A 3QKGA 4ZFXA 2VFCA 4MVIA 2F09A 4MVKA 1GT3A 1N43A 5H9NA 1SXWA 2G78A 1DV9A 5K67A 3RDXA 4C5PA 2AT8X 4BX5B 2QO6A 4ALOA 4LQZA 3K3LA 3VPJE 4KH8A 3TZSA 1IIUA 2L68A 3BX7A 5H9AA 1EPAA 1FENA 2RA6A 4IMNA 1SLEB 1KOIA 2G79A 2GTLM 2HNXA 3RDOA 4A60A 3P6EA 5K68A 4ALBA 4EKVA 2GC9A 1NQMA 3JQOA 5H9LA 2IFBA 2NP1A 1SXUA 1VWKB 3CMPA 4ORXA 2CM4A 4YGZA 5KHPA 3X00A 4N7CA 2RTLA 1S2PA 4FQBB 2FR3A 4FBOA 2LB6A 1EUOA 1X8PA 1PMPA 1IKJA 3D9WA 3FELA 3SLJA 1SY1A 2RTIB 1LFOA 4YKOA 2Q2MA 1CJ5A 3HTYA 1VWLB 1HMRA 2MO5A 4GUZA 2X8TA 4IB9A 4CDEA 3HWEA 1VWPB 2W2BA 4NNTA 3SZHA 5HZ9A 1KT3A 5IXGA 5LJKA 1Y52X 4Z28A 1SXYA 4GDZA 4NV8A 5LJBA 1BM5A 1MUPA 4L3RA 1UYNX 4GD9A 1KQWA 4TNNA 4QYPA 5FENA 1OEKA 1SWAA 2FHLA 2FR2A 2GJ5A 2WR6A 1MX7A 3N91A 1NC9A 3HK1A 3O2YA 2OY1O 5LJGA 4AZNA 5AEOA 5HZ5A 4I6SA 4TKHA 2OY5O 3FMZA 3I17A 4O49A 4AZQA 1WBIA 5F6ZA 1LPJA 1OSPO 1Y0GA 2RCQA 1NGLA 1VWNB 3IA8A 1CBSA 5AJBA 2EU7X 1WUBA 2QM9A 1QWDA 1KT5A 2RTHB 2X32A 3CR6A 3B2JA 2WQ9A 5B10O 2A2UA 1EPBA 1ZNEA 2N93A 4ZGFA 2Q4NA 4ZHCA 2IZHB 3CBSA 5F1EA 1BSQA 1CBIA 2ACOA 2AMMX 4NNSA 4KCAA 3ZUOA 1JJXA 2OL6O 3VG2A 5AQ6A 4COTA 1QY2A 4LKTA 5FFHA 4OS8A 1RBPA 1B8EA 1VWDB 2OZQA 3KFHA 4FBVA 3WZOA 2BS5A 2AKQA 4EDEA 4XMGA 3VG7A 4Z2VA 1KZWA 1STPA 4N7DA 1QG5A 2OFAA 1VWFB 3FA8A 3F8AA 2RTCB 3PQSA 2JU7A 3MBTA 1HXZA 1ZNKA 1HXLA 4O4SA 2RTQB 3FENA 5EEEA 4GU8A 4ZH6A 1B4MA 1OPAA 1X8NA 2BT9A 5EDBA 4ARHA 3HOEA 3VE1A 5HTDA 3AUMO 2QOMA 1MVGA 1W4TA 2UYWA 2ZAGA 3NBXX 3RDUA 3RWXA 1PBYA 2BS6A 1NQNA 1SLFB 2ASNX 4M7MA 2IZFB 4TKJA 2LFOA 3ZW2A 5HWZA 1I4UA 2O62A 5F7GA 1KT6A 4HPDA 5IRAA 4WFUA 4WFVA 4ML7B 1QY0A 3WYQA 4I3BA 2NNDA 1VWIB 5B27A 1D3SA 2NNEA 5B29A 1BWYA 4Y59A 2RTFB 1DFVA 1VWHB 1BBPA 1X71A 2RQ0A 4FGIB 3ELZA 2CAMA 2IZGB 2LBAA 1H91A 1DZMA 4NYRA 4D6AA 2FGSA 4QAEA 1IFCA 3S5XA 4INNA 4CK4A 3KFFA 3HWFA 1JJUA 1KL3A 2RTJA 3Q34A 3PP6A 2RTNB 4QGWA 4A1HA 1RAVA 3PEDA 5LKEA 1RSTB 1LF7A 4U8UN 5B5FA 5BVSA 3D4RA 3GE2A 4GRJA 1HQQA 3ZW1A 4BOEA 3SAOA 4YCEA 1AVEA 4A1YA 1SWPA 3JSQA 3B2LA 3P6HA 4ZR2A 4OMXA 5F2BA 4NLIA 3RDSA 2BLGA 4IB8A 1GM6A 3NQ3A 4I95A 3CWKA 2RTBB 1B56A 5EDCA 4CDFA 4BQUA 4DQ3A 1BJ7A 5HBSA 5LJHA 2Y3FA 1P6PA 4CDCA 3BX8A 1HY2A 1SMPI 1G74A 1Y9TA 1SWLA 4HPBA 4IB6A 1GKAA 4ORUA 2BHVA 5HA0A 2AF5A 4MIRA 4ORSA 4AW8A 1KXOA 5FQ7E 1DZPA
chains in the Genus database with same CATH topology
