2QO4A

Crystal structure of zebrafish liver bile acid-binding protein complexed with cholic acid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
AFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Liver-basic fatty acid binding protein
publication title A Single Amino Acid Mutation in Zebrafish (Danio rerio) Liver Bile Acid-binding Protein Can Change the Stoichiometry of Ligand Binding.
pubmed doi rcsb
source organism Danio rerio
molecule tags Lipid binding protein
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14651 Lipocalin_7 Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2qo4A00
2HYSA 2ALLX 2RD7C 3BX8A 5H9NA 3KZAA 4YKMA 5B27A 2BLGA 1LF7A 1ACDA 1X8OA 2MJIA 2L67A 1N0SA 2WUTA 3P6FA 1TXLA 3CQRA 1DF3A 2AMMX 1KQXA 3BDRA 3O22A 5D48A 3RSWA 4NYRA 3JSQA 3WXQA 2AH7X 3FA7A 1GKAB 2L68A 3WBGA 3U03A 1LIDA 4GRJA 4TKHA 3P6GA 5JR8A 1VYGA 1FE3A 2AT8X 3TGBA 3EBKA 1ICNA 3FELA 4NNSA 4GKCA 1LIEA 3CBSA 1EUOA 2E4JA 2AKQA 2CBSA 3C78X 4IB6A 1AVGI 3JS1A 4ZHDA 3UEXA 4LKTA 3F8AA 1EQDA 1DFVA 4HPDA 4NLIA 1B0OA 1B56A 5F6BA 4BOEA 4N7DA 2ANSA 1ICMA 2MO5A 5FENA 1PM1X 3RZYA 1ZNGA 3APWA 1GT3A 4HPCA 3U9PC 3FA6A 1X8UA 3KQ0A 4AYHA 2W2BA 3FA8A 3QKGA 4MVLA 4YDBA 4CK4A 4ZHGA 3C76X 5H9LA 2CZUA 4N7CA 1SXWA 1BRPA 4QYNA 4ZHHA 5HZ8A 2CM4A 3D96A 3PH6A 1YUPA 4OS8A 1QFVA 2LKKA 2Q39A 2CBRA 2EU7X 5EEEA 5H9AA 5LJEA 2NP1A 5LJGA 1TOWA 1I05A 1LNMA 1SY2A 4O9SA 2G7BA 1TW4A 2WR6A 3WJCA 4AZQA 1JZUA 4ARHA 1SXYA 2A13A 5HWZA 4DQ4A 3NP1A 3FW5A 1KZXA 3IA8A 4IB8A 5BVTA 3HWFA 4WFUA 1NP4A 3MVFA 1IKJA 3HWEA 4XMCA 4K19A 4ALOA 5HZ5A 5KICA 2FRSA 4EFGA 5IO7A 1OPAA 3NR3A 3AKMA 1YP6A 1HN2A 1BRQA 2NNEA 1S2PA 1OBUA 3O2YA 3STKA 1R0UA 4GH7A 2W2FA 5EPQA 1IW2A 4DQ3A 4ZGUA 4LZUA 1D2UA 2OVDA 2RQ0A 5C0NA 1G7NA 1TVQA 4YDAA 2LB6A 5LJHA 4PSQA 3KFFA 3EM0A 1JJXA 1GXAA 4XMGA 1G5WA 5EEDA 3NPOA 5LKFA 5F6ZA 4UU3A 5FFHA 3FLLA 2FTBA 3UEWA 1BWYA 1T8VA 3TF6A 2XSTA 2O62A 1X8QA 2R56A 3HK1A 4ODDA 3TZSA 4RUNA 4AZMA 4ZFXA 2WQ9A 4HFOA 2QM9A 4IBAA 1GX8A 1A18A 1DZMA 5F7GA 1H91A 3NX2A 4A8ZA 2FLJA 5EDCA 5LJCA 1A2DA 3CR6A 1E5PA 3UEUA 2JU7A 2F73A 1BM5A 1KT7A 1KQWA 1ZNKA 3P6EA 3WJBA 2HMBA 2ACPX 4OMWA 4NLJA 3ZUIA 1JYDA 1HMSA 4IMOA 4UU2A 4I9SA 2HLVA 1BEBA 3WJEA 3P6CA 2DM5A 2AL0X 1B4MA 2R73A 4XMDA 3APUA 1O8VA 1HBQA 4QYPA 1ZNDA 4ORSA 2NNQA 4ZHCA 1ZNLA 1GT1A 1AQBA 1EPBA 2FR3A 2Q2PA 3NQ9A 4ZJ0A 3STMX 1EALA 1KT5A 1KT6A 3BS2A 5HA0A 1RBPA 3CWKA 3S26A 1G85A 1MX8A 3BU9A 1CBIA 3ZQ3A 1UZ2X 4I9RA 1PBOA 1BBPA 3BLGA 1SY0A 1KXOA 2L9CA 1HMRA 5HZQA 4ZH9A 2OFMX 4ZR2A 4ORYA 1BJ7A 1ERBA 4Y0PA 4HPAA 2AT5X 4AW8A 3EYCA 1KT3A 2A0AA 2HNXA 2RCTA 2N93A 3WVMA 5HTEA 4GNWA 4OMXA 3MBTA 1VPRA 1DV9A 1OEJA 4AZOA 3KFIA 2JN3A 3PEDA 5F1EA 3IFBA 3KFGA 4TKBA 2KT4B 1CBQA 1IFCA 3BSZE 1CRBA 2LBAA 2AT0X 3NADA 3FMZA 4QAEA 2CM9A 3UEVA 3VG5A 4YH0A 1OPBA 4YCHA 1OBPA 5HZ9A 2FS7A 5HAEA 2WQAE 1DZKA 3FEPA 1KZWA 1FENA 2GC9A 4YGZA 1EPAA 3BRNA 2WWPA 2RA6A 3FIQA 1FTPA 4ORWA 1A57A 2OVEA 1JV4A 4ORUA 5IO5A 1ERXA 1E00A 1U0XA 5LJKA 3PP6A 4XMHA 1U17A 3WJDA 1LFOA 3PECA 1HBPA 2WEXA 3BY0A 4YGHA 4ZHFA 4GNYA 2MM3A 3I17A 3STNA 3EMMA 1FEMA 4I3CA 1QY2A 3SAOA 2PY1A 5D45A 3PH5A 3PPTA 3NQ3A 2G79A 5AQ6A 4BVMA 3BU1A 5IO6A 2WSJA 3BX7A 5H8TA 3CMPA 2OVAA 1MX7A 2KTDA 3EBWA 1AELA 1CJ5A 5L8IA 5LKEA 3VG2A 3HWDA 1JJJA 2RCQA 3FR2A 4EXZA 4YFRA 1YWBA 3FR5A 3DTQA 2G78A 1L6MA 1GGLA 2JOZA 4AZNA 2FS6A 5L8NA 1ALBA 3FENA 3D97A 3VG4A 5EZ2A 5D8JA 1YWAA 4EEJA 2WEWA 1E02A 2FR2A 1GKAA 1XCAA 2JU3A 2A3FX 4YFQA 5D4AA 5HCDC 3G7XA 3VG3A 2Q9SA 4A60A 2FWVA 1XKIA 3P6DA 5KHPA 4TKJA 1IIUA 5HBSA 1BLRA 1QFTA 2NNDA 1BSQA 4YBUA 1DZJA 3CBCA 4TNNA 4YKOA 1YWCA 4WFVA 5BVQA 2CZTA 4YCEA 1NGLA 1O1UA 4HPBA 1QWDA 4Y0QA 4ZCBA 2JU8A 1KGLA 1KT4A 3B2KA 4XMEA 3B2JA 1X89A 3FEKA 1G74A 1GM6A 3HWGA 5HCEC 3AKNA 3ZUOA 1MDCA 1QY1A 1Z24A 4ORRA 3ELZA 2IFBA 1IFBA 1SXXA 3APXA 1QQSA 4I3BA 4YGGA 4A1HA 1ZNHA 4NYQA 5KIDA 2K23A 3CQNA 3Q6LA 1I04A 1CBSA 4ZH6A 4IMNA 4TLJA 3KFHA 2LBVA 1OEKA 4QZTA 4MVIA 2A2UA 1QG5A 4TQ2A 3WJFA 4BQUA 2ACOA 1GT4A 4M6SA 1OBQA 1YP7A 4I3DA 4YMYA 3B2IA 2HZRA 1ADLA 1ML7A 1GT5A 2QOSC 4ORXA 4Y0RA 4AZRA 1FELA 3L4RA 3APVA 1LPJA 3U0DA 4GE1A 4D6BA 1AB0A 1I06A 2X46A 3F9DA 2HZQA 5EDBA 1BSOA 1S7DA 1U18A 2AT3X 1JBHA 4R0BA 2GTFX 1FDQA 4QGXA 3ELXA 1HMTA 2YG2A 4IB9A 2L5PA 4YFPA 1LIFA 4IAWA 1EW3A 2A2GA 2OZQA 4TJZA 4D6AA 5CE4A 1T68X 3O19A 1LKEA 1EIIA 4GETA 1NP1A 4IB7A 1E06A 2FT9A 4MVKA 4QGVA 3VG6A 1UREA 1SY3A 5F58A 5DG4A 1B8EA 1HQPA 1EXSA 4RUUA 2P8GA 2POAA 4NP1A 1MUPA 4LZVA 3NX1A 1VYFA 2LFOA 3D95A 5HA1A 2OFRX 3C77X 3GAQA 4QZUA 1OEEA 1PMPA 1SY1A 2R74A 3VG7A 1O1VA 1YWDA 3P6HA 3I0AA 1SXUA 3TGAA 1YIVA 1ZNEA 3K3LA 1PEEA 5HTDA 5HZ6A 1RLBE 1KOIA 1BSYA 3FA9A 1T0VA 1LIBA 5LJDA 4EDEA 1QY0A 1P6PA 1TOUA 2Q4NA 5H9KA 4NNTA 4OS0A 2QO4A 4ES7A 4IAXA 2XKLA 1GX9A 5B29A 1QABE 2X45A 3WJGA 1X71A 5D47A 5HCCC 5DPQA 4QGWA 5BVSA 2AT6X 1CBRA 3DSZA 4WBKA 1A3YA 4AZPA 4Y0SA 4XMFA 1EIOA 1DC9A 1IKEA 1JYJA 2Q2MA 2QO5A 1DZPA 1D3SA 4ALBA 1SA8A 1ZRYA 5FAZA 3B2LA 1X8PA 3FW4A 1I4UA 2ASNX 3FR4A 3TGCA 3T1DA 1X8NA 1LICA 4M7MA 4YBPA 2GJ5A 2W2AA 3B2HA 4KIIA 2QO6A 5L8OA 4A1YA 5LJBA 4LKPA 1MVGA 4OS3A 5K06A 1S44A 3OJYC 2K62A
chains in the Genus database with same CATH superfamily
