2QO4A

Crystal structure of zebrafish liver bile acid-binding protein complexed with cholic acid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
125
structure length
125
Chain Sequence
AFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Liver-basic fatty acid binding protein
publication title A Single Amino Acid Mutation in Zebrafish (Danio rerio) Liver Bile Acid-binding Protein Can Change the Stoichiometry of Ligand Binding.
pubmed doi rcsb
source organism Danio rerio
total genus 25
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14651 Lipocalin_7 Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2qo4A00
1LIBA 4A1YA 1OBQA 1G74A 4YFPA 5EPQA 2QO6A 2FR2A 4EFGA 4IB7A 5BVSA 5LJEA 3PP6A 3P6CA 4YBUA 1U17A 1RBPA 4WFVA 4ZFXA 1ML7A 3WVMA 3CMPA 4D6BA 1JYJA 4OMWA 4ZCBA 1SY3A 3TGBA 3PH6A 4IB9A 2IFBA 1CJ5A 5HCCC 4ZHHA 1L6MA 1QQSA 4WBKA 4QYNA 4YBPA 3FA7A 4NYQA 5HTEA 2Q4NA 2WEXA 2NNDA 4ZGUA 3FR5A 3FW5A 2ACPX 5LKEA 1FTPA 5HZQA 4M7MA 1X8QA 4RUNA 1VPRA 4QGVA 1NP4A 4AYHA 2OFRX 1GKAA 4D6AA 4YCEA 2ALLX 5HTDA 4TKBA 5HCDC 4IAWA 2AL0X 5HZ6A 4ORWA 2L67A 2WSJA 2LKKA 5D4AA 3CBSA 1B0OA 4XMGA 1FDQA 2Q2MA 2R73A 3TGAA 4ES7A 2N93A 1QG5A 3D96A 2ANSA 3IFBA 1BSOA 1GX8A 3FENA 2LB6A 3ELZA 3B2KA 1I4UA 4AZQA 5C0NA 1QY1A 5HA1A 5B29A 1LFOA 3BX8A 3APXA 3VG6A 2Q9SA 4I3DA 4IB6A 1X89A 5LJCA 1ZNLA 4YGZA 3STMX 1B4MA 4GE1A 4XMEA 4XMCA 2X46A 1IW2A 3D97A 2GTFX 1T68X 3HWFA 2L9CA 3S26A 3C77X 2PY1A 2JU8A 4Y0SA 4ZH6A 3VG3A 2AT3X 4TKHA 1QY2A 1MX8A 1OBPA 3PPTA 5HAEA 3NADA 5JR8A 3ZUIA 3Q6LA 4YDAA 1OEEA 1YWBA 4YCHA 2HZQA 4MVKA 3QKGA 4QZUA 1HMRA 1RLBE 5K06A 4QGXA 1TOUA 3O22A 4YFRA 1VYGA 2Q2PA 4AZPA 2WQAE 3FA6A 3B2IA 1I04A 4IMNA 1D3SA 1A2DA 5L8IA 3OJYC 4KIIA 3UEXA 3WXQA 3FIQA 4M6SA 3WJBA 2G79A 5D45A 4Y0QA 1X8UA 4NYRA 1GT1A 1G7NA 4N7CA 3WBGA 