3RE5A 1VWBB 1SRGA 3RDMA 5CHKA 3T2XA 4GGZA 2RTIB 3WZQA 3WYPA 1LCVA 1LCWA 1SLDB 3VHMA 1SRHA 4U46A 1VWLB 1N9MA 2UZ2A 3RDQA 1VWPB 2IZJA 3SZHA 1SWHA 1N7YA 1Y52X 4Z28A 2AVIA 1VWGB 3T6LA 4GD9A 1DF8A 4CPEA 1SREA 1SWAA 1VWQB 2FHLA 2QCBA 4GJSA 1NC9A 3MG5A 1SRIA 1LUQA 1LELA 1KFFA 1SLGB 3RE6A 1SWDA 3SZJA 1WBIA 1PTSA 2GH7A 4Z27A 1VWNB 4BX5A 5B5GA 4Y5DA 1SWTA 2IZLB 2RTHB 4OKAA 3WZPA 5L3YA 2IZAA 2MF6A 3T2WA 3PK2A 1SWNA 2IZHB 2OF9A 4BX6B 3EW2A 4CPHB 3T6FA 3RY2A 4GJVA 2A8GA 2RTEB 1SWKA 2RTDB 1STRB 1RSUB 1SWJA 2IZKA 1VWDB 3WZOA 1VWJB 2A5BA 2FHNX 2IZBA 4CPFA 1SWRA 2RTPB 4Z2VA 2IZIA 1STPA 2OFAA 1VWFB 3WZNA 2RTCB 1SWBA 3MM0A 4BBOA 4Z2PA 3VHIA 1N4JA 1NDJA 4BX7B 1HXZA 1I9HA 1HXLA 1NBXA 1VWRB 2OF8A 2RTQB 1SWEA 5IRWA 5JD2A 4BCSA 1SRFA 2Y3EA 1RXJA 5CSEA 1VWEB 2BC3A 4GGTA 4I60A 1VWCB 1SWQA 2G5LA 3RDUA 2UYWA 3FDCA 1KL5A 1SWCA 2OFBA 4GGRA 1NQNA 1SLFB 4IRWA 1IJ8A 5IRUA 2IZFB 2RTKA 2IZEB 1SWSA 1MEPA 2C4IA 1AVDA 5IRAA 1STSB 2RTAA 3EW1A 3WYQA 1MOYA 1Y53X 1LDOA 3RY1A 1VWIB 1VWOB 2IZCB 1SRJA 4Y59A 1SWGA 4CPHA 4DNEA 2RTFB 4JNJA 1VWHB 4JO6A 1LDQA 1RXKA 2RTMA 2WPUA 2A5CA 2CAMA 1VYOA 1VWMB 2IZGB 4Z6JA 1SWUA 1N9YA 1KL3A 1SWOA 2IZDB 2RTJA 2RTNB 3SZIA 1RAVA 1RSTB 5B5FA 1RXHA 2JGSA 4Z2OA 4JHQA 1HQQA 4BJ8A 1MK5A 1KL4A 4BX7A 1N43A 2RTGB 1Y55X 1AVEA 4CPIA 1SWPA 3RDXA 3VHHA 5F2BA 3RDSA 4BX5B 5K67A 1LCZA 4YVBA 2C1SA 2ZSCA 2RTBB 2Y32A 2C1QA 4GDAA 2Y3FA 1SLEB 2RTRB 4BX6A 1HY2A 3RDOA 5K68A 1SWLA 4EKVA 2F01A 1NQMA 3VGWA 1VWAB 1VWKB 1SWFA 2RTOB 1MM9A 3X00A 2RTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RE5 A;  1VWB B;  1SRG A;  3RDM A;  5CHK A;  3T2X A;  4GGZ A;  2RTI B;  3WZQ A;  3WYP A;  1LCV A;  1LCW A;  1SLD B;  3VHM A;  1SRH A;  4U46 A;  1VWL B;  1N9M A;  2UZ2 A;  3RDQ A;  1VWP B;  2IZJ A;  3SZH A;  1SWH A;  1N7Y A;  1Y52 X;  4Z28 A;  2AVI A;  1VWG B;  3T6L A;  4GD9 A;  1DF8 A;  4CPE A;  1SRE A;  1SWA A;  1VWQ B;  2FHL A;  2QCB A;  4GJS A;  1NC9 A;  3MG5 A;  1SRI A;  1LUQ A;  1LEL A;  1KFF A;  1SLG B;  3RE6 A;  1SWD A;  3SZJ A;  1WBI A;  1PTS A;  2GH7 A;  4Z27 A;  1VWN B;  4BX5 A;  5B5G A;  4Y5D A;  1SWT A;  2IZL B;  2RTH B;  4OKA A;  3WZP A;  5L3Y A;  2IZA A;  2MF6 A;  3T2W A;  3PK2 A;  1SWN A;  2IZH B;  2OF9 A;  4BX6 B;  3EW2 A;  4CPH B;  3T6F A;  3RY2 A;  4GJV A;  2A8G A;  2RTE B;  1SWK A;  2RTD B;  1STR B;  1RSU B;  1SWJ A;  2IZK A;  1VWD B;  3WZO A;  1VWJ B;  2A5B A;  2FHN X;  2IZB A;  4CPF A;  1SWR A;  2RTP B;  4Z2V A;  2IZI A;  1STP A;  2OFA A;  1VWF B;  3WZN A;  2RTC B;  1SWB A;  3MM0 A;  4BBO A;  4Z2P A;  3VHI A;  1N4J A;  1NDJ A;  4BX7 B;  1HXZ A;  