2HYSA 2ALLX 2RD7C 3BX8A 4L3RA 1NQNA 4U46A 3KZAA 4YKMA 3LHNA 2BLGA 1LF7A 1ACDA 1X8OA 5B27A 2MJIA 3RY1A 2L67A 2RTLA 1N0SA 2WUTA 3P6FA 1MEPA 4EKVA 1TXLA 3CQRA 5FQ6E 4Z2OA 1DF3A 2AMMX 1KQXA 3BDRA 3O22A 1VWNB 5D48A 3RSWA 5CHKA 4GD9A 4NYRA 3JSQA 3WXQA 2FKJA 2AH7X 1LCZA 3ZW0A 2BC3A 3FA7A 1GKAB 2L68A 4KC7A 3WBGA 1LIDA 4BX6A 4GRJA 3U03A 4TKHA 3P6GA 5JR8A 1VYGA 1FE3A 2AT8X 3AEHA 3EBKA 3TGBA 4WHIA 1ICNA 3FELA 3VU1A 4NNSA 2Y3FA 4GKCA 1LIEA 1LDOA 1VWPB 3CBSA 2KD2A 3SOTA 1EUOA 2E4JA 4BBOA 2AKQA 2CBSA 4JNJA 2X4MA 4I6SA 3C78X 4IB6A 3ZWEA 1AVGI 4ZJ0A 3JS1A 1RSTB 3UEXA 4ZHDA 3EW1A 4LKTA 4GDAA 1SWHA 1EQDA 3F8AA 4GDZA 4BX7A 1DFVA 1SWEA 4HPDA 2LA7A 4EQAC 4NLIA 1JMXA 1B0OA 1B56A 5F6BA 1W4TA 4BOEA 4N7DA 2ANSA 1ICMA 2MO5A 5FENA 1PM1X 3RZYA 1ZNGA 3APWA 1GT3A 4HPCA 3U9PC 4GGZA 1MK5A 3FA6A 3T2XA 1X8UA 3KQ0A 4AYHA 2W2BA 3FA8A 3QKGA 4MVLA 4YDBA 4CK4A 4ZHGA 3C76X 3D4RA 1SWNA 2CZUA 5H9LA 1SWQA 4N7CA 1SXWA 1BRPA 4QYNA 4U9CA 4ZHHA 5HZ8A 2CM4A 3D96A 3PH6A 1YUPA 4OS8A 1QFVA 2LKKA 2OFAA 2Q39A 2CBRA 2EU7X 5EEEA 5H9AA 5LJEA 3RDQA 2NP1A 1PTSA 5LJGA 1TOWA 1I05A 1LNMA 1SY2A 4O9SA 1SWRA 5IRUA 4CDCA 2G7BA 1SWCA 1N43A 1TW4A 2WR6A 3VE2A 3WJCA 4AZQA 1JZUA 4ARHA 1SXYA 2A13A 4KCAA 4CPHB 4DQ4A 5H9NA 5HWZA 3NP1A 3FW5A 1SWFA 3NBXX 3WJGA 2GTLO 1KZXA 2ZAIA 1SWLA 3IA8A 4IB8A 5BVTA 2OY8A 3HWFA 4IRWA 4WFUA 1NP4A 2X56A 3MVFA 1AVDA 1SWOA 1SRHA 1IKJA 3HWEA 4XMCA 4K19A 4ALOA 1RXJA 1DF8A 5HZ5A 5KICA 5AEOA 1MM9A 2FRSA 2IZBA 4EFGA 5IO7A 2PI3O 3PQUA 2Z4HA 3VHHA 1OPAA 3NR3A 3AKMA 1YP6A 5B11O 3SLOA 1HN2A 1BRQA 2NNEA 3SLJA 2RTIB 3WZQA 3H3IA 2Z4IA 1S2PA 1OBUA 3O2YA 3STKA 1R0UA 2M4LA 4GH7A 2W2FA 5BYPA 5EPQA 1IW2A 2QCBA 2VFBA 4DQ3A 4LZUA 4ZGUA 1D2UA 2OVDA 2RQ0A 4JGLA 5C0NA 3RDXA 4ID2A 1SLGB 1STRB 1G7NA 1SWJA 1TVQA 2LB6A 4YDAA 1JJUA 2C1QA 1SWKA 5LJHA 4PSQA 3RY2A 3KFFA 5HCCC 3EM0A 1JJXA 1GXAA 4XMGA 4CDEA 5EEDA 3NPOA 5LKFA 4BCSA 5F6ZA 4UU3A 2OL7A 5FFHA 5AJCA 4DNEA 3FLLA 2FTBA 1VWLB 3UEWA 1BWYA 1VWEB 1T8VA 3TF6A 3WOVA 1RSUB 2XSTA 2O62A 1X8QA 2R56A 3HK1A 4INNA 4ODDA 3TZSA 4RUNA 4AZMA 4GU8A 4ZFXA 2WQ9A 4HFOA 2QM9A 4IBAA 1GX8A 1A18A 4Y5DA 1DZMA 5F7GA 1H91A 3NX2A 3EC5A 4LQZA 2F01A 4A8ZA 1STPA 2UZ2A 3WYPA 2FLJA 5EDCA 5LJCA 3SZHA 2MHDA 2WPUA 1A2DA 3CR6A 1KFFA 4PJ2A 2FGSA 4GUZA 3RWXA 1E5PA 3UEUA 2JU7A 2F73A 2RTEB 2IZHB 1KT7A 3RKGA 1BM5A 1N4JA 1KQWA 5B3MO 1SWPA 1ZNKA 3P6EA 3WJBA 2HMBA 4Y59A 2ACPX 2OY1O 2BS5A 1SWDA 2VFCA 4NLJA 4OMWA 1JYDA 3SZJA 3ZUIA 4KT5A 1HMSA 4IMOA 4UU2A 5IRWA 4MIRA 4I9SA 2DJGA 2HLVA 3MM0A 1BEBA 3WJEA 3P6CA 2DM5A 4GZVA 2AL0X 3VGWA 1B4MA 3FIDA 2R73A 4XMDA 3APUA 1O8VA 1HBQA 4QYPA 4GK9A 1ZNDA 2RTMA 4ORSA 2NNQA 4ZHCA 1GT1A 2GTLN 3CKFA 1AQBA 1EPBA 1Y9TA 2FR3A 2Q2PA 1Y9LA 1NBXA 3NQ9A 1KT5A 4MVEA 3STMX 3RDOA 1EALA 1KT6A 3BS2A 1A57A 5HA0A 3GE2A 3PQSA 1RBPA 4O3WA 2X8FA 3CWKA 3S26A 1G85A 1VWHB 1MX8A 2AVIA 3BU9A 1CBIA 1N9YA 1UZ2X 2JMBA 4I9RA 3ZQ3A 1PBOA 1BBPA 1WBIA 1SY0A 1KXOA 2L9CA 3BLGA 3T6LA 1HMRA 5HZQA 4ZH9A 1HY2A 3S5VA 2RTCB 2OFMX 4ZR2A 3VE1A 4ORYA 1BJ7A 1ERBA 2IZKA 3OD9A 4HPAA 2AT5X 2QMIA 4Y0PA 5B2AO 5B5GA 4Z2VA 4AW8A 2KW1A 1JIWI 3EYCA 1KT3A 4B55A 2A0AA 2HNXA 2RCTA 2N93A 4ON1A 2C4IA 3WVMA 5HTEA 5B5FA 4GNWA 3HPEA 4FGIB 4OMXA 3MBTA 3T2WA 4BX5A 1VPRA 1DV9A 1OEJA 4AZOA 3KFIA 3PDFA 5CSEA 2JN3A 5B10O 3FDCA 3PEDA 5F1EA 4ZHFA 1SMPI 4O4UA 3IFBA 3KFGA 4QQ1A 4TKBA 3RE6A 2FKGA 2RTOB 3ZW0B 1OSPO 2KT4B 4BX6B 1CBQA 1IFCA 2RTFB 2IZGB 4OKAA 5JD2A 3BSZE 1RXKA 1CRBA 2GH7A 1RAVA 2BSZA 2RN4A 2LBAA 3VHIA 1SRFA 2AT0X 3NADA 3FMZA 1VWIB 3RBYA 4QAEA 2CM9A 1FJ1E 1Y53X 2X8TA 3UEVA 3VG5A 4YH0A 1OPBA 3KVNA 4YCHA 1OBPA 4BX7B 2FS7A 2IZJA 5HZ9A 1NC9A 2WQAE 5HAEA 1DZKA 3FEPA 1KZWA 1FENA 2GC9A 4YGZA 1EPAA 3BRNA 4U8UO 3HOLA 2WWPA 2RA6A 3FIQA 1FTPA 1HXZA 4O49A 4ORWA 2OVEA 1JV4A 1SLDB 3MX7A 2RTJA 4ORUA 3VPJE 5L3YA 3NQKA 5IO5A 1VWCB 3RDSA 3WZNA 1ERXA 2ZAGA 1E00A 1U0XA 3QQ2A 3PP6A 1JQPA 4XMHA 5LJKA 1N7YA 1VYOA 1U17A 3WJDA 2IZDB 3AUMO 2OY7A 1SLEB 4ML7B 1LFOA 3PECA 1HBPA 2WEXA 3BY0A 1VWKB 3EW2A 4GNYA 4YGHA 1UYOX 2MM3A 4C5PA 4CSBA 3I17A 3STNA 1K3BA 3EMMA 1FEMA 4I3CA 3ZW1A 4COTA 1QY2A 3SAOA 2PY1A 5D45A 5F2BA 3PH5A 3PPTA 2X32A 3NQ3A 5K67A 1SLFB 2G79A 5AQ6A 2ZSCA 3VHMA 3BU1A 4BVMA 4CPEA 3JQOA 4BGFA 4Z2PA 2WSJA 3BX7A 4JO6A 5IO6A 5H8TA 3CMPA 4CDDA 3S60A 2OVAA 1SRGA 1MX7A 2F09A 2KTDA 3EBWA 4BJ8A 1AELA 1G5WA 1I78A 4O4SA 5L8IA 1JMZA 3RE5A 1CJ5A 5LKEA 3VG2A 1KL4A 3HWDA 1JJJA 3LV4A 2OL8O 2RCQA 3FR2A 4EXZA 4YFRA 1WUBA 2GTLM 1YWBA 5AJBA 5IRAA 4CDFA 3FR5A 2X8SA 3DTQA 2G78A 1L6MA 1GGLA 2JOZA 4AZNA 1UYNX 1Y52X 2FS6A 2A5CA 1W6FA 5L8NA 1ALBA 3FENA 3D97A 5K68A 3VG4A 4KC8A 2MF6A 5EZ2A 5D8JA 1YWAA 2IZIA 2WEWA 1E02A 5FQ7E 4EEJA 2FR2A 2MWHA 1GKAA 4FBOA 1XCAA 2JU3A 4GJSA 1SWAA 1Y55X 1LELA 2A3FX 4YFQA 3N91A 2RTGB 3G7XA 5D4AA 4CPIA 5HCDC 3VG3A 1NDJA 2Q9SA 2RTQB 4A60A 1K24A 2FWVA 1XKIA 3P6DA 5KHPA 4TKJA 1IIUA 5HBSA 5IXGA 2OY5O 1BLRA 1QFTA 4O3XB 2NNDA 1BSQA 4YBUA 1SREA 4CV7A 1DZJA 3CBCA 1Y0GA 3CKGA 2VDFA 2X55A 4TNNA 4YKOA 1YWCA 4WFVA 1EI5A 4I60A 3SZIA 5BVQA 2CZTA 4YCEA 3F6ZB 1LDQA 1NGLA 4U8UN 1O1UA 1SWSA 1QWDA 2G8CO 4HPBA 4Y0QA 4ZCBA 2JU8A 1KGLA 1KT4A 2CAMA 3B2KA 4XMEA 3B2JA 3Q34A 1X89A 3FEKA 1G74A 1GM6A 3HWGA 5HCEC 3AKNA 3P24A 3ZUOA 4QNIA 1MDCA 1QY1A 1SWGA 3RDMA 3X00A 1Z24A 2A8GA 3ELZA 4ORRA 2RTDB 1VWOB 2IFBA 2FHNX 2FHLA 3HOEA 1IFBA 1SXXA 3APXA 1QQSA 4I3BA 4YGGA 4A1HA 4FBRA 2BS6A 1VWBB 1ZNHA 3ZI8A 1HQQA 4NYQA 5KIDA 2K23A 3CQNA 3Q6LA 1I04A 4JHQA 1CBSA 2UYWA 4IMNA 4ZH6A 4TLJA 3KFHA 1SWBA 1OEKA 2LBVA 4QZTA 3WYQA 4KH8A 1I9HA 4I95A 4CPHA 4MVIA 2A2UA 2RTRB 3E3CA 1HXLA 1QG5A 3HTYA 3WJFA 4BQUA 4TQ2A 2ACOA 4L1NA 3T6FA 1PBYA 1GT4A 2OL6O 4ZGFA 1VWMB 4M6SA 4GGRA 3ZZVA 3OBLA 1OBQA 1YP7A 4I3DA 4YMYA 3B2IA 2BT9A 3D9WA 4Z6JA 1VWAB 2HZRA 1ADLA 1ML7A 1GT5A 2QOSC 4ORXA 4Y0RA 4AZRA 1FELA 3L4RA 3APVA 1LPJA 3U0DA 4GE1A 4NV7A 4D6BA 1AB0A 1I06A 2X46A 3F9DA 2HZQA 1NQMA 2JGSA 4OEMA 5EDBA 4NV8A 