1BRQA 2XKLA 4TQ2A 3BY0A 3EBWA 1ZNEA 1EALA 4TJZA 1GT5A 4ORSA 2CZUA 2POAA 3BS2A 1A57A 2R74A 1AQBA 1KT5A 1JZUA 1E02A 3BRNA 4DQ3A 2WQ9A 1I05A 1JYDA 2JU3A 3TGCA 3RZYA 4O9SA 1BJ7A 1EIIA 4EXZA 2KTDA 3FR2A 1SY2A 3KFHA 4XMFA 4AW8A 3P6DA 2ACOA 1LKEA 1CBSA 3U03A 2WUTA 4AZRA 1YWDA 5H9LA 1XKIA 3PECA 4AZOA 1LPJA 4MVLA 4NP1A 1ALBA 4LZVA 1EW3A 1YP7A 1YWCA 2DM5A 5BVQA 5EDCA 2XSTA 2FLJA 4YGGA 5FFHA 1VYFA 1BWYA 3AKMA 5F7GA 5D48A 4A8ZA 3HWDA 4I9SA 5EEDA 5F1EA 1MX7A 2MO5A 4OMXA 1CBRA 1KT6A 2AKQA 4LZUA 4BOEA 4EDEA 4QGWA 3P6EA 3SAOA 5F6ZA 1ICNA 3B2HA 3BU1A 1SXWA 5HA0A 3VG2A 4AZMA 2L68A 5D8JA 1LICA 1O1VA 4Y0PA 3I17A 1IFBA 1KZXA 1TW4A 3C78X 5KICA 5FENA 3STNA 1X8OA 3FR4A 3CBCA 3WJEA 4GETA 1HBPA 1PBOA 2YG2A 3KZAA 5D47A 1IFCA 5HBSA 2OFMX 3NQ3A 3O2YA 1B8EA 1DZKA 1LNMA 1SXUA 3F8AA 1GKAB 1KOIA 4YKMA 1ACDA 3P6GA 1AELA 3FEPA 2HLVA 2MM3A 3CQRA 4GKCA 3B2LA 1KQWA 1BBPA 2A0AA 3FMZA 2RQ0A 5H9KA 1JBHA 3WJGA 2AT5X 5DPQA 2NNQA 1TVQA 1AVGI 1U18A 4YKOA 3NR3A 1UREA 2E4JA 2FS6A 3FA8A 5AQ6A 5B27A 3STKA 1GT4A 2FS7A 2RCTA 2A13A 2O62A 1SXYA 2OVEA 2WWPA 3EYCA 3VG5A 1CBIA 5BVTA 2OZQA 3NQ9A 3UEUA 4LKTA 2BLGA 3KFGA 5LJGA 3CQNA 3VG4A 4EEJA 1FE3A 4ORUA 4ODDA 1DFVA 1BM5A 2A2UA 5LJBA 2LBVA 1DZMA 2NNEA 5LJDA 1CBQA 4A60A 1FEMA 4A1HA 1EXSA 3CR6A 1KT7A 3RSWA 5F58A 2GJ5A 3I0AA 4YMYA 1KT4A 2CM4A 2NP1A 1SY1A 4GH7A 1I06A 4ORYA 4GNYA 1SA8A 3HWEA 3U9PC 3K3LA 4NNSA 1OPBA 1OPAA 2A3FX 2G78A 2FTBA 3HWGA 5HZ8A 3D95A 4I9RA 3NX2A 4OS0A 1MDCA 3C76X 1EUOA 3JS1A 1E06A 1QFTA 4DQ4A 3KQ0A 1KZWA 1EQDA 1EIOA 2W2BA 3APUA 1ADLA 1BEBA 3HK1A 5HCEC 1JJJA 1HN2A 4LKPA 4ZJ0A 1IIUA 3EM0A 4IAXA 3JSQA 5KHPA 2ASNX 4AZNA 5HZ9A 1DV9A 4ZHFA 4HFOA 4IBAA 2CM9A 1X71A 4R0BA 5FAZA 2KT4B 2X45A 4YGHA 3WJCA 1EPBA 4UU3A 2EU7X 3FA9A 2WEWA 3BU9A 3BLGA 1A18A 5HWZA 2CBSA 3NP1A 4YH0A 1QWDA 1GM6A 5H8TA 3NPOA 