1I9H A;  1HXL A;  1NBX A;  1VWR B;  2OF8 A;  2RTQ B;  1SWE A;  5IRW A;  5JD2 A;  4BCS A;  1SRF A;  2Y3E A;  1RXJ A;  5CSE A;  1VWE B;  2BC3 A;  4GGT A;  4I60 A;  1VWC B;  1SWQ A;  2G5L A;  3RDU A;  2UYW A;  3FDC A;  1KL5 A;  1SWC A;  2OFB A;  4GGR A;  1NQN A;  1SLF B;  4IRW A;  1IJ8 A;  5IRU A;  2IZF B;  2RTK A;  2IZE B;  1SWS A;  1MEP A;  2C4I A;  1AVD A;  5IRA A;  1STS B;  2RTA A;  3EW1 A;  3WYQ A;  1MOY A;  1Y53 X;  1LDO A;  3RY1 A;  1VWI B;  1VWO B;  2IZC B;  1SRJ A;  4Y59 A;  1SWG A;  4CPH A;  4DNE A;  2RTF B;  4JNJ A;  1VWH B;  4JO6 A;  1LDQ A;  1RXK A;  2RTM A;  2WPU A;  2A5C A;  2CAM A;  1VYO A;  1VWM B;  2IZG B;  4Z6J A;  1SWU A;  1N9Y A;  1KL3 A;  1SWO A;  2IZD B;  2RTJ A;  2RTN B;  3SZI A;  1RAV A;  1RST B;  5B5F A;  1RXH A;  2JGS A;  4Z2O A;  4JHQ A;  1HQQ A;  4BJ8 A;  1MK5 A;  1KL4 A;  4BX7 A;  1N43 A;  2RTG B;  1Y55 X;  1AVE A;  4CPI A;  1SWP A;  3RDX A;  3VHH A;  5F2B A;  3RDS A;  4BX5 B;  5K67 A;  1LCZ A;  4YVB A;  2C1S A;  2ZSC A;  2RTB B;  2Y32 A;  2C1Q A;  4GDA A;  2Y3F A;  1SLE B;  2RTR B;  4BX6 A;  1HY2 A;  3RDO A;  5K68 A;  1SWL A;  4EKV A;  2F01 A;  1NQM A;  3VGW A;  1VWA B;  1VWK B;  1SWF A;  2RTO B;  1MM9 A;  3X00 A;  2RTL A; 
#chains in the Genus database with same CATH topology
 2POA A;  2W2F A;  4NLJ A;  3T1D A;  4OEL A;  3UEV A;  5F6B A;  3VG5 A;  4AZM A;  1N0S A;  1SY3 A;  2CBS A;  4ZHH A;  1SRG A;  1OBQ A;  1W5R A;  3RDM A;  4EFG A;  4IBA A;  4I3C A;  4KII A;  3WYP A;  3KQ0 A;  5HTE A;  2GTL O;  3D95 A;  1LCW A;  1FEM A;  4LZU A;  3VHM A;  2WSJ A;  4XME A;  4YKM A;  4U46 A;  5EZ2 A;  2XKL A;  5F58 A;  2Z4I A;  3RDQ A;  4O4O A;  1CBR A;  3AKN A;  2PY1 A;  1N7Y A;  4RUU A;  1QQS A;  3QQ2 A;  3T6L A;  1YUP A;  2X8F A;  3WJB A;  3JS1 A;  1A3Y A;  1ADL A;  3ZW1 B;  4YFR A;  5CE4 A;  3LV4 A;  1Y9L A;  2AT0 X;  1LUQ A;  2DJF A;  1LEL A;  1KFF A;  1SLG B;  2LKK A;  3MG5 A;  5EPQ A;  3RE6 A;  4TLJ A;  4QZT A;  3SZJ A;  2HMB A;  3V8U A;  4ZGU A;  1PTS A;  3BS2 A;  2GH7 A;  4QQ1 A;  4YFQ A;  5LJE A;  3C77 X;  1W6F A;  3PH5 A;  5B5G A;  4Y5D A;  2IZL B;  2MJI A;  2RN4 A;  4I9R A;  1IW2 A;  4NP1 A;  4OKA A;  3FW4 A;  3T2W A;  1GT5 A;  4CPH B;  2JU3 A;  3S60 A;  4ZCB A;  2Q9S A;  3RY2 A;  3WOV A;  1AB0 A;  1TOU A;  1RLB E;  5CYB A;  5EED A;  1X8O A;  1SWK A;  3EBK A;  2RTD B;  1STR B;  1SWJ A;  3BU9 A;  2AT6 X;  2IZK A;  3KVN A;  4GET A;  2X45 A;  1VWJ B;  2A5B A;  2FS6 A;  