2RTBB 1BSOA 1LCWA 1S7DA 1U18A 1VWQB 2AT3X 4CPFA 2IZCB 2HKDA 1JBHA 4GJVA 4O4OA 4R0BA 2GTFX 1FDQA 4O3ZA 4QGXA 3ELXA 1HMTA 2YG2A 4IB9A 2IZFB 3ZW2A 2L5PA 1VWDB 4YFPA 2QOMA 1LIFA 4IAWA 1VWGB 2Y32A 1EW3A 2KTSA 2A2GA 2OZQA 4TJZA 4FBVA 5FQ8E 1IJ8A 4D6AA 1T68X 5CE4A 3O19A 1LKEA 1EIIA 4BX5B 4GETA 1NP1A 4IB7A 1E06A 2FT9A 1SRIA 4MVKA 4U3QA 4QGVA 3VG6A 1UREA 1VWFB 1SY3A 5F58A 5DG4A 1B8EA 1HQPA 1EXSA 4RUUA 2P8GA 2POAA 4NP1A 1MUPA 4LZVA 1MOYA 1VWRB 3RDUA 4OELA 2OF9A 4O3YA 3UAQA 3NX1A 5CYBA 1VYFA 2LFOA 2OVSA 3D95A 4HWMA 5HA1A 2OFRX 1N9MA 3S5XA 3C77X 3GAQA 3WZOA 4QZUA 1OEEA 1KL3A 1PMPA 1SY1A 2R74A 3P02A 1LCVA 3VG7A 1SWUA 1LUQA 1O1VA 1YWDA 2OF8A 4GGTA 2C1SA 3P6HA 3I0AA 1SXUA 3TGAA 1YIVA 1ZNEA 3K3LA 1PEEA 5HTDA 5HZ6A 1RLBE 1KOIA 1BSYA 3FA9A 2BHVA 1T0VA 1KL5A 1LIBA 5LJDA 4EDEA 1QY0A 2Y3EA 1P6PA 1TOUA 2Q4NA 3SLTA 5H9KA 4NNTA 4OS0A 4MEEA 2QO4A 4ES7A 4IAXA 2X34A 1E2TA 2DJFA 4O4XA 4QRLA 2XKLA 1GX9A 3V8UA 5B29A 1SRJA 1QABE 1RXHA 2X45A 1GX3A 4Z28A 1X71A 4U8UM 3PK2A 2AF5A 5D47A 5DPQA 4QGWA 5BVSA 2AT6X 4YVBA 1CBRA 2YMSA 3DSZA 4WBKA 2RTHB 3FYFA 4IABA 1A3YA 1STSB 2IZLB 4Y0SA 4AZPA 4XMFA 3OE3A 3LTWA 1EIOA 2G5LA 1DC9A 1IKEA 1JYJA 2K62A 2Q2MA 4FQBB 3ZW1B 1VWJB 2RTNB 2A5BA 2QO5A 1DZPA 1D3SA 4DCBA 4ALBA 1AVEA 2I5ZO 1SA8A 1ZRYA 5FAZA 3WZPA 2RTKA 1X8PA 3B2LA 3FW4A 1I4UA 1SWTA 2ASNX 3FR4A 3TGCA 3T1DA 1X8NA 1LICA 2RTAA 4M7MA 4YBPA 2GJ5A 2W2AA 3B2HA 4KIIA 2QO6A 5L8OA 1W5RA 2IZAA 4A1YA 2I5VO 2OYBO 3MG5A 2RTPB 4Z27A 4LKPA 5LJBA 1MVGA 4OS3A 4NW4A 2JW1A 5K06A 1S44A 2OFBA 3OJYC 1ZNLA 4MISA 2IZEB
chains in the Genus database with same CATH topology
2HYSA 2ALLX 2RD7C 3BX8A 4L3RA 5H9NA 3WOVA 3KZAA 4YKMA 3LHNA 2BLGA 1LF7A 1ACDA 1X8OA 5B27A 2MJIA 2L67A 1N0SA 2WUTA 3P6FA 1TXLA 3CQRA 5FQ6E 1DF3A 2AMMX 1KQXA 3BDRA 3O22A 5D48A 3RSWA 4NYRA 3JSQA 3WXQA 2AH7X 3ZW0A 3FA7A 1GKAB 2L68A 4KC7A 3WBGA 1LIDA 3U03A 4GRJA 4TKHA 3P6GA 5JR8A 1VYGA 1FE3A 2AT8X 3TGBA 3EBKA 4WHIA 1ICNA 3FELA 3VU1A 4NNSA 4GKCA 1LIEA 3CBSA 3SOTA 2KD2A 1EUOA 2E4JA 2AKQA 2CBSA 4I6SA 3C78X 4IB6A 3ZWEA 1AVGI 3JS1A 4ZHDA 3UEXA 4LKTA 3F8AA 1EQDA 4GDZA 1DFVA 4HPDA 2LA7A 4EQAC 4NLIA 1B0OA 1B56A 5F6BA 4BOEA 4N7DA 2ANSA 1ICMA 2MO5A 5FENA 1PM1X 3RZYA 1ZNGA 3APWA 1GT3A 4HPCA 3U9PC 3FA6A 1X8UA 3KQ0A 4AYHA 2W2BA 3FA8A 3QKGA 4MVLA 4YDBA 4CK4A 4ZHGA 3C76X 3D4RA 2CZUA 5H9LA 4N7CA 1SXWA 1BRPA 4QYNA 4U9CA 4ZHHA 5HZ8A 2CM4A 3D96A 3PH6A 1YUPA 4OS8A 1QFVA 2LKKA 2Q39A 2CBRA 2EU7X 5EEEA 5H9AA 5LJEA 2NP1A 5LJGA 1TOWA 1I05A 1LNMA 1SY2A 4O9SA 2G7BA 1TW4A 2WR6A 3WJCA 4AZQA 1JZUA 4ARHA 1SXYA 2A13A 4KCAA 5HWZA 4DQ4A 3NP1A 3FW5A 3NBXX 2GTLO 1KZXA 2ZAIA 3IA8A 4IB8A 5BVTA 3HWFA 4WFUA 1NP4A 3MVFA 1IKJA 3HWEA 4XMCA 4K19A 4ALOA 5HZ5A 5KICA 5AEOA 2FRSA 4EFGA 5IO7A 3PQUA 2Z4HA 1OPAA 3NR3A 3AKMA 1YP6A 1HN2A 1BRQA 2NNEA 3H3IA 2Z4IA 1S2PA 1OBUA 3O2YA 3STKA 1R0UA 2M4LA 4GH7A 2W2FA 5BYPA 5EPQA 1IW2A 4DQ3A 4ZGUA 4LZUA 1D2UA 2OVDA 2RQ0A 4JGLA 5C0NA 4ID2A 1G7NA 1TVQA 4YDAA 2LB6A 5LJHA 4PSQA 3KFFA 3EM0A 1JJXA 1GXAA 4XMGA 1G5WA 5EEDA 3NPOA 5LKFA 5F6ZA 4UU3A 5FFHA 5AJCA 3FLLA 2FTBA 3UEWA 1BWYA 1T8VA 3TF6A 2XSTA 2O62A 1X8QA 2R56A 3HK1A 4INNA 4ODDA 3TZSA 4RUNA 4AZMA 4GU8A 4ZFXA 2WQ9A 4HFOA 2QM9A 4IBAA 1GX8A 1A18A 1DZMA 5F7GA 1H91A 3NX2A 4LQZA 4A8ZA 2FLJA 5EDCA 5LJCA 2MHDA 1A2DA 3CR6A 4PJ2A 3RWXA 1E5PA 3UEUA 2JU7A 2F73A 1BM5A 3RKGA 1KT7A 1KQWA 1ZNKA 3P6EA 3WJBA 2HMBA 2ACPX 2BS5A 4OMWA 4NLJA 3ZUIA 1JYDA 4KT5A 1HMSA 4IMOA 4UU2A 4MIRA 4I9SA 2HLVA 1BEBA 3WJEA 3P6CA 2DM5A 4GZVA 2AL0X 1B4MA 2R73A 4XMDA 3APUA 1O8VA 1HBQA 4QYPA 4GK9A 1ZNDA 4ORSA 2NNQA 4ZHCA 1ZNLA 1GT1A 2GTLN 1AQBA 1EPBA 1Y9TA 2FR3A 2Q2PA 1Y9LA 3NQ9A 4MVEA 1KT5A 3STMX 4ZJ0A 1EALA 1KT6A 3BS2A 1A57A 5HA0A 3GE2A 3PQSA 1RBPA 4O3WA 2X8FA 3CWKA 3S26A 1G85A 1MX8A 3BU9A 1CBIA 3ZQ3A 1UZ2X 2JMBA 4I9RA 1PBOA 1BBPA 3BLGA 1SY0A 1KXOA 2L9CA 1HMRA 5HZQA 4ZH9A 3S5VA 2OFMX 4ZR2A 3VE1A 4ORYA 1BJ7A 1ERBA 3OD9A 4HPAA 4Y0PA 2AT5X 2QMIA 4AW8A 2KW1A 1JIWI 3EYCA 1KT3A 2A0AA 2HNXA 2RCTA 2N93A 4ON1A 3WVMA 5HTEA 4GNWA 4FGIB 4OMXA 3MBTA 1VPRA 1DV9A 1OEJA 4AZOA 3KFIA 2JN3A 3PEDA 5F1EA 1SMPI 4O4UA 3IFBA 3KFGA 4QQ1A 4TKBA 3ZW0B 2KT4B 1CBQA 1IFCA 3BSZE 1CRBA 2RN4A 2LBAA 2AT0X 3NADA 3FMZA 3RBYA 4QAEA 2CM9A 2X8TA 3UEVA 3VG5A 4YH0A 1OPBA 4YCHA 1OBPA 5HZ9A 2FS7A 5HAEA 2WQAE 1DZKA 3FEPA 1KZWA 1FENA 2GC9A 4YGZA 1EPAA 3BRNA 4U8UO 3HOLA 2WWPA 2RA6A 3FIQA 1FTPA 4O49A 4ORWA 3VE2A 2OVEA 1JV4A 3MX7A 4ORUA 3VPJE 3NQKA 5IO5A 1ERXA 2ZAGA 1E00A 1U0XA 5LJKA 3PP6A 4XMHA 1U17A 3WJDA 4ML7B 1LFOA 3PECA 1HBPA 2WEXA 3BY0A 4YGHA 4ZHFA 4GNYA 4CSBA 2MM3A 3I17A 3STNA 3EMMA 1FEMA 4I3CA 3ZW1A 4COTA 1QY2A 3SAOA 2PY1A 5D45A 3PH5A 3PPTA 3NQ3A 2G79A 5AQ6A 4BVMA 3BU1A 3JQOA 5IO6A 2WSJA 3BX7A 5H8TA 3CMPA 3S60A 2OVAA 1MX7A 2F09A 2KTDA 3EBWA 1AELA 4O4SA 1CJ5A 5L8IA 5LKEA 3VG2A 3HWDA 1JJJA 3LV4A 2RCQA 3FR2A 4EXZA 4YFRA 2GTLM 1YWBA 5AJBA 3FR5A 2X8SA 3DTQA 2G78A 1L6MA 1GGLA 2JOZA 4AZNA 2FS6A 5L8NA 1ALBA 3FENA 3D97A 3VG4A 4KC8A 5EZ2A 5D8JA 1YWAA 4EEJA 2WEWA 1E02A 5FQ7E 2FR2A 2MWHA 1GKAA 4FBOA 1XCAA 2JU3A 2A3FX 4YFQA 3N91A 5D4AA 3G7XA 5HCDC 3VG3A 2Q9SA 4A60A 2FWVA 1XKIA 3P6DA 5KHPA 4TKJA 1IIUA 5HBSA 1BLRA 1QFTA 4O3XB 2NNDA 1BSQA 4YBUA 4CV7A 1DZJA 3CBCA 4TNNA 4YKOA 1YWCA 4WFVA 1EI5A 5BVQA 2CZTA 4YCEA 3F6ZB 4U8UN 1NGLA 1O1UA 4HPBA 1QWDA 4Y0QA 4ZCBA 2JU8A 1KGLA 1KT4A 3B2KA 4XMEA 3B2JA 1X89A 3FEKA 1G74A 1GM6A 3HWGA 5HCEC 3AKNA 3P24A 3ZUOA 4QNIA 1MDCA 1QY1A 1Z24A 4ORRA 3ELZA 2IFBA 3HOEA 1IFBA 1SXXA 3APXA 1QQSA 4I3BA 4YGGA 4A1HA 4FBRA 2BS6A 1ZNHA 3ZI8A 4NYQA 5KIDA 2K23A 3CQNA 3Q6LA 