2HMBA 2JN3A 1OBUA 3TF6A 5HZ5A 1T8VA 1HBQA 1E5PA 2AT8X 4BVMA 3O19A 2CZTA 1ZNHA 5LKFA 3P6HA 2QO5A 4XMDA 1KQXA 3ZQ3A 1TXLA 2JU7A 3GAQA 1ZNGA 4IB8A 4TKJA 5EDBA 1MUPA 1ZNDA 2FRSA 3EMMA 2L5PA 2RA6A 2QOSC 4ALOA 2AMMX 5F6BA 2HYSA 2Q39A 2HZRA 4NLJA 4HPDA 4I3CA 1XCAA 4ORXA 4ZHGA 1N0SA 1SY0A 1S7DA 1YWAA 2W2FA 1D2UA 4HPCA 4OS3A 1ZNKA 3BX7A 1X8PA 1SXXA 2HNXA 2JOZA 5CE4A 1GX9A 3NX1A 2A2GA 1YP6A 1LIFA 5L8OA 1HQPA 3APWA 1PMPA 1JJXA 1NGLA 3BDRA 1IKJA 3MBTA 1LIEA 2OVAA 3APVA 3EBKA 5L8NA 2GC9A 1BSQA 4MVIA 3IA8A 4XMHA 5IO5A 5IO6A 4QYPA 4OS8A 1HMTA 1JV4A 3WJFA 4BQUA 2F73A 3F9DA 1AB0A 1R0UA 2FR3A 1BRPA 1Z24A 1DF3A 1G5WA 2G7BA 1O8VA 1CRBA 4QAEA 1BSYA 3CWKA 1T0VA 4ARHA 5IO7A 4ZHDA 1LF7A 3ZUOA 1YIVA 4ORRA 1B56A 3UEVA 4TNNA 1QY0A 4ZH9A 3KFFA 4ALBA 4YFQA 1ERBA 1PM1X 4NNTA 1TOWA 1E00A 3AKNA 4ZHCA 1MVGA 1YUPA 1G85A 1DZPA 1KXOA 1IKEA 1O1UA 3TZSA 1KGLA 3FELA 1NP1A 3DTQA 4UU2A 1DZJA 1U0XA 3UEWA 2MJIA 3L4RA 3DSZA 1ZRYA 3ELXA 1X8NA 3WJDA 5LJHA 1ICMA 2K23A 4PSQA 3U0DA 1S2PA 1A3YA 1LIDA 3G7XA 2AT0X 5EEEA 1ERXA 1UZ2X 1QABE 5KIDA 1DC9A 4N7DA 2AH7X 4K19A 1P6PA 3PEDA 4HPBA 1H91A 3FW4A 2P8GA 2RCQA 1QFVA 4GNWA 2QO4A 3BSZE 1GXAA 4I3BA 5H9AA 1S44A 1PEEA 2W2AA 1KT3A 3KFIA 4RUUA 2LBAA 2FT9A 2OVDA 5LJKA 1BLRA 4CK4A 2K62A 4TLJA 5H9NA 1HMSA 3FEKA 2WR6A 1GGLA 4WFUA 3VG7A 4NLIA 1FENA 1EPAA 2LFOA 3MVFA 3T1DA 2FWVA 1GT3A 5DG4A 3P6FA 2RD7C 3FLLA 1OEJA 2QM9A 4ZR2A 4QZTA 2R56A 4YDBA 4HPAA 2AT6X 1OEKA 2CBRA 4GRJA 4IMOA 3B2JA 5EZ2A 4Y0RA 3PH5A 1FELA
chains in the Genus database with same CATH superfamily