4GE1 A;  2IZB A;  1URE A;  1LIE A;  2L9C A;  1SWR A;  4CPF A;  3TGB A;  2IZI A;  1JZU A;  1ACD A;  3TF6 A;  4ZHF A;  2FKG A;  2LA7 A;  2HYS A;  2QOS C;  2DM5 A;  2OL7 A;  1VYF A;  2KT4 B;  4NYQ A;  4ORW A;  4YBP A;  5JR8 A;  1SY0 A;  1VWR B;  3FIQ A;  2OF8 A;  1E02 A;  1OEJ A;  1ZNL A;  2BSZ A;  1HN2 A;  5HZQ A;  5L8O A;  1E2T A;  1JYD A;  1E06 A;  5CSE A;  3KZA A;  3FW5 A;  1VWE B;  2BC3 A;  3P6C A;  4GGT A;  4LZV A;  3P6G A;  3P6F A;  3ZW0 A;  5IO7 A;  1QFV A;  1SA8 A;  3BDR A;  2KTS A;  1I78 A;  3EC5 A;  3ZQ3 A;  3DTQ A;  5IRU A;  2WEX A;  4YFP A;  1EXS A;  1TW4 A;  2OFM X;  2IZE B;  4K19 A;  1JV4 A;  4ZH9 A;  1MEP A;  3SOT A;  4ZHD A;  5BYP A;  4JGL A;  2VDF A;  1NP4 A;  2RTA A;  2WWP A;  1LKE A;  1S44 A;  3PEC A;  4Y0P A;  3APU A;  1ZNG A;  2P8G A;  3B2H A;  2R56 A;  4GZV A;  4Y0Q A;  1U18 A;  2HZQ A;  2R74 A;  3KFG A;  4JNJ A;  3P02 A;  3RZY A;  2CBR A;  1YWA A;  2AL0 X;  4XMH A;  1KT4 A;  1OPB A;  2RTM A;  3NAD A;  2A5C A;  3B2K A;  3OD9 A;  1VYO A;  4O3Z A;  2K62 A;  1X89 A;  3PDF A;  5D4A A;  4QYN A;  4YGH A;  1SWO A;  3SLO A;  1A18 A;  4QGV A;  4M6S A;  3MX7 A;  1MK5 A;  1KL4 A;  4BX7 A;  3VG6 A;  2JW1 A;  2AT5 X;  2HLV A;  1OEE A;  2ALL X;  2HKD A;  2WQA E;  1G7N A;  1TOW A;  2X8S A;  3AKM A;  4NW4 A;  1E00 A;  1OBU A;  4MVE A;  2JMB A;  2KTD A;  3ZW0 B;  3CKF A;  1LCZ A;  5DPQ A;  2C1S A;  4YVB A;  3UEW A;  2C1Q A;  4ODD A;  4EXZ A;  3OE3 A;  1I05 A;  2RTR B;  3WJF A;  2KW1 A;  1KGL A;  1LIF A;  2AH7 X;  2MHD A;  1VWA B;  2OL8 O;  3EBW A;  1ZND A;  3LTW A;  4MVL A;  1MM9 A;  5FQ8 E;  3UAQ A;  1GX9 A;  3RE5 A;  3ZZV A;  1MX8 A;  1VWB B;  1AQB A;  4TJZ A;  1ICN A;  1PBO A;  5HCE C;  5CHK A;  3SLT A;  2Q39 A;  4GGZ A;  4IAB A;  3WZQ A;  1LCV A;  1GX8 A;  3WXQ A;  1SLD B;  4A8Z A;  1SRH A;  4GNW A;  3L4R A;  4YBU A;  5FAZ A;  1IKE A;  1DC9 A;  1OBP A;  2UZ2 A;  2MWH A;  3BU1 A;  2IZJ A;  4WHI A;  1YIV A;  4CSB A;  1SWH A;  1EIO A;  2AVI A;  3U0D A;  1HQP A;  1FEL A;  1VWG B;  3MVF A;  2MM3 A;  1FTP A;  1SRE A;  3NQK A;  4GNY A;  4U8U O;  2LBV A;  5H9K A;  3WBG A;  4GJS A;  4O4U A;  4BGF A;  1SRI A;  1SWD A;  2OYB O;  5H8T A;  4PSQ A;  4UU3 A;  2X4M A;  2GTF X;  4Z27 A;  4BX5 A;  5BVQ A;  4EQA C;  1KQX A;  1SWT A;  4IAW A;  4YMY A;  4D6B A;  2MF6 A;  5LJC A;  1SWN A;  1TVQ A;  2OF9 A;  3IFB A;  3EW2 A;  5HZ8 A;  5L8N A;  2OVA A;  3HOL A;  1VPR A;  3T6F A;  3FID A;  1E5P A;  1JIW I;  2AT3 