1I04A 1CBSA 4ZH6A 4IMNA 4TLJA 3KFHA 2LBVA 1OEKA 4QZTA 4KH8A 4I95A 4MVIA 2A2UA 3HTYA 3E3CA 1QG5A 4TQ2A 3WJFA 4BQUA 2ACOA 4L1NA 4ZGFA 1GT4A 4M6SA 3ZZVA 3OBLA 1OBQA 1YP7A 4I3DA 4YMYA 3B2IA 2BT9A 2HZRA 1ADLA 1ML7A 1GT5A 2QOSC 4ORXA 4Y0RA 4AZRA 1FELA 3L4RA 3APVA 1LPJA 3U0DA 4GE1A 4D6BA 1AB0A 1I06A 2X46A 3F9DA 2HZQA 5EDBA 1BSOA 1S7DA 1U18A 2AT3X 1JBHA 4O4OA 4R0BA 2GTFX 1FDQA 4O3ZA 4QGXA 3ELXA 1HMTA 2YG2A 4IB9A 3ZW2A 2L5PA 4YFPA 1LIFA 4IAWA 1EW3A 2KTSA 2A2GA 2OZQA 4TJZA 4FBVA 5FQ8E 4D6AA 5CE4A 1T68X 3O19A 1LKEA 1EIIA 4GETA 1NP1A 4IB7A 1E06A 2FT9A 4MVKA 4U3QA 4QGVA 3VG6A 1UREA 1SY3A 5F58A 5DG4A 1B8EA 1HQPA 1EXSA 4RUUA 2P8GA 2POAA 4NP1A 1MUPA 4LZVA 4O3YA 3UAQA 3NX1A 5CYBA 1VYFA 2LFOA 2OVSA 3D95A 4HWMA 5HA1A 2OFRX 3S5XA 3C77X 3GAQA 4QZUA 1OEEA 1PMPA 1SY1A 2R74A 3P02A 3VG7A 1O1VA 1YWDA 3P6HA 3I0AA 1SXUA 3TGAA 1YIVA 1ZNEA 3K3LA 1PEEA 5HTDA 5HZ6A 1RLBE 1KOIA 1BSYA 3FA9A 2BHVA 1T0VA 1LIBA 5LJDA 4EDEA 1QY0A 1P6PA 1TOUA 2Q4NA 5H9KA 4NNTA 4OS0A 2QO4A 4ES7A 4IAXA 4O4XA 4QRLA 3V8UA 2XKLA 1GX9A 5B29A 1QABE 2X45A 3WJGA 1X71A 4U8UM 5D47A 5HCCC 5DPQA 4QGWA 5BVSA 2AT6X 1CBRA 2YMSA 3DSZA 4WBKA 3FYFA 4IABA 1A3YA 4AZPA 4Y0SA 4XMFA 3OE3A 1EIOA 1DC9A 1IKEA 1JYJA 2Q2MA 4FQBB 3ZW1B 2QO5A 1DZPA 1D3SA 4ALBA 1SA8A 1ZRYA 5FAZA 3B2LA 1X8PA 3FW4A 1I4UA 2ASNX 3FR4A 3TGCA 3T1DA 1X8NA 1LICA 4M7MA 4YBPA 2GJ5A 2W2AA 3B2HA 4KIIA 2QO6A 5L8OA 4A1YA 5LJBA 4LKPA 1MVGA 4OS3A 4NW4A 2JW1A 5K06A 1S44A 3OJYC 2K62A 4MISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYS A;  2ALL X;  2RD7 C;  3BX8 A;  5H9N A;  3KZA A;  4YKM A;  5B27 A;  2BLG A;  1LF7 A;  1ACD A;  1X8O A;  2MJI A;  2L67 A;  1N0S A;  2WUT A;  3P6F A;  1TXL A;  3CQR A;  1DF3 A;  2AMM X;  1KQX A;  3BDR A;  3O22 A;  5D48 A;  3RSW A;  4NYR A;  3JSQ A;  3WXQ A;  2AH7 X;  3FA7 A;  1GKA B;  2L68 A;  3WBG A;  3U03 A;  1LID A;  4GRJ A;  4TKH A;  3P6G A;  5JR8 A;  1VYG A;  1FE3 A;  2AT8 X;  3TGB A;  3EBK A;  1ICN A;  3FEL A;  4NNS A;  4GKC A;  1LIE A;  3CBS A;  1EUO A;  2E4J A;  2AKQ A;  2CBS A;  3C78 X;  4IB6 A;  1AVG I;  3JS1 A;  4ZHD A;  3UEX A;  4LKT A;  3F8A A;  1EQD A;  1DFV A;  4HPD A;  4NLI A;  1B0O A;  1B56 A;  5F6B A;  4BOE A;  4N7D A;  2ANS A;  1ICM A;  2MO5 A;  5FEN A;  1PM1 X;  3RZY A;  1ZNG A;  3APW A;  1GT3 A;  4HPC A;  3U9P C;  3FA6 A;  1X8U A;  3KQ0 A;  4AYH A;  2W2B A;  3FA8 A;  3QKG A;  4MVL A;  4YDB A;  4CK4 A;  4ZHG A;  3C76 X;  5H9L A;  2CZU A;  4N7C A;  1SXW A;  1BRP A;  4QYN A;  4ZHH A;  5HZ8 A;  2CM4 A;  3D96 A;  3PH6 A;  1YUP A;  4OS8 A;  1QFV A;  2LKK A;  2Q39 A;  2CBR A;  2EU7 X;  5EEE A;  5H9A A;  5LJE A;  2NP1 A;  5LJG A;  1TOW A;  1I05 A;  1LNM A;  1SY2 A;  4O9S A;  2G7B A;  1TW4 A;  2WR6 A;  3WJC A;  4AZQ A;  1JZU A;  4ARH A;  1SXY A;  2A13 A;  5HWZ A;  4DQ4 A;  3NP1 A;  3FW5 A;  1KZX A;  3IA8 A;  4IB8 A;  5BVT A;  3HWF A;  4WFU A;  1NP4 A;  3MVF A;  1IKJ A;  3HWE A;  4XMC A;  4K19 A;  4ALO A;  5HZ5 A;  5KIC A;  2FRS A;  4EFG A;  5IO7 A;  1OPA A;  3NR3 A;  3AKM A;  1YP6 A;  1HN2 A;  1BRQ A;  2NNE A;  1S2P A;  1OBU A;  3O2Y A;  3STK A;  1R0U A;  4GH7 A;  2W2F A;  5EPQ A;  1IW2 A;  4DQ3 A;  4ZGU A;  4LZU A;  1D2U A;  2OVD A;  2RQ0 A;  5C0N A;  1G7N A;  1TVQ A;  4YDA A;  2LB6 A;  5LJH A;  4PSQ A;  3KFF A;  3EM0 A;  1JJX A;  1GXA A;  4XMG A;  1G5W A;  5EED A;  3NPO A;  5LKF A;  5F6Z A;  4UU3 A;  5FFH A;  3FLL A;  2FTB A;  3UEW A;  1BWY A;  1T8V A;  3TF6 A;  2XST A;  2O62 A;  1X8Q A;  2R56 A;  3HK1 A;  4ODD A;  3TZS A;  4RUN A;  4AZM A;  4ZFX A;  2WQ9 A;  4HFO A;  2QM9 A;  4IBA A;  1GX8 A;  1A18 A;  1DZM A;  5F7G A;  1H91 A;  3NX2 A;  4A8Z A;  2FLJ A;  5EDC A;  5LJC A;  1A2D A;  3CR6 A;  1E5P A;  3UEU A;  2JU7 A;  2F73 A;  1BM5 A;  1KT7 A;  1KQW A;  1ZNK A;  3P6E A;  3WJB A;  2HMB A;  2ACP X;  4OMW A;  4NLJ A;  3ZUI A;  1JYD A;  1HMS A;  4IMO A;  4UU2 A;  4I9S A;  2HLV A;  1BEB A;  3WJE A;  3P6C A;  2DM5 A;  2AL0 X;  1B4M A;  2R73 A;  4XMD A;  3APU A;  1O8V A;  1HBQ A;  4QYP A;  1ZND A;  4ORS A;  2NNQ A;  4ZHC A;  1ZNL A;  1GT1 A;  1AQB A;  1EPB A;  2FR3 A;  2Q2P A;  3NQ9 A;  4ZJ0 A;  3STM X;  1EAL A;  1KT5 A;  1KT6 A;  3BS2 A;  5HA0 A;  1RBP A;  3CWK A;  3S26 A;  1G85 A;  1MX8 A;  3BU9 A;  1CBI A;  3ZQ3 A;  1UZ2 X;  4I9R A;  1PBO A;  1BBP A;  3BLG A;  1SY0 A;  1KXO A;  2L9C A;  1HMR A;  5HZQ A;  4ZH9 A;  2OFM X;  4ZR2 A;  4ORY A;  1BJ7 A;  1ERB A;  4Y0P A;  4HPA A;  2AT5 X;  4AW8 A;  3EYC A;  1KT3 A;  2A0A A;  2HNX A;  2RCT A;  2N93 A;  3WVM A;  5HTE A;  4GNW A;  4OMX A;  3MBT A;  1VPR A;  1DV9 A;  1OEJ A;  4AZO A;  3KFI A;  2JN3 A;  3PED A;  5F1E A;  3IFB A;  3KFG A;  4TKB A;  2KT4 B;  1CBQ A;  1IFC A;  3BSZ E;  1CRB A;  2LBA A;  2AT0 X;  3NAD A;  3FMZ A;  4QAE A;  2CM9 A;  3UEV A;  3VG5 A;  4YH0 A;  1OPB A;  4YCH A;  1OBP A;  5HZ9 A;  2FS7 A;  5HAE A;  2WQA E;  1DZK A;  3FEP A;  1KZW A;  1FEN A;  2GC9 A;  4YGZ A;  1EPA A;  3BRN A;  2WWP A;  2RA6 A;  3FIQ A;  1FTP A;  4ORW A;  1A57 A;  2OVE A;  1JV4 A;  4ORU A;  5IO5 A;  1ERX A;  1E00 A;  1U0X A;  5LJK A;  3PP6 A;  4XMH A;  1U17 A;  3WJD A;  1LFO A;  3PEC A;  1HBP A;  2WEX A;  3BY0 A;  4YGH A;  4ZHF A;  4GNY A;  2MM3 A;  3I17 A;  3STN A;  3EMM A;  1FEM A;  4I3C A;  1QY2 A;  3SAO A;  2PY1 A;  5D45 A;  3PH5 A;  3PPT A;  3NQ3 A;  2G79 A;  5AQ6 A;  4BVM A;  3BU1 A;  5IO6 A;  2WSJ A;  3BX7 A;  5H8T A;  3CMP A;  2OVA A;  1MX7 A;  2KTD A;  3EBW A;  1AEL A;  1CJ5 A;  5L8I A;  5LKE A;  3VG2 A;  3HWD A;  1JJJ A;  2RCQ A;  3FR2 A;  4EXZ A;  4YFR A;  