1LIBA 3ZW0B 4A1YA 5K68A 3VHIA 4JNJA 1OBQA 1G74A 4YFPA 4U8UO 5EPQA 1SWGA 2QO6A 1SWOA 2FKGA 2FR2A 4HWMA 4IB7A 2RTDB 5B2AO 3PP6A 4Z28A 5BVSA 4EFGA 3P6CA 3MX7A 4YBUA 2GTLO 1SMPI 1U17A 2QOMA 1RBPA 2KW1A 2OL8O 4WFVA 1IJ8A 1KL3A 1ML7A 2X8TA 4IABA 4ZFXA 2RTFB 3WVMA 3CMPA 3WYQA 1W4TA 4D6BA 1JYJA 2IZJA 4OMWA 4ZCBA 1SY3A 2RTHB 5AJBA 3TGBA 3PH6A 4IB9A 1Y9LA 4Y5DA 2DJGA 2IFBA 4ML7B 1CJ5A 5HCCC 4ZHHA 4GJVA 4KT5A 1VYOA 1L6MA 1QQSA 2A5BA 4WBKA 4QYNA 5IRWA 2RTRB 4YBPA 3HTYA 3FA7A 4NYQA 5HTEA 2Q4NA 1NC9A 2WEXA 1SWKA 2NNDA 4ZGUA 4OELA 4O49A 3FR5A 3FW5A 1K24A 4GGRA 1AVDA 2ACPX 3E3CA 5LKEA 1FTPA 1JMXA 4M7MA 5HZQA 1X8QA 4RUNA 1VPRA 4QGVA 4KH8A 1NP4A 4AYHA 2OFRX 1GKAA 1SWEA 2KD2A 2M4LA 2A8GA 4NV8A 4YCEA 3RKGA 2ALLX 4D6AA 5HTDA 2OF9A 4TKBA 5HCDC 2FGSA 4IAWA 1LCVA 2AL0X 5HZ6A 1Y55X 4ORWA 1OSPO 2L67A 5CHKA 1KL5A 1STSB 2LKKA 2WSJA 1I9HA 5D4AA 3CBSA 3JQOA 1B0OA 3PDFA 4XMGA 2MWHA 4GDZA 1FDQA 2Q2MA 2R73A 3QQ2A 3TGAA 4I95A 4ES7A 2N93A 1QG5A 3D96A 2ANSA 3IFBA 1WBIA 1BSOA 1SLFB 1GX8A 3FENA 2VDFA 2LB6A 3ELZA 2RTBB 3B2KA 3Q34A 1I4UA 2X8SA 4AZQA 4CDFA 4FBRA 5C0NA 4BX5A 1QY1A 5HA1A 5B29A 1LFOA 2IZGB 3D4RA 3BX8A 4BX7B 3V8UA 3S5VA 3APXA 3VG6A 3F6ZB 4CPFA 2IZCB 2Q9SA 4I3DA 4IB6A 4Z2OA 1X89A 5LJCA 5K67A 1VWRB 1ZNLA 2RTPB 4GJSA 4YGZA 2I5VO 3STMX 1B4MA 4GE1A 1VWEB 4XMEA 4XMCA 1SRJA 1SWBA 2X46A 1IW2A 2Z4IA 4BX5B 3D97A 3LTWA 1SWSA 2GTFX 1T68X 3HWFA 2L9CA 4ID2A 4Y59A 5F2BA 3S26A 3RDOA 3C77X 2PY1A 2JU8A 4Y0SA 5BYPA 2OFBA 4ZH6A 3RDMA 3VG3A 2AT3X 1JQPA 3VGWA 4TKHA 3ZW1B 4L1NA 1QY2A 1MX8A 1OBPA 3PPTA 5HAEA 2Y32A 3EW1A 3NADA 2IZKA 3ZUIA 5JR8A 3Q6LA 3SLOA 2IZBA 4YDAA 1SWDA 1OEEA 1YWBA 3LHNA 1VWQB 2BS5A 3N91A 4YCHA 1VWKB 2HZQA 4MVKA 3QKGA 4QZUA 1HMRA 1RLBE 3CKGA 3P02A 4GDAA 4QGXA 5K06A 3GE2A 1TOUA 2VFCA 4QRLA 3O22A 2BT9A 4C5PA 4YFRA 1VYGA 2Q2PA 4AZPA 2WQAE 3FA6A 3NBXX 3B2IA 1I04A 4FBOA 1D3SA 4IMNA 1A2DA 5L8IA 3OJYC 1RXHA 3FYFA 4KIIA 3UEXA 1HY2A 3WXQA 3FIQA 4M6SA 3WJBA 2G79A 5D45A 4MISA 1X8UA 4GU8A 4NYRA 4Y0QA 4BGFA 1GT1A 5IXGA 3S5XA 1G7NA 4N7CA 3WBGA 3WZPA 1BRQA 1LCWA 1SLDB 2XKLA 1SWQA 3MM0A 4TQ2A 