X;  4U3Q A;  2RTE B;  1K3B A;  1U0X A;  1XCA A;  1L6M A;  1YP6 A;  1D2U A;  4AZO A;  1LID A;  1K24 A;  2FHN X;  1EQD A;  3FEK A;  3Q6L A;  3TGC A;  2RTP B;  3G7X A;  3P24 A;  3PH6 A;  2PI3 O;  3WJG A;  3UEX A;  1SWB A;  4O3W A;  4Z2P A;  3CQN A;  3NX2 A;  3VHI A;  1NDJ A;  1B0O A;  4HPA A;  1I06 A;  3CKG A;  4I9S A;  2DJG A;  3NR3 A;  5IRW A;  5JD2 A;  1JQP A;  4AZP A;  4BCS A;  4CV7 A;  5L8I A;  1RXJ A;  3C76 X;  3NP1 A;  4L1N A;  2VFB A;  4I60 A;  4NV7 A;  3VG3 A;  1BSY A;  1QAB E;  1BRP A;  1SWQ A;  2HZR A;  3DSZ A;  1UYO X;  3FDC A;  2OY8 A;  4QNI A;  1AVG I;  1CRB A;  2OVD A;  1AEL A;  3NPO A;  1A2D A;  4GH7 A;  4IRW A;  2FS7 A;  2CZU A;  2G8C O;  2RTK A;  3FA9 A;  3B2I A;  1GKA B;  2X34 A;  4ID2 A;  3CQR A;  1SWS A;  3D96 A;  1AVD A;  1STS B;  3FR5 A;  3EW1 A;  3STK A;  4QZU A;  4O9S A;  5HAE A;  2ACP X;  1VWO B;  4ES7 A;  2E4J A;  4YDB A;  4DNE A;  4FBR A;  1T0V A;  3KFI A;  3RBY A;  3OBL A;  4I3D A;  4JO6 A;  4GK9 A;  1IFB A;  3E3C A;  4PJ2 A;  3NX1 A;  1JMZ A;  4Z6J A;  1ALB A;  1YP7 A;  3F6Z B;  4O3Y A;  3S5V A;  3STN A;  3U03 A;  1A57 A;  2FT9 A;  2IZD B;  3GAQ A;  4YDA A;  1X8Q A;  1YWD A;  2FTB A;  3STM X;  3BLG A;  1S7D A;  4JHQ A;  2I5Z O;  5AJC A;  2JOZ A;  5FQ6 E;  1QY1 A;  4BJ8 A;  2I5V O;  5LKF A;  4Y0R A;  2RTG B;  4YH0 A;  1Y55 X;  4IMO A;  1HBQ A;  4ZJ0 A;  1U17 A;  3VHH A;  4QGX A;  1JBH A;  2ZSC A;  2JN3 A;  4YGG A;  4R0B A;  2Y32 A;  4IAX A;  3BY0 A;  1SY2 A;  1JJJ A;  4GDA A;  4ORY A;  1X8U A;  2WEW A;  4U9C A;  4BX6 A;  3O22 A;  1MDC A;  3HWD A;  1JMX A;  2F01 A;  3VGW A;  3FA7 A;  5D48 A;  1DZK A;  1ICM A;  1XKI A;  1SWF A;  4UU2 A;  4AYH A;  2A13 A;  2RTO B;  4MEE A;  2A3F X;  1O1V A;  2FKJ A;  2YMS A;  3ZUI A;  4TQ2 A;  1KZX A;  5HA1 A;  4ORR A;  5B11 O;  3VU1 A;  3WVM A;  1EAL A;  5IO6 A;  2F73 A;  2X46 A;  1GX3 A;  1VYG A;  4OS3 A;  1JYJ A;  1KT7 A;  3T2X A;  2ZAI A;  3ZI8 A;  1HMS A;  3BRN A;  3OJY C;  3VG4 A;  1Z24 A;  2KD2 A;  2OVS A;  1LIB A;  5D45 A;  1R0U A;  1UZ2 X;  2L67 A;  1N9M A;  2Z4H A;  3FR4 A;  1G5W A;  1ML7 A;  2NNQ A;  2QO4 A;  4QRL A;  1O8V A;  1LNM A;  2OY7 A;  2A2G A;  1ERB A;  3EM0 A;  5KIC A;  1YWC A;  4CDD A;  1YWB A;  3HPE A;  5D47 A;  1DF8 A;  4CPE A;  1ZNH A;  1VWQ B;  4BVM A;  1ZRY A;  2QCB A;  3APX A;  3AEH A;  3APW A;  2Q2P A;  1GT1 A;  5C0N A;  2A0A A;  2M4L A;  3FEP A;  4MIS A;  5HCC C;  3UEU A;  1GGL A;  3WJC A;  3BSZ E;  3WZP A;  