1YWB A;  3FR5 A;  3DTQ A;  2G78 A;  1L6M A;  1GGL A;  2JOZ A;  4AZN A;  2FS6 A;  5L8N A;  1ALB A;  3FEN A;  3D97 A;  3VG4 A;  5EZ2 A;  5D8J A;  1YWA A;  4EEJ A;  2WEW A;  1E02 A;  2FR2 A;  1GKA A;  1XCA A;  2JU3 A;  2A3F X;  4YFQ A;  5D4A A;  5HCD C;  3G7X A;  3VG3 A;  2Q9S A;  4A60 A;  2FWV A;  1XKI A;  3P6D A;  5KHP A;  4TKJ A;  1IIU A;  5HBS A;  1BLR A;  1QFT A;  2NND A;  1BSQ A;  4YBU A;  1DZJ A;  3CBC A;  4TNN A;  4YKO A;  1YWC A;  4WFV A;  5BVQ A;  2CZT A;  4YCE A;  1NGL A;  1O1U A;  4HPB A;  1QWD A;  4Y0Q A;  4ZCB A;  2JU8 A;  1KGL A;  1KT4 A;  3B2K A;  4XME A;  3B2J A;  1X89 A;  3FEK A;  1G74 A;  1GM6 A;  3HWG A;  5HCE C;  3AKN A;  3ZUO A;  1MDC A;  1QY1 A;  1Z24 A;  4ORR A;  3ELZ A;  2IFB A;  1IFB A;  1SXX A;  3APX A;  1QQS A;  4I3B A;  4YGG A;  4A1H A;  1ZNH A;  4NYQ A;  5KID A;  2K23 A;  3CQN A;  3Q6L A;  1I04 A;  1CBS A;  4ZH6 A;  4IMN A;  4TLJ A;  3KFH A;  2LBV A;  1OEK A;  4QZT A;  4MVI A;  2A2U A;  1QG5 A;  4TQ2 A;  3WJF A;  4BQU A;  2ACO A;  1GT4 A;  4M6S A;  1OBQ A;  1YP7 A;  4I3D A;  4YMY A;  3B2I A;  2HZR A;  1ADL A;  1ML7 A;  1GT5 A;  2QOS C;  4ORX A;  4Y0R A;  4AZR A;  1FEL A;  3L4R A;  3APV A;  1LPJ A;  3U0D A;  4GE1 A;  4D6B A;  1AB0 A;  1I06 A;  2X46 A;  3F9D A;  2HZQ A;  5EDB A;  1BSO A;  1S7D A;  1U18 A;  2AT3 X;  1JBH A;  4R0B A;  2GTF X;  1FDQ A;  4QGX A;  3ELX A;  1HMT A;  2YG2 A;  4IB9 A;  2L5P A;  4YFP A;  1LIF A;  4IAW A;  1EW3 A;  2A2G A;  2OZQ A;  4TJZ A;  4D6A A;  5CE4 A;  1T68 X;  3O19 A;  1LKE A;  1EII A;  4GET A;  1NP1 A;  4IB7 A;  1E06 A;  2FT9 A;  4MVK A;  4QGV A;  3VG6 A;  1URE A;  1SY3 A;  5F58 A;  5DG4 A;  1B8E A;  1HQP A;  1EXS A;  4RUU A;  2P8G A;  2POA A;  4NP1 A;  1MUP A;  4LZV A;  3NX1 A;  1VYF A;  2LFO A;  3D95 A;  5HA1 A;  2OFR X;  3C77 X;  3GAQ A;  4QZU A;  1OEE A;  1PMP A;  1SY1 A;  2R74 A;  3VG7 A;  1O1V A;  1YWD A;  3P6H A;  3I0A A;  1SXU A;  3TGA A;  1YIV A;  1ZNE A;  3K3L A;  1PEE A;  5HTD A;  5HZ6 A;  1RLB E;  1KOI A;  1BSY A;  3FA9 A;  1T0V A;  1LIB A;  5LJD A;  4EDE A;  1QY0 A;  1P6P A;  1TOU A;  2Q4N A;  5H9K A;  4NNT A;  4OS0 A;  2QO4 A;  4ES7 A;  4IAX A;  2XKL A;  1GX9 A;  5B29 A;  1QAB E;  2X45 A;  3WJG A;  1X71 A;  5D47 A;  5HCC C;  5DPQ A;  4QGW A;  5BVS A;  2AT6 X;  1CBR A;  3DSZ A;  4WBK A;  1A3Y A;  4AZP A;  4Y0S A;  4XMF A;  1EIO A;  1DC9 A;  1IKE A;  1JYJ A;  2Q2M A;  2QO5 A;  1DZP A;  1D3S A;  4ALB A;  1SA8 A;  1ZRY A;  5FAZ A;  3B2L A;  1X8P A;  3FW4 A;  1I4U A;  2ASN X;  3FR4 A;  3TGC A;  3T1D A;  1X8N A;  1LIC A;  4M7M A;  4YBP A;  2GJ5 A;  2W2A A;  3B2H A;  4KII A;  2QO6 A;  5L8O A;  4A1Y A;  5LJB A;  4LKP A;  1MVG A;  4OS3 A;  5K06 A;  1S44 A;  3OJY C;  2K62 A; 
#chains in the Genus database with same CATH topology
 2HYS A;  2ALL X;  2RD7 C;  3BX8 A;  4L3R A;  1NQN A;  4U46 A;  3KZA A;  4YKM A;  3LHN A;  2BLG A;  1LF7 A;  1ACD A;  1X8O A;  5B27 A;  2MJI A;  3RY1 A;  2L67 A;  2RTL A;  1N0S A;  2WUT A;  3P6F A;  1MEP A;  4EKV A;  1TXL A;  3CQR A;  5FQ6 E;  4Z2O A;  1DF3 A;  2AMM X;  1KQX A;  3BDR A;  3O22 A;  1VWN B;  5D48 A;  3RSW A;  5CHK A;  4GD9 A;  4NYR A;  3JSQ A;  3WXQ A;  2FKJ A;  2AH7 X;  1LCZ A;  3ZW0 A;  2BC3 A;  3FA7 A;  1GKA B;  2L68 A;  4KC7 A;  3WBG A;  1LID A;  4BX6 A;  4GRJ A;  3U03 A;  4TKH A;  3P6G A;  5JR8 A;  1VYG A;  1FE3 A;  2AT8 X;  3AEH A;  3EBK A;  3TGB A;  4WHI A;  1ICN A;  3FEL A;  3VU1 A;  4NNS A;  2Y3F A;  4GKC A;  1LIE A;  1LDO A;  1VWP B;  3CBS A;  2KD2 A;  3SOT A;  1EUO A;  2E4J A;  4BBO A;  2AKQ A;  2CBS A;  4JNJ A;  2X4M A;  4I6S A;  3C78 X;  4IB6 A;  3ZWE A;  1AVG I;  4ZJ0 A;  3JS1 A;  1RST B;  3UEX A;  4ZHD A;  3EW1 A;  4LKT A;  4GDA A;  1SWH A;  1EQD A;  3F8A A;  4GDZ A;  4BX7 A;  1DFV A;  1SWE A;  4HPD A;  2LA7 A;  4EQA C;  4NLI A;  1JMX A;  1B0O A;  1B56 A;  5F6B A;  1W4T A;  4BOE A;  4N7D A;  2ANS A;  1ICM A;  2MO5 A;  5FEN A;  1PM1 X;  3RZY A;  1ZNG A;  3APW A;  1GT3 A;  4HPC A;  3U9P C;  4GGZ A;  1MK5 A;  3FA6 A;  3T2X A;  1X8U A;  3KQ0 A;  4AYH A;  2W2B A;  3FA8 A;  3QKG A;  4MVL A;  4YDB A;  4CK4 A;  4ZHG A;  3C76 X;  3D4R A;  1SWN A;  2CZU A;  5H9L A;  1SWQ A;  4N7C A;  1SXW A;  1BRP A;  4QYN A;  4U9C A;  4ZHH A;  5HZ8 A;  2CM4 A;  3D96 A;  3PH6 A;  1YUP A;  4OS8 A;  1QFV A;  2LKK A;  2OFA A;  2Q39 A;  2CBR A;  2EU7 X;  5EEE A;  5H9A A;  5LJE A;  3RDQ A;  2NP1 A;  1PTS A;  5LJG A;  1TOW A;  1I05 A;  1LNM A;  1SY2 A;  4O9S A;  1SWR A;  5IRU A;  4CDC A;  2G7B A;  1SWC A;  1N43 A;  1TW4 A;  2WR6 A;  3VE2 A;  3WJC A;  4AZQ A;  1JZU A;  4ARH A;  1SXY A;  2A13 A;  4KCA A;  4CPH B;  4DQ4 A;  5H9N A;  5HWZ A;  3NP1 A;  3FW5 A;  1SWF A;  3NBX X;  3WJG A;  2GTL O;  1KZX A;  2ZAI A;  1SWL A;  3IA8 A;  4IB8 A;  5BVT A;  2OY8 A;  3HWF A;  4IRW A;  4WFU A;  1NP4 A;  2X56 A;  3MVF A;  1AVD A;  1SWO A;  1SRH A;  1IKJ A;  3HWE A;  4XMC A;  4K19 A;  4ALO A;  1RXJ A;  1DF8 A;  5HZ5 A;  5KIC A;  5AEO A;  1MM9 A;  2FRS A;  2IZB A;  4EFG A;  5IO7 A;  2PI3 O;  3PQU A;  2Z4H A;  3VHH A;  1OPA A;  3NR3 A;  3AKM A;  1YP6 A;  5B11 O;  3SLO A;  1HN2 A;  1BRQ A;  2NNE A;  3SLJ A;  2RTI B;  3WZQ A;  3H3I A;  2Z4I A;  1S2P A;  1OBU A;  3O2Y A;  3STK A;  1R0U A;  2M4L A;  4GH7 A;  2W2F A;  5BYP A;  5EPQ A;  1IW2 A;  2QCB A;  2VFB A;  4DQ3 A;  4LZU A;  4ZGU A;  1D2U A;  2OVD A;  2RQ0 A;  4JGL A;  5C0N A;  3RDX A;  4ID2 A;  1SLG B;  1STR B;  1G7N A;  1SWJ A;  1TVQ A;  2LB6 A;  4YDA A;  1JJU A;  2C1Q A;  1SWK A;  5LJH A;  4PSQ A;  3RY2 A;  