3BY0A 2MF6A 1ZNEA 2KTSA 3EBWA 3HOEA 3SOTA 1EALA 4TJZA 1GT5A 4ORSA 2CZUA 1SWRA 2POAA 3BS2A 2R74A 2RTIB 5B10O 1AQBA 1KT5A 1SWJA 2DJFA 1E02A 4XMFA 1JZUA 3BRNA 4DQ3A 2WQ9A 3FIDA 1VWLB 3PQSA 1I05A 1JYDA 2JU3A 3TGCA 1PBYA 3T6FA 3RZYA 4O9SA 1BJ7A 1EIIA 4KC7A 5IRAA 1DF8A 1VWOB 2KTDA 2QMIA 1SY2A 2ZAIA 3FR2A 3KFHA 3LV4A 2ACOA 2BHVA 1LKEA 2LA7A 1CBSA 3P6DA 2WUTA 2CAMA 1YWDA 5H9LA 4AZRA 3U03A 1XKIA 3RDUA 3PECA 4AZOA 1LPJA 1MM9A 4MVLA 2FHLA 1HXLA 4IRWA 2OL7A 1ALBA 4FBVA 1AVEA 4NP1A 1NQMA 4LZVA 1EW3A 1VWBB 1YP7A 1YWCA 2DM5A 5BVQA 2FKJA 5EDCA 4GK9A 2XSTA 4Z2VA 1RXKA 2FLJA 4YGGA 5FFHA 4U3QA 1VYFA 1BWYA 3AKMA 5F7GA 5D48A 1W5RA 1LCZA 4A8ZA 2UZ2A 3HWDA 4I9SA 4ON1A 5EEDA 5FQ8E 5F1EA 5AEOA 1MX7A 2MO5A 4OMXA 1SWFA 1CBRA 1KT6A 2AKQA 1VWDB 4LZUA 4BOEA 4QGWA 3P6EA 2RTGB 1SWLA 3SAOA 3PQUA 5F6ZA 4EDEA 1ICNA 4O4XA 3B2HA 3BU1A 1SXWA 5FQ6E 5HA0A 5B5GA 3VG2A 4AZMA 2L68A 3OBLA 5D8JA 1LICA 1O1VA 4Y0PA 2OY8A 2Y3EA 4CDCA 3I17A 2G5LA 1LELA 1IFBA 2OL6O 4CPHA 1I78A 2RTOB 1TW4A 1KZXA 1W6FA 3C78X 2IZLB 1RSUB 2ZAGA 5FENA 3STNA 5KICA 1X8OA 3FR4A 3CBCA 3WJEA 4GETA 1HBPA 1PBOA 2YG2A 3KZAA 5D47A 1IFCA 4MIRA 5HBSA 2OFMX 3NQ3A 2JW1A 3O2YA 1B8EA 1DZKA 4GGZA 3VPJE 3VU1A 4EXZA 1LNMA 1SXUA 3F8AA 4I6SA 4CPEA 4Z2PA 1GKAB 1KOIA 4YKMA 1ACDA 3P6GA 1AELA 3FEPA 2HLVA 2MM3A 3CQRA 4GKCA 4AW8A 3B2LA 1KQWA 1BBPA 2A0AA 3FMZA 2RQ0A 4JHQA 1N7YA 5H9KA 3EW2A 1JBHA 3WJGA 2AT5X 5DPQA 2NNQA 5LJHA 5B5FA 1TVQA 3D9WA 1AVGI 1U18A 4KCAA 4QQ1A 4YKOA 3NR3A 1UREA 2E4JA 2FS6A 3FA8A 5AQ6A 5B27A 2OVSA 3RDQA 3STKA 1GT4A 2FS7A 2RCTA 2A13A 4I60A 2O62A 1SXYA 2OVEA 2WWPA 2RTAA 3AUMO 3EYCA 3NQKA 1CBIA 3VG5A 2OZQA 5BVTA 3NQ9A 3UEUA 4LKTA 2BLGA 3KFGA 5LJGA 3CQNA 3VG4A 4EEJA 1FE3A 2C1SA 4ORUA 4ODDA 1VWJB 1DFVA 4B55A 1BM5A 2A2UA 5LJBA 2IZDB 2LBVA 1DZMA 2NNEA 2X56A 5LJDA 1CBQA 2WPUA 4A60A 