5L3Y A;  2L5P A;  2IZA A;  3PK2 A;  1DZJ A;  4HWM A;  4BX6 B;  4KT5 A;  5BVT A;  1T68 X;  2W2A A;  1BLR A;  3O19 A;  4GJV A;  1BRQ A;  3FLL A;  2A8G A;  4TKB A;  3EMM A;  1LIC A;  1PM1 X;  1RSU B;  2X55 A;  4KC8 A;  2YG2 A;  4OEM A;  4HFO A;  2R73 A;  3PPT A;  2RD7 C;  2RCT A;  1HMT A;  1SXX A;  3RKG A;  3TGA A;  4KC7 A;  3WZN A;  3WJE A;  2ANS A;  2JU8 A;  1O1U A;  3MM0 A;  3P6D A;  5LJD A;  3S26 A;  1TXL A;  3ZWE A;  1N4J A;  4BBO A;  4BX7 B;  5K06 A;  1I9H A;  1BEB A;  1NBX A;  2FWV A;  5B3M O;  1QFT A;  1CBQ A;  1SWE A;  2QMI A;  4O3X B;  4RUN A;  2XST A;  3I0A A;  1SRF A;  2Y3E A;  4XMD A;  3RSW A;  4AZR A;  4DCB A;  3FR2 A;  1VWC B;  1PEE A;  4YCH A;  2G5L A;  3H3I A;  5HZ6 A;  3CBC A;  4WBK A;  5HCD C;  1KL5 A;  1SWC A;  2CZT A;  2OFB A;  3F9D A;  4GGR A;  1IJ8 A;  3U9P C;  3D97 A;  3WJD A;  4OS0 A;  1G85 A;  4Y0S A;  5B2A O;  4LKP A;  3EYC A;  3LHN A;  2FRS A;  4CPI A;  1FE3 A;  1GXA A;  1T8V A;  2C4I A;  2QO5 A;  3C78 X;  5IO5 A;  1EI5 A;  1MOY A;  1Y53 X;  1LDO A;  4OMW A;  3VE2 A;  3APV A;  3RY1 A;  1FJ1 E;  4B55 A;  1HBP A;  2IZC B;  2K23 A;  1SRJ A;  2WUT A;  1NP1 A;  1SWG A;  1I04 A;  3ELX A;  3FYF A;  4CPH A;  1BSO A;  4DQ4 A;  1FDQ A;  4HPC A;  3NQ9 A;  1DF3 A;  1LDQ A;  1RXK A;  2GTL N;  3FA6 A;  4XMC A;  1GT4 A;  2OVE A;  2WPU A;  1EII A;  1VWM B;  5DG4 A;  1SWU A;  4O4X A;  4ON1 A;  4ZHG A;  5D8J A;  4IB7 A;  4XMF A;  1N9Y A;  3PQU A;  2FLJ A;  2G7B A;  4U8U M;  3SZI A;  5KID A;  3HWG A;  1ERX A;  1RXH A;  2JGS A;  4GKC A;  4Z2O A;  4EEJ A;  2CM9 A;  1EW3 A;  2OFR X;  2X56 A;  3QKG A;  4ZFX A;  2VFC A;  4MVI A;  2F09 A;  4MVK A;  1GT3 A;  1N43 A;  5H9N A;  1SXW A;  2G78 A;  1DV9 A;  5K67 A;  3RDX A;  4C5P A;  2AT8 X;  4BX5 B;  2QO6 A;  4ALO A;  4LQZ A;  3K3L A;  3VPJ E;  4KH8 A;  3TZS A;  1IIU A;  2L68 A;  3BX7 A;  5H9A A;  1EPA A;  1FEN A;  2RA6 A;  4IMN A;  1SLE B;  1KOI A;  2G79 A;  2GTL M;  2HNX A;  3RDO A;  4A60 A;  3P6E A;  5K68 A;  4ALB A;  4EKV A;  2GC9 A;  1NQM A;  3JQO A;  5H9L A;  2IFB A;  2NP1 A;  1SXU A;  1VWK B;  3CMP A;  4ORX A;  2CM4 A;  4YGZ A;  5KHP A;  3X00 A;  4N7C A;  2RTL A;  1S2P A;  4FQB B;  2FR3 A;  4FBO A;  2LB6 A;  1EUO A;  1X8P A;  1PMP A;  1IKJ A;  3D9W A;  3FEL A;  3SLJ A;  1SY1 A;  2RTI B;  1LFO A;  4YKO A;  2Q2M A;  1CJ5 A;  3HTY A;  1VWL B;  1HMR A;  2MO5 A;  4GUZ A;  2X8T A;  4IB9 A;  4CDE A;  3HWE A;  1VWP B;  2W2B A;  4NNT A;  3SZH A;  