3KFF A;  5HCC C;  3EM0 A;  1JJX A;  1GXA A;  4XMG A;  4CDE A;  5EED A;  3NPO A;  5LKF A;  4BCS A;  5F6Z A;  4UU3 A;  2OL7 A;  5FFH A;  5AJC A;  4DNE A;  3FLL A;  2FTB A;  1VWL B;  3UEW A;  1BWY A;  1VWE B;  1T8V A;  3TF6 A;  3WOV A;  1RSU B;  2XST A;  2O62 A;  1X8Q A;  2R56 A;  3HK1 A;  4INN A;  4ODD A;  3TZS A;  4RUN A;  4AZM A;  4GU8 A;  4ZFX A;  2WQ9 A;  4HFO A;  2QM9 A;  4IBA A;  1GX8 A;  1A18 A;  4Y5D A;  1DZM A;  5F7G A;  1H91 A;  3NX2 A;  3EC5 A;  4LQZ A;  2F01 A;  4A8Z A;  1STP A;  2UZ2 A;  3WYP A;  2FLJ A;  5EDC A;  5LJC A;  3SZH A;  2MHD A;  2WPU A;  1A2D A;  3CR6 A;  1KFF A;  4PJ2 A;  2FGS A;  4GUZ A;  3RWX A;  1E5P A;  3UEU A;  2JU7 A;  2F73 A;  2RTE B;  2IZH B;  1KT7 A;  3RKG A;  1BM5 A;  1N4J A;  1KQW A;  5B3M O;  1SWP A;  1ZNK A;  3P6E A;  3WJB A;  2HMB A;  4Y59 A;  2ACP X;  2OY1 O;  2BS5 A;  1SWD A;  2VFC A;  4NLJ A;  4OMW A;  1JYD A;  3SZJ A;  3ZUI A;  4KT5 A;  1HMS A;  4IMO A;  4UU2 A;  5IRW A;  4MIR A;  4I9S A;  2DJG A;  2HLV A;  3MM0 A;  1BEB A;  3WJE A;  3P6C A;  2DM5 A;  4GZV A;  2AL0 X;  3VGW A;  1B4M A;  3FID A;  2R73 A;  4XMD A;  3APU A;  1O8V A;  1HBQ A;  4QYP A;  4GK9 A;  1ZND A;  2RTM A;  4ORS A;  2NNQ A;  4ZHC A;  1GT1 A;  2GTL N;  3CKF A;  1AQB A;  1EPB A;  1Y9T A;  2FR3 A;  2Q2P A;  1Y9L A;  1NBX A;  3NQ9 A;  1KT5 A;  4MVE A;  3STM X;  3RDO A;  1EAL A;  1KT6 A;  3BS2 A;  1A57 A;  5HA0 A;  3GE2 A;  3PQS A;  1RBP A;  4O3W A;  2X8F A;  3CWK A;  3S26 A;  1G85 A;  1VWH B;  1MX8 A;  2AVI A;  3BU9 A;  1CBI A;  1N9Y A;  1UZ2 X;  2JMB A;  4I9R A;  3ZQ3 A;  1PBO A;  1BBP A;  1WBI A;  1SY0 A;  1KXO A;  2L9C A;  3BLG A;  3T6L A;  1HMR A;  5HZQ A;  4ZH9 A;  1HY2 A;  3S5V A;  2RTC B;  2OFM X;  4ZR2 A;  3VE1 A;  4ORY A;  1BJ7 A;  1ERB A;  2IZK A;  3OD9 A;  4HPA A;  2AT5 X;  2QMI A;  4Y0P A;  5B2A O;  5B5G A;  4Z2V A;  4AW8 A;  2KW1 A;  1JIW I;  3EYC A;  1KT3 A;  4B55 A;  2A0A A;  2HNX A;  2RCT A;  2N93 A;  4ON1 A;  2C4I A;  3WVM A;  5HTE A;  5B5F A;  4GNW A;  3HPE A;  4FGI B;  4OMX A;  3MBT A;  3T2W A;  4BX5 A;  1VPR A;  1DV9 A;  1OEJ A;  4AZO A;  3KFI A;  3PDF A;  5CSE A;  2JN3 A;  5B10 O;  3FDC A;  3PED A;  5F1E A;  4ZHF A;  1SMP I;  4O4U A;  3IFB A;  3KFG A;  4QQ1 A;  4TKB A;  3RE6 A;  2FKG A;  2RTO B;  3ZW0 B;  1OSP O;  2KT4 B;  4BX6 B;  1CBQ A;  1IFC A;  2RTF B;  2IZG B;  4OKA A;  5JD2 A;  3BSZ E;  1RXK A;  1CRB A;  2GH7 A;  1RAV A;  2BSZ A;  2RN4 A;  2LBA A;  3VHI A;  1SRF A;  2AT0 X;  3NAD A;  3FMZ A;  1VWI B;  3RBY A;  4QAE A;  2CM9 A;  1FJ1 E;  1Y53 X;  2X8T A;  3UEV A;  3VG5 A;  4YH0 A;  1OPB A;  3KVN A;  4YCH A;  1OBP A;  4BX7 B;  2FS7 A;  2IZJ A;  5HZ9 A;  1NC9 A;  2WQA E;  5HAE A;  1DZK A;  3FEP A;  1KZW A;  1FEN A;  2GC9 A;  4YGZ A;  1EPA A;  3BRN A;  4U8U O;  3HOL A;  2WWP A;  2RA6 A;  3FIQ A;  1FTP A;  1HXZ A;  4O49 A;  4ORW A;  2OVE A;  1JV4 A;  1SLD B;  3MX7 A;  2RTJ A;  4ORU A;  3VPJ E;  5L3Y A;  3NQK A;  5IO5 A;  1VWC B;  3RDS A;  3WZN A;  1ERX A;  2ZAG A;  1E00 A;  1U0X A;  3QQ2 A;  3PP6 A;  1JQP A;  4XMH A;  5LJK A;  1N7Y A;  1VYO A;  1U17 A;  3WJD A;  2IZD B;  3AUM O;  2OY7 A;  1SLE B;  4ML7 B;  1LFO A;  3PEC A;  1HBP A;  2WEX A;  3BY0 A;  1VWK B;  3EW2 A;  4GNY A;  4YGH A;  1UYO X;  2MM3 A;  4C5P A;  4CSB A;  3I17 A;  3STN A;  1K3B A;  3EMM A;  1FEM A;  4I3C A;  3ZW1 A;  4COT A;  1QY2 A;  3SAO A;  2PY1 A;  5D45 A;  5F2B A;  3PH5 A;  3PPT A;  2X32 A;  3NQ3 A;  5K67 A;  1SLF B;  2G79 A;  5AQ6 A;  2ZSC A;  3VHM A;  3BU1 A;  4BVM A;  4CPE A;  3JQO A;  4BGF A;  4Z2P A;  2WSJ A;  3BX7 A;  4JO6 A;  5IO6 A;  5H8T A;  3CMP A;  4CDD A;  3S60 A;  2OVA A;  1SRG A;  1MX7 A;  2F09 A;  2KTD A;  3EBW A;  4BJ8 A;  1AEL A;  1G5W A;  1I78 A;  4O4S A;  5L8I A;  1JMZ A;  3RE5 A;  1CJ5 A;  5LKE A;  3VG2 A;  1KL4 A;  3HWD A;  1JJJ A;  3LV4 A;  2OL8 O;  2RCQ A;  3FR2 A;  4EXZ A;  4YFR A;  1WUB A;  2GTL M;  1YWB A;  5AJB A;  5IRA A;  4CDF A;  3FR5 A;  2X8S A;  3DTQ A;  2G78 A;  1L6M A;  1GGL A;  2JOZ A;  4AZN A;  1UYN X;  1Y52 X;  2FS6 A;  2A5C A;  1W6F A;  5L8N A;  1ALB A;  3FEN A;  3D97 A;  5K68 A;  3VG4 A;  4KC8 A;  2MF6 A;  5EZ2 A;  5D8J A;  1YWA A;  2IZI A;  2WEW A;  1E02 A;  5FQ7 E;  4EEJ A;  2FR2 A;  2MWH A;  1GKA A;  4FBO A;  1XCA A;  2JU3 A;  4GJS A;  1SWA A;  1Y55 X;  1LEL A;  2A3F X;  4YFQ A;  3N91 A;  2RTG B;  3G7X A;  5D4A A;  4CPI A;  5HCD C;  3VG3 A;  1NDJ A;  2Q9S A;  2RTQ B;  4A60 A;  1K24 A;  2FWV A;  1XKI A;  3P6D A;  5KHP A;  4TKJ A;  1IIU A;  5HBS A;  5IXG A;  2OY5 O;  1BLR A;  1QFT A;  4O3X B;  2NND A;  1BSQ A;  4YBU A;  1SRE A;  4CV7 A;  1DZJ A;  3CBC A;  1Y0G A;  3CKG A;  2VDF A;  2X55 A;  4TNN A;  4YKO A;  1YWC A;  4WFV A;  1EI5 A;  4I60 A;  3SZI A;  5BVQ A;  2CZT A;  4YCE A;  3F6Z B;  1LDQ A;  1NGL A;  4U8U N;  1O1U A;  1SWS A;  1QWD A;  2G8C O;  4HPB A;  4Y0Q A;  4ZCB A;  2JU8 A;  1KGL A;  1KT4 A;  2CAM A;  3B2K A;  4XME A;  3B2J A;  3Q34 A;  1X89 A;  3FEK A;  1G74 A;  1GM6 A;  3HWG A;  5HCE C;  3AKN A;  3P24 A;  3ZUO A;  4QNI A;  1MDC A;  1QY1 A;  1SWG A;  3RDM A;  3X00 A;  1Z24 A;  2A8G A;  3ELZ A;  4ORR A;  2RTD B;  1VWO B;  2IFB A;  2FHN X;  2FHL A;  3HOE A;  1IFB A;  1SXX A;  3APX A;  1QQS A;  4I3B A;  4YGG A;  4A1H A;  4FBR A;  2BS6 A;  1VWB B;  1ZNH A;  3ZI8 A;  1HQQ A;  4NYQ A;  5KID A;  2K23 A;  3CQN A;  3Q6L A;  1I04 A;  4JHQ A;  1CBS A;  2UYW A;  4IMN A;  4ZH6 A;  4TLJ A;  3KFH A;  1SWB A;  1OEK A;  2LBV A;  4QZT A;  3WYQ A;  4KH8 A;  1I9H A;  4I95 A;  4CPH A;  4MVI A;  2A2U