1E2TA 1FEMA 1Y53X 4A1HA 1EXSA 3CR6A 1KT7A 3RY1A 4BX6A 4O4SA 3RSWA 3RDSA 3RE6A 5F58A 2GJ5A 2JMBA 3I0AA 1SLGB 4EKVA 4CV7A 4YMYA 1KT4A 1PTSA 2CM4A 2NP1A 1SY1A 4GH7A 1I06A 4ORYA 4GNYA 1SA8A 2X32A 3HWEA 1JJUA 3K3LA 3U9PC 4NNSA 1OPBA 2RTLA 4FQBB 1OPAA 2A3FX 2G78A 2FTBA 3HWGA 4GGTA 5HZ8A 5L8NA 2BSZA 4CDEA 3D95A 2IZHB 4I9RA 3HOLA 3NX2A 4OS0A 4PJ2A 3H3IA 4NV7A 1KFFA 1MDCA 3C76X 1EUOA 3JS1A 4MVEA 1E06A 1WUBA 4DNEA 2RTKA 1QFTA 4DQ4A 3KQ0A 4LQZA 1VWCB 1KZWA 1EQDA 1VWNB 4NW4A 1NDJA 1EIOA 1SWHA 2OY7A 2W2BA 3SZJA 3APUA 1ADLA 1BEBA 2X4MA 1SRGA 1RAVA 2RTJA 3HK1A 4CPIA 5HCEC 1RXJA 1JJJA 1HN2A 4LKPA 4ZJ0A 4O4OA 1IIUA 4CDDA 3RE5A 3EM0A 4IAXA 2X55A 3ZI8A 3JSQA 5KHPA 3PK2A 3KVNA 2ASNX 4AZNA 5HZ9A 1DV9A 1MK5A 4ZHFA 4HFOA 4IBAA 2CM9A 1X71A 4R0BA 5FAZA 1Y0GA 2KT4B 2X45A 4YGHA 3WJCA 2F09A 1EPBA 2OY1O 4UU3A 4YVBA 2EU7X 3FA9A 4BJ8A 1A57A 3RY2A 2WEWA 2C4IA 3BU9A 3ZW0A 3BLGA 2RTMA 1A18A 5HWZA 2CBSA 3NP1A 4YH0A 1QWDA 1GM6A 5H8TA 3NPOA 3OD9A 2HMBA 2JN3A 1OBUA 5IRUA 3TF6A 5HZ5A 3ZZVA 1T8VA 3VE2A 1HBQA 1E5PA 1LUQA 2AT8X 4BVMA 1SWAA 3O19A 2CZTA 2A5CA 4BCSA 1SWTA 1FELA 1ZNHA 3P24A 5CSEA 2JGSA 4O3ZA 5LKFA 1SRFA 3P6HA 2QO5A 2AF5A 1RSTB 4L3RA 4XMDA 1KQXA 3ZQ3A 1TXLA 5B11O 1N43A 3ZWEA 2JU7A 3GAQA 1JIWI 1ZNGA 4IB8A 4TKJA 5EDBA 1MUPA 1ZNDA 2FRSA 4GD9A 4U8UN 1LDQA 2L5PA 2RA6A 2QOSC 3EMMA 4ALOA 2AMMX 4OEMA 5F6BA 2HYSA 2GH7A 2Q39A 2GTLN 2HZRA 3EC5A 4NLJA 4HPDA 4I3CA 1XCAA 4O3WA 3VHMA 4ORXA 4ZHGA 1N0SA 1SY0A 1S7DA 1YWAA 2W2FA 1D2UA 4HPCA 4O3YA 3WOVA 4OS3A 1K3BA 1ZNKA 3BX7A 1X8PA 1SXXA 2HNXA 3RDXA 4CPHB 2JOZA 1KL4A 5CE4A 3RBYA 1GX9A 3NX1A 2A2GA 2G8CO 1YP6A 2AVIA 4ZGFA 1LIFA 2RTNB 5L8OA 1HQPA 3APWA 2YMSA 2BS6A 1PMPA 4QNIA 3RWXA 2RTEB 1JJXA 1NGLA 5LJEA 2X34A 3BDRA 1LDOA 1IKJA 1LIEA 2OVAA 3APVA 3EBKA 3MBTA 2GC9A 4JGLA 1BSQA 4MVIA 4CSBA 3IA8A 2FHNX 