5HZ9 A;  1KT3 A;  5IXG A;  5LJK A;  1Y52 X;  4Z28 A;  1SXY A;  4GDZ A;  4NV8 A;  5LJB A;  1BM5 A;  1MUP A;  4L3R A;  1UYN X;  4GD9 A;  1KQW A;  4TNN A;  4QYP A;  5FEN A;  1OEK A;  1SWA A;  2FHL A;  2FR2 A;  2GJ5 A;  2WR6 A;  1MX7 A;  3N91 A;  1NC9 A;  3HK1 A;  3O2Y A;  2OY1 O;  5LJG A;  4AZN A;  5AEO A;  5HZ5 A;  4I6S A;  4TKH A;  2OY5 O;  3FMZ A;  3I17 A;  4O49 A;  4AZQ A;  1WBI A;  5F6Z A;  1LPJ A;  1OSP O;  1Y0G A;  2RCQ A;  1NGL A;  1VWN B;  3IA8 A;  1CBS A;  5AJB A;  2EU7 X;  1WUB A;  2QM9 A;  1QWD A;  1KT5 A;  2RTH B;  2X32 A;  3CR6 A;  3B2J A;  2WQ9 A;  5B10 O;  2A2U A;  1EPB A;  1ZNE A;  2N93 A;  4ZGF A;  2Q4N A;  4ZHC A;  2IZH B;  3CBS A;  5F1E A;  1BSQ A;  1CBI A;  2ACO A;  2AMM X;  4NNS A;  4KCA A;  3ZUO A;  1JJX A;  2OL6 O;  3VG2 A;  5AQ6 A;  4COT A;  1QY2 A;  4LKT A;  5FFH A;  4OS8 A;  1RBP A;  1B8E A;  1VWD B;  2OZQ A;  3KFH A;  4FBV A;  3WZO A;  2BS5 A;  2AKQ A;  4EDE A;  4XMG A;  3VG7 A;  4Z2V A;  1KZW A;  1STP A;  4N7D A;  1QG5 A;  2OFA A;  1VWF B;  3FA8 A;  3F8A A;  2RTC B;  3PQS A;  2JU7 A;  3MBT A;  1HXZ A;  1ZNK A;  1HXL A;  4O4S A;  2RTQ B;  3FEN A;  5EEE A;  4GU8 A;  4ZH6 A;  1B4M A;  1OPA A;  1X8N A;  2BT9 A;  5EDB A;  4ARH A;  3HOE A;  3VE1 A;  5HTD A;  3AUM O;  2QOM A;  1MVG A;  1W4T A;  2UYW A;  2ZAG A;  3NBX X;  3RDU A;  3RWX A;  1PBY A;  2BS6 A;  1NQN A;  1SLF B;  2ASN X;  4M7M A;  2IZF B;  4TKJ A;  2LFO A;  3ZW2 A;  5HWZ A;  1I4U A;  2O62 A;  5F7G A;  1KT6 A;  4HPD A;  5IRA A;  4WFU A;  4WFV A;  4ML7 B;  1QY0 A;  3WYQ A;  4I3B A;  2NND A;  1VWI B;  5B27 A;  1D3S A;  2NNE A;  5B29 A;  1BWY A;  4Y59 A;  2RTF B;  1DFV A;  1VWH B;  1BBP A;  1X71 A;  2RQ0 A;  4FGI B;  3ELZ A;  2CAM A;  2IZG B;  2LBA A;  1H91 A;  1DZM A;  4NYR A;  4D6A A;  2FGS A;  4QAE A;  1IFC A;  3S5X A;  4INN A;  4CK4 A;  3KFF A;  3HWF A;  1JJU A;  1KL3 A;  2RTJ A;  3Q34 A;  3PP6 A;  2RTN B;  4QGW A;  4A1H A;  1RAV A;  3PED A;  5LKE A;  1RST B;  1LF7 A;  4U8U N;  5B5F A;  5BVS A;  3D4R A;  3GE2 A;  4GRJ A;  1HQQ A;  3ZW1 A;  4BOE A;  3SAO A;  4YCE A;  1AVE A;  4A1Y A;  1SWP A;  3JSQ A;  3B2L A;  3P6H A;  4ZR2 A;  4OMX A;  5F2B A;  4NLI A;  3RDS A;  2BLG A;  4IB8 A;  1GM6 A;  3NQ3 A;  4I95 A;  3CWK A;  2RTB B;  1B56 A;  5EDC A;  4CDF A;  4BQU A;  4DQ3 A;  1BJ7 A;  5HBS A;  5LJH A;  2Y3F A;  1P6P A;  4CDC A;  3BX8 A;  1HY2 A;  1SMP I;  1G74 A;  1Y9T A;  1SWL A;  4HPB A;  4IB6 A;  1GKA A;  4ORU A;  2BHV A;  5HA0 A;  2AF5 A;  4MIR A;  4ORS A;  4AW8 A;  1KXO A;  5FQ7 E;  1DZP A; 