A;  2RTR B;  3E3C A;  1HXL A;  1QG5 A;  3HTY A;  3WJF A;  4BQU A;  4TQ2 A;  2ACO A;  4L1N A;  3T6F A;  1PBY A;  1GT4 A;  2OL6 O;  4ZGF A;  1VWM B;  4M6S A;  4GGR A;  3ZZV A;  3OBL A;  1OBQ A;  1YP7 A;  4I3D A;  4YMY A;  3B2I A;  2BT9 A;  3D9W A;  4Z6J A;  1VWA B;  2HZR A;  1ADL A;  1ML7 A;  1GT5 A;  2QOS C;  4ORX A;  4Y0R A;  4AZR A;  1FEL A;  3L4R A;  3APV A;  1LPJ A;  3U0D A;  4GE1 A;  4NV7 A;  4D6B A;  1AB0 A;  1I06 A;  2X46 A;  3F9D A;  2HZQ A;  1NQM A;  2JGS A;  4OEM A;  5EDB A;  4NV8 A;  2RTB B;  1BSO A;  1LCW A;  1S7D A;  1U18 A;  1VWQ B;  2AT3 X;  4CPF A;  2IZC B;  2HKD A;  1JBH A;  4GJV A;  4O4O A;  4R0B A;  2GTF X;  1FDQ A;  4O3Z A;  4QGX A;  3ELX A;  1HMT A;  2YG2 A;  4IB9 A;  2IZF B;  3ZW2 A;  2L5P A;  1VWD B;  4YFP A;  2QOM A;  1LIF A;  4IAW A;  1VWG B;  2Y32 A;  1EW3 A;  2KTS A;  2A2G A;  2OZQ A;  4TJZ A;  4FBV A;  5FQ8 E;  1IJ8 A;  4D6A A;  1T68 X;  5CE4 A;  3O19 A;  1LKE A;  1EII A;  4BX5 B;  4GET A;  1NP1 A;  4IB7 A;  1E06 A;  2FT9 A;  1SRI A;  4MVK A;  4U3Q A;  4QGV A;  3VG6 A;  1URE A;  1VWF B;  1SY3 A;  5F58 A;  5DG4 A;  1B8E A;  1HQP A;  1EXS A;  4RUU A;  2P8G A;  2POA A;  4NP1 A;  1MUP A;  4LZV A;  1MOY A;  1VWR B;  3RDU A;  4OEL A;  2OF9 A;  4O3Y A;  3UAQ A;  3NX1 A;  5CYB A;  1VYF A;  2LFO A;  2OVS A;  3D95 A;  4HWM A;  5HA1 A;  2OFR X;  1N9M A;  3S5X A;  3C77 X;  3GAQ A;  3WZO A;  4QZU A;  1OEE A;  1KL3 A;  1PMP A;  1SY1 A;  2R74 A;  3P02 A;  1LCV A;  3VG7 A;  1SWU A;  1LUQ A;  1O1V A;  1YWD A;  2OF8 A;  4GGT A;  2C1S A;  3P6H A;  3I0A A;  1SXU A;  3TGA A;  1YIV A;  1ZNE A;  3K3L A;  1PEE A;  5HTD A;  5HZ6 A;  1RLB E;  1KOI A;  1BSY A;  3FA9 A;  2BHV A;  1T0V A;  1KL5 A;  1LIB A;  5LJD A;  4EDE A;  1QY0 A;  2Y3E A;  1P6P A;  1TOU A;  2Q4N A;  3SLT A;  5H9K A;  4NNT A;  4OS0 A;  4MEE A;  2QO4 A;  4ES7 A;  4IAX A;  2X34 A;  1E2T A;  2DJF A;  4O4X A;  4QRL A;  2XKL A;  1GX9 A;  3V8U A;  5B29 A;  1SRJ A;  1QAB E;  1RXH A;  2X45 A;  1GX3 A;  4Z28 A;  1X71 A;  4U8U M;  3PK2 A;  2AF5 A;  5D47 A;  5DPQ A;  4QGW A;  5BVS A;  2AT6 X;  4YVB A;  1CBR A;  2YMS A;  3DSZ A;  4WBK A;  2RTH B;  3FYF A;  4IAB A;  1A3Y A;  1STS B;  2IZL B;  4Y0S A;  4AZP A;  4XMF A;  3OE3 A;  3LTW A;  1EIO A;  2G5L A;  1DC9 A;  1IKE A;  1JYJ A;  2K62 A;  2Q2M A;  4FQB B;  3ZW1 B;  1VWJ B;  2RTN B;  2A5B A;  2QO5 A;  1DZP A;  1D3S A;  4DCB A;  4ALB A;  1AVE A;  2I5Z O;  1SA8 A;  1ZRY A;  5FAZ A;  3WZP A;  2RTK A;  1X8P A;  3B2L A;  3FW4 A;  1I4U A;  1SWT A;  2ASN X;  3FR4 A;  3TGC A;  3T1D A;  1X8N A;  1LIC A;  2RTA A;  4M7M A;  4YBP A;  2GJ5 A;  2W2A A;  3B2H A;  4KII A;  2QO6 A;  5L8O A;  1W5R A;  2IZA A;  4A1Y A;  2I5V O;  2OYB O;  3MG5 A;  2RTP B;  4Z27 A;  4LKP A;  5LJB A;  1MVG A;  4OS3 A;  4NW4 A;  2JW1 A;  5K06 A;  1S44 A;  2OFB A;  3OJY C;  1ZNL A;  4MIS A;  2IZE B; 
#chains in the Genus database with same CATH homology
 2HYS A;  2ALL X;  2RD7 C;  3BX8 A;  4L3R A;  5H9N A;  3WOV A;  3KZA A;  4YKM A;  3LHN A;  2BLG A;  1LF7 A;  1ACD A;  1X8O A;  5B27 A;  2MJI A;  2L67 A;  1N0S A;  2WUT A;  3P6F A;  1TXL A;  3CQR A;  5FQ6 E;  1DF3 A;  2AMM X;  1KQX A;  3BDR A;  3O22 A;  5D48 A;  3RSW A;  4NYR A;  3JSQ A;  3WXQ A;  2AH7 X;  3ZW0 A;  3FA7 A;  1GKA B;  2L68 A;  4KC7 A;  3WBG A;  1LID A;  3U03 A;  4GRJ A;  4TKH A;  3P6G A;  5JR8 A;  1VYG A;  1FE3 A;  2AT8 X;  3TGB A;  3EBK A;  4WHI A;  1ICN A;  3FEL A;  3VU1 A;  4NNS A;  4GKC A;  1LIE A;  3CBS A;  3SOT A;  2KD2 A;  1EUO A;  2E4J A;  2AKQ A;  2CBS A;  4I6S A;  3C78 X;  4IB6 A;  3ZWE A;  1AVG I;  3JS1 A;  4ZHD A;  3UEX A;  4LKT A;  3F8A A;  1EQD A;  4GDZ A;  1DFV A;  4HPD A;  2LA7 A;  4EQA C;  4NLI A;  1B0O A;  1B56 A;  5F6B A;  4BOE A;  4N7D A;  2ANS A;  1ICM A;  2MO5 A;  5FEN A;  1PM1 X;  3RZY A;  1ZNG A;  3APW A;  1GT3 A;  4HPC A;  3U9P C;  3FA6 A;  1X8U A;  3KQ0 A;  4AYH A;  2W2B A;  3FA8 A;  3QKG A;  4MVL A;  4YDB A;  4CK4 A;  4ZHG A;  3C76 X;  3D4R A;  2CZU A;  5H9L A;  4N7C A;  1SXW A;  1BRP A;  4QYN A;  4U9C A;  4ZHH A;  5HZ8 A;  2CM4 A;  3D96 A;  3PH6 A;  1YUP A;  4OS8 A;  1QFV A;  2LKK A;  2Q39 A;  2CBR A;  2EU7 X;  5EEE A;  5H9A A;  5LJE A;  2NP1 A;  5LJG A;  1TOW A;  1I05 A;  1LNM A;  1SY2 A;  4O9S A;  2G7B A;  1TW4 A;  2WR6 A;  3WJC A;  4AZQ A;  1JZU A;  4ARH A;  1SXY A;  2A13 A;  4KCA A;  5HWZ A;  4DQ4 A;  3NP1 A;  3FW5 A;  3NBX X;  2GTL O;  1KZX A;  2ZAI A;  3IA8 A;  4IB8 A;  5BVT A;  3HWF A;  4WFU A;  1NP4 A;  3MVF A;  1IKJ A;  3HWE A;  4XMC A;  4K19 A;  4ALO A;  5HZ5 A;  5KIC A;  5AEO A;  2FRS A;  4EFG A;  5IO7 A;  3PQU A;  2Z4H A;  1OPA A;  3NR3 A;  3AKM A;  1YP6 A;  1HN2 A;  1BRQ A;  2NNE A;  3H3I A;  2Z4I A;  1S2P A;  1OBU A;  3O2Y A;  3STK A;  1R0U A;  2M4L A;  4GH7 A;  2W2F A;  5BYP A;  5EPQ A;  1IW2 A;  4DQ3 A;  4ZGU A;  4LZU A;  1D2U A;  2OVD A;  2RQ0 A;  4JGL A;  5C0N A;  4ID2 A;  1G7N A;  1TVQ A;  4YDA A;  2LB6 A;  5LJH A;  4PSQ A;  3KFF A;  3EM0 A;  1JJX A;  1GXA A;  4XMG A;  1G5W A;  5EED A;  3NPO A;  5LKF A;  5F6Z A;  4UU3 A;  5FFH A;  5AJC A;  3FLL A;  2FTB A;  3UEW A;  1BWY A;  1T8V A;  3TF6 A;  2XST A;  2O62 A;  1X8Q A;  2R56 A;  3HK1 A;  4INN A;  4ODD A;  3TZS A;  4RUN A;  4AZM A;  4GU8 A;  4ZFX A;  2WQ9 A;  4HFO A;  2QM9 A;  4IBA A;  1GX8 A;  1A18 A;  1DZM A;  5F7G A;  1H91 A;  3NX2 A;  4LQZ A;  4A8Z A;  2FLJ A;  5EDC A;  5LJC A;  2MHD A;  1A2D A;  3CR6 A;  4PJ2 A;  3RWX A;  1E5P A;  3UEU A;  2JU7 A;  2F73 A;  1BM5 A;  3RKG A;  1KT7 A;  1KQW A;  1ZNK