3WYPA 1VWAB 4XMHA 5IO5A 5IO6A 4QYPA 4JO6A 4OS8A 3T2WA 2C1QA 1HMTA 5JD2A 4Z6JA 1JV4A 4BBOA 1STRB 3WJFA 5AJCA 4BQUA 2F73A 3X00A 2IZEB 3F9DA 4U8UM 1AB0A 1R0UA 2FR3A 1BRPA 1Z24A 1DF3A 1G5WA 2G7BA 1O8VA 4BX7A 1CRBA 4QAEA 2GTLM 2IZAA 1BSYA 1VWMB 2HKDA 3WZOA 3CWKA 5CYBA 1T0VA 4ARHA 5IO7A 1N9YA 1VWPB 4ZHDA 5FQ7E 1LF7A 3ZUOA 2RN4A 2VFBA 3AEHA 1YIVA 1MEPA 4ORRA 1SWNA 1B56A 3UEVA 2RTCB 4KC8A 1QY0A 1GX3A 1SWUA 4TNNA 3KFFA 4ZH9A 2QCBA 4YFQA 4ALBA 1ERBA 2Y3FA 2ZSCA 4MEEA 1UYOX 1PM1X 4WHIA 3FDCA 4NNTA 1TOWA 1E00A 3AKNA 4ZHCA 3ZW1A 3WZNA 1MVGA 1YUPA 5L3YA 1SWCA 4BX6B 1G85A 1DZPA 1KXOA 1IKEA 1O1UA 3SZHA 3TZSA 2I5ZO 3CKFA 1KGLA 2OYBO 3FELA 4U46A 1NP1A 3DTQA 2RTQB 4UU2A 1DZJA 3WZQA 1U0XA 3SLTA 3UEWA 2MJIA 3L4RA 3DSZA 1ZRYA 2IZIA 1X8NA 3ELXA 3WJDA 1ICMA 2K23A 1STPA 3OE3A 4PSQA 1S2PA 1A3YA 3U0DA 1LIDA 5B3MO 3G7XA 1HQQA 1SRHA 2AT0X 3HPEA 1SWPA 5EEEA 1ERXA 2UYWA 1UZ2X 3SZIA 1QABE 4INNA 5KIDA 1DC9A 4COTA 2Z4HA 1N9MA 4N7DA 2AH7X 4O4UA 3S60A 4K19A 4OKAA 1P6PA 3PEDA 4HPBA 1H91A 3FW4A 3VE1A 2P8GA 2RCQA 1QFVA 4GNWA 2QO4A 1VWIB 3BSZE 2PI3O 1GXAA 2OFAA 4I3BA 1Y9TA 5H9AA 2BC3A 3VHHA 2OY5O 1S44A 4EQAC 1PEEA 4GUZA 2W2AA 4Z27A 2F01A 1KT3A 3KFIA 1N4JA 2LBAA 4RUUA 1SRIA 2FT9A 2X8FA 4GZVA 1VWFB 2OVDA 5LJKA 1BLRA 1VWGB 4FGIB 4CK4A 2K62A 4TLJA 4U9CA 1HXZA 1HMSA 3FEKA 5H9NA 2WR6A 3T6LA 1GGLA 4WFUA 3VG7A 1EI5A 4NLIA 1SLEB 1FENA 1EPAA 2LFOA 3MVFA 3T1DA 2FWVA 1FJ1E 1GT3A 1UYNX 5DG4A 3P6FA 2OF8A 2RD7C 3FLLA 3T2XA 1OEJA 1VWHB 2QM9A 3MG5A 2MHDA 4ZR2A 4QZTA 2R56A 1JMZA 4DCBA 4YDBA 1Y52X 4HPAA 4O3XB 1NBXA 3UAQA 2AT6X 1OEKA 2CBRA 1MOYA 4GRJA 2IZFB 3B2JA 4IMOA 5EZ2A 4Y0RA 3PH5A 3SLJA 3ZW2A 1SREA 1NQNA
chains in the Genus database with same CATH topology