#chains in the Genus database with same CATH homology
 3RE5 A;  1VWB B;  1SRG A;  3RDM A;  5CHK A;  3T2X A;  4GGZ A;  2RTI B;  3WZQ A;  3WYP A;  1LCV A;  1LCW A;  1SLD B;  3VHM A;  1SRH A;  4U46 A;  1VWL B;  1N9M A;  2UZ2 A;  3RDQ A;  1VWP B;  2IZJ A;  3SZH A;  1SWH A;  1N7Y A;  1Y52 X;  4Z28 A;  2AVI A;  1VWG B;  3T6L A;  4GD9 A;  1DF8 A;  4CPE A;  1SRE A;  1SWA A;  1VWQ B;  2FHL A;  2QCB A;  4GJS A;  1NC9 A;  3MG5 A;  1SRI A;  1LUQ A;  1LEL A;  1KFF A;  1SLG B;  3RE6 A;  1SWD A;  3SZJ A;  1WBI A;  1PTS A;  2GH7 A;  4Z27 A;  1VWN B;  4BX5 A;  5B5G A;  4Y5D A;  1SWT A;  2IZL B;  2RTH B;  4OKA A;  3WZP A;  5L3Y A;  2IZA A;  2MF6 A;  3T2W A;  3PK2 A;  1SWN A;  2IZH B;  2OF9 A;  4BX6 B;  3EW2 A;  4CPH B;  3T6F A;  3RY2 A;  4GJV A;  2A8G A;  2RTE B;  1SWK A;  2RTD B;  1STR B;  1RSU B;  1SWJ A;  2IZK A;  1VWD B;  3WZO A;  1VWJ B;  2A5B A;  2FHN X;  2IZB A;  4CPF A;  1SWR A;  2RTP B;  4Z2V A;  2IZI A;  1STP A;  2OFA A;  1VWF B;  3WZN A;  2RTC B;  1SWB A;  3MM0 A;  4BBO A;  4Z2P A;  3VHI A;  1N4J A;  1NDJ A;  4BX7 B;  1HXZ A;  1I9H A;  1HXL A;  1NBX A;  1VWR B;  2OF8 A;  2RTQ B;  1SWE A;  5IRW A;  5JD2 A;  4BCS A;  1SRF A;  2Y3E A;  1RXJ A;  5CSE A;  1VWE B;  2BC3 A;  4GGT A;  4I60 A;  1VWC B;  1SWQ A;  2G5L A;  3RDU A;  2UYW A;  3FDC A;  1KL5 A;  1SWC A;  2OFB A;  4GGR A;  1NQN A;  1SLF B;  4IRW A;  1IJ8 A;  5IRU A;  2IZF B;  2RTK A;  2IZE B;  1SWS A;  1MEP A;  2C4I A;  1AVD A;  5IRA A;  1STS B;  2RTA A;  3EW1 A;  3WYQ A;  1MOY A;  1Y53 X;  1LDO A;  3RY1 A;  1VWI B;  1VWO B;  2IZC B;  1SRJ A;  4Y59 A;  1SWG A;  4CPH A;  4DNE A;  2RTF B;  4JNJ A;  1VWH B;  4JO6 A;  1LDQ A;  1RXK A;  2RTM A;  2WPU A;  2A5C A;  2CAM A;  1VYO A;  1VWM B;  2IZG B;  4Z6J A;  1SWU A;  1N9Y A;  1KL3 A;  1SWO A;  2IZD B;  2RTJ A;  2RTN B;  3SZI A;  1RAV A;  1RST B;  5B5F A;  1RXH A;  2JGS A;  4Z2O A;  4JHQ A;  1HQQ A;  4BJ8 A;  1MK5 A;  1KL4 A;  4BX7 A;  1N43 A;  2RTG B;  1Y55 X;  1AVE A;  4CPI A;  1SWP A;  3RDX A;  3VHH A;  5F2B A;  3RDS A;  4BX5 B;  5K67 A;  1LCZ A;  4YVB A;  2C1S A;  2ZSC A;  2RTB B;  2Y32 A;  2C1Q A;  4GDA A;  2Y3F A;  1SLE B;  2RTR B;  4BX6 A;  1HY2 A;  3RDO A;  5K68 A;  1SWL A;  4EKV A;  2F01 A;  1NQM A;  3VGW A;  1VWA B;  1VWK B;  1SWF A;  2RTO B;  1MM9 A;  3X00 A;  2RTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...