A;  3P6E A;  3WJB A;  2HMB A;  2ACP X;  2BS5 A;  4OMW A;  4NLJ A;  3ZUI A;  1JYD A;  4KT5 A;  1HMS A;  4IMO A;  4UU2 A;  4MIR A;  4I9S A;  2HLV A;  1BEB A;  3WJE A;  3P6C A;  2DM5 A;  4GZV A;  2AL0 X;  1B4M A;  2R73 A;  4XMD A;  3APU A;  1O8V A;  1HBQ A;  4QYP A;  4GK9 A;  1ZND A;  4ORS A;  2NNQ A;  4ZHC A;  1ZNL A;  1GT1 A;  2GTL N;  1AQB A;  1EPB A;  1Y9T A;  2FR3 A;  2Q2P A;  1Y9L A;  3NQ9 A;  4MVE A;  1KT5 A;  3STM X;  4ZJ0 A;  1EAL A;  1KT6 A;  3BS2 A;  1A57 A;  5HA0 A;  3GE2 A;  3PQS A;  1RBP A;  4O3W A;  2X8F A;  3CWK A;  3S26 A;  1G85 A;  1MX8 A;  3BU9 A;  1CBI A;  3ZQ3 A;  1UZ2 X;  2JMB A;  4I9R A;  1PBO A;  1BBP A;  3BLG A;  1SY0 A;  1KXO A;  2L9C A;  1HMR A;  5HZQ A;  4ZH9 A;  3S5V A;  2OFM X;  4ZR2 A;  3VE1 A;  4ORY A;  1BJ7 A;  1ERB A;  3OD9 A;  4HPA A;  4Y0P A;  2AT5 X;  2QMI A;  4AW8 A;  2KW1 A;  1JIW I;  3EYC A;  1KT3 A;  2A0A A;  2HNX A;  2RCT A;  2N93 A;  4ON1 A;  3WVM A;  5HTE A;  4GNW A;  4FGI B;  4OMX A;  3MBT A;  1VPR A;  1DV9 A;  1OEJ A;  4AZO A;  3KFI A;  2JN3 A;  3PED A;  5F1E A;  1SMP I;  4O4U A;  3IFB A;  3KFG A;  4QQ1 A;  4TKB A;  3ZW0 B;  2KT4 B;  1CBQ A;  1IFC A;  3BSZ E;  1CRB A;  2RN4 A;  2LBA A;  2AT0 X;  3NAD A;  3FMZ A;  3RBY A;  4QAE A;  2CM9 A;  2X8T A;  3UEV A;  3VG5 A;  4YH0 A;  1OPB A;  4YCH A;  1OBP A;  5HZ9 A;  2FS7 A;  5HAE A;  2WQA E;  1DZK A;  3FEP A;  1KZW A;  1FEN A;  2GC9 A;  4YGZ A;  1EPA A;  3BRN A;  4U8U O;  3HOL A;  2WWP A;  2RA6 A;  3FIQ A;  1FTP A;  4O49 A;  4ORW A;  3VE2 A;  2OVE A;  1JV4 A;  3MX7 A;  4ORU A;  3VPJ E;  3NQK A;  5IO5 A;  1ERX A;  2ZAG A;  1E00 A;  1U0X A;  5LJK A;  3PP6 A;  4XMH A;  1U17 A;  3WJD A;  4ML7 B;  1LFO A;  3PEC A;  1HBP A;  2WEX A;  3BY0 A;  4YGH A;  4ZHF A;  4GNY A;  4CSB A;  2MM3 A;  3I17 A;  3STN A;  3EMM A;  1FEM A;  4I3C A;  3ZW1 A;  4COT A;  1QY2 A;  3SAO A;  2PY1 A;  5D45 A;  3PH5 A;  3PPT A;  3NQ3 A;  2G79 A;  5AQ6 A;  4BVM A;  3BU1 A;  3JQO A;  5IO6 A;  2WSJ A;  3BX7 A;  5H8T A;  3CMP A;  3S60 A;  2OVA A;  1MX7 A;  2F09 A;  2KTD A;  3EBW A;  1AEL A;  4O4S A;  1CJ5 A;  5L8I A;  5LKE A;  3VG2 A;  3HWD A;  1JJJ A;  3LV4 A;  2RCQ A;  3FR2 A;  4EXZ A;  4YFR A;  2GTL M;  1YWB A;  5AJB A;  3FR5 A;  2X8S A;  3DTQ A;  2G78 A;  1L6M A;  1GGL A;  2JOZ A;  4AZN A;  2FS6 A;  5L8N A;  1ALB A;  3FEN A;  3D97 A;  3VG4 A;  4KC8 A;  5EZ2 A;  5D8J A;  1YWA A;  4EEJ A;  2WEW A;  1E02 A;  5FQ7 E;  2FR2 A;  2MWH A;  1GKA A;  4FBO A;  1XCA A;  2JU3 A;  2A3F X;  4YFQ A;  3N91 A;  5D4A A;  3G7X A;  5HCD C;  3VG3 A;  2Q9S A;  4A60 A;  2FWV A;  1XKI A;  3P6D A;  5KHP A;  4TKJ A;  1IIU A;  5HBS A;  1BLR A;  1QFT A;  4O3X B;  2NND A;  1BSQ A;  4YBU A;  4CV7 A;  1DZJ A;  3CBC A;  4TNN A;  4YKO A;  1YWC A;  4WFV A;  1EI5 A;  5BVQ A;  2CZT A;  4YCE A;  3F6Z B;  4U8U N;  1NGL A;  1O1U A;  4HPB A;  1QWD A;  4Y0Q A;  4ZCB A;  2JU8 A;  1KGL A;  1KT4 A;  3B2K A;  4XME A;  3B2J A;  1X89 A;  3FEK A;  1G74 A;  1GM6 A;  3HWG A;  5HCE C;  3AKN A;  3P24 A;  3ZUO A;  4QNI A;  1MDC A;  1QY1 A;  1Z24 A;  4ORR A;  3ELZ A;  2IFB A;  3HOE A;  1IFB A;  1SXX A;  3APX A;  1QQS A;  4I3B A;  4YGG A;  4A1H A;  4FBR A;  2BS6 A;  1ZNH A;  3ZI8 A;  4NYQ A;  5KID A;  2K23 A;  3CQN A;  3Q6L A;  1I04 A;  1CBS A;  4ZH6 A;  4IMN A;  4TLJ A;  3KFH A;  2LBV A;  1OEK A;  4QZT A;  4KH8 A;  4I95 A;  4MVI A;  2A2U A;  3HTY A;  3E3C A;  1QG5 A;  4TQ2 A;  3WJF A;  4BQU A;  2ACO A;  4L1N A;  4ZGF A;  1GT4 A;  4M6S A;  3ZZV A;  3OBL A;  1OBQ A;  1YP7 A;  4I3D A;  4YMY A;  3B2I A;  2BT9 A;  2HZR A;  1ADL A;  1ML7 A;  1GT5 A;  2QOS C;  4ORX A;  4Y0R A;  4AZR A;  1FEL A;  3L4R A;  3APV A;  1LPJ A;  3U0D A;  4GE1 A;  4D6B A;  1AB0 A;  1I06 A;  2X46 A;  3F9D A;  2HZQ A;  5EDB A;  1BSO A;  1S7D A;  1U18 A;  2AT3 X;  1JBH A;  4O4O A;  4R0B A;  2GTF X;  1FDQ A;  4O3Z A;  4QGX A;  3ELX A;  1HMT A;  2YG2 A;  4IB9 A;  3ZW2 A;  2L5P A;  4YFP A;  1LIF A;  4IAW A;  1EW3 A;  2KTS A;  2A2G A;  2OZQ A;  4TJZ A;  4FBV A;  5FQ8 E;  4D6A A;  5CE4 A;  1T68 X;  3O19 A;  1LKE A;  1EII A;  4GET A;  1NP1 A;  4IB7 A;  1E06 A;  2FT9 A;  4MVK A;  4U3Q A;  4QGV A;  3VG6 A;  1URE A;  1SY3 A;  5F58 A;  5DG4 A;  1B8E A;  1HQP A;  1EXS A;  4RUU A;  2P8G A;  2POA A;  4NP1 A;  1MUP A;  4LZV A;  4O3Y A;  3UAQ A;  3NX1 A;  5CYB A;  1VYF A;  2LFO A;  2OVS A;  3D95 A;  4HWM A;  5HA1 A;  2OFR X;  3S5X A;  3C77 X;  3GAQ A;  4QZU A;  1OEE A;  1PMP A;  1SY1 A;  2R74 A;  3P02 A;  3VG7 A;  1O1V A;  1YWD A;  3P6H A;  3I0A A;  1SXU A;  3TGA A;  1YIV A;  1ZNE A;  3K3L A;  1PEE A;  5HTD A;  5HZ6 A;  1RLB E;  1KOI A;  1BSY A;  3FA9 A;  2BHV A;  1T0V A;  1LIB A;  5LJD A;  4EDE A;  1QY0 A;  1P6P A;  1TOU A;  2Q4N A;  5H9K A;  4NNT A;  4OS0 A;  2QO4 A;  4ES7 A;  4IAX A;  4O4X A;  4QRL A;  3V8U A;  2XKL A;  1GX9 A;  5B29 A;  1QAB E;  2X45 A;  3WJG A;  1X71 A;  4U8U M;  5D47 A;  5HCC C;  5DPQ A;  4QGW A;  5BVS A;  2AT6 X;  1CBR A;  2YMS A;  3DSZ A;  4WBK A;  3FYF A;  4IAB A;  1A3Y A;  4AZP A;  4Y0S A;  4XMF A;  3OE3 A;  1EIO A;  1DC9 A;  1IKE A;  1JYJ A;  2Q2M A;  4FQB B;  3ZW1 B;  2QO5 A;  1DZP A;  1D3S A;  4ALB A;  1SA8 A;  1ZRY A;  5FAZ A;  3B2L A;  1X8P A;  3FW4 A;  1I4U A;  2ASN X;  3FR4 A;  3TGC A;  3T1D A;  1X8N A;  1LIC A;  4M7M A;  4YBP A;  2GJ5 A;  2W2A A;  3B2H A;  4KII A;  2QO6 A;  5L8O A;  4A1Y A;  5LJB A;  4LKP A;  1MVG A;  4OS3 A;  4NW4 A;  2JW1 A;  5K06 A;  1S44 A;  3OJY C;  2K62 A;  4MIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...