1LIBA 3ZW0B 4A1YA 1OBQA 1G74A 4YFPA 4U8UO 5EPQA 2QO6A 2FR2A 4HWMA 4IB7A 5BVSA 4EFGA 5LJEA 3PP6A 3P6CA 3MX7A 4YBUA 2GTLO 1SMPI 1U17A 1RBPA 2KW1A 4WFVA 4ZFXA 1ML7A 2X8TA 4IABA 3WVMA 3CMPA 4D6BA 1JYJA 4OMWA 4ZCBA 1SY3A 5AJBA 3TGBA 3PH6A 4IB9A 1Y9LA 2IFBA 4ML7B 1CJ5A 5HCCC 4ZHHA 4KT5A 1L6MA 1QQSA 4WBKA 4QYNA 4YBPA 3HTYA 3FA7A 4NYQA 5HTEA 2Q4NA 2WEXA 2NNDA 4ZGUA 4O49A 3FR5A 3FW5A 3E3CA 2ACPX 5LKEA 1FTPA 5HZQA 4M7MA 1X8QA 4RUNA 1VPRA 4QGVA 4KH8A 1NP4A 4AYHA 2OFRX 1GKAA 2KD2A 4D6AA 2M4LA 4YCEA 3RKGA 2ALLX 5HTDA 4TKBA 5HCDC 4IAWA 2AL0X 5HZ6A 4ORWA 2L67A 2WSJA 2LKKA 5D4AA 3CBSA 3JQOA 1B0OA 4XMGA 2MWHA 4GDZA 1FDQA 2Q2MA 2R73A 3TGAA 4I95A 4ES7A 2N93A 1QG5A 3D96A 2ANSA 3IFBA 1BSOA 1GX8A 3FENA 2LB6A 3ELZA 3B2KA 1I4UA 2X8SA 4AZQA 5C0NA 4FBRA 1QY1A 5HA1A 5B29A 1LFOA 3D4RA 3BX8A 3V8UA 3S5VA 3APXA 3VG6A 3F6ZB 2Q9SA 4I3DA 4IB6A 1X89A 5LJCA 1ZNLA 4YGZA 3STMX 1B4MA 4GE1A 4XMEA 4XMCA 2X46A 1IW2A 2Z4IA 3D97A 2GTFX 1T68X 3HWFA 2L9CA 4ID2A 3S26A 3C77X 2PY1A 2JU8A 4Y0SA 5BYPA 4ZH6A 3VG3A 2AT3X 4TKHA 3ZW1B 4L1NA 1QY2A 1MX8A 1OBPA 3PPTA 5HAEA 3NADA 5JR8A 3ZUIA 3Q6LA 4YDAA 1OEEA 1YWBA 3LHNA 2BS5A 3N91A 4YCHA 2HZQA 4MVKA 3QKGA 4QZUA 1HMRA 1RLBE 3P02A 5K06A 4QGXA 3GE2A 1TOUA 4QRLA 3O22A 2BT9A 4YFRA 1VYGA 2Q2PA 4AZPA 2WQAE 3FA6A 3NBXX 3B2IA 1I04A 4FBOA 1D3SA 4IMNA 1A2DA 5L8IA 3OJYC 3FYFA 4KIIA 3UEXA 3WXQA 3FIQA 4M6SA 3WJBA 2G79A 5D45A 4MISA 1X8UA 4GU8A 4NYRA 4Y0QA 1GT1A 3S5XA 1G7NA 4N7CA 3WBGA 1BRQA 2XKLA 4TQ2A 3BY0A 3EBWA 1ZNEA 2KTSA 3HOEA 3SOTA 1EALA 4TJZA 1GT5A 4ORSA 2CZUA 2POAA 3BS2A 1A57A 2R74A 1AQBA 1KT5A 4XMFA 1JZUA 1E02A 3BRNA 4DQ3A 2WQ9A 3PQSA 1I05A 1JYDA 2JU3A 3TGCA 3RZYA 4O9SA 1BJ7A 1EIIA 4KC7A 4EXZA 2QMIA 2KTDA 3FR2A 1SY2A 2ZAIA 3KFHA 3LV4A 3P6DA 2ACOA 2BHVA 1LKEA 2LA7A 1CBSA 4AW8A 2WUTA 4AZRA 1YWDA 5H9LA 3U03A 1XKIA 3PECA 4AZOA 1LPJA 4MVLA 4O4UA 4NP1A 1ALBA 4FBVA 4LZVA 1EW3A 1YP7A 1YWCA 2DM5A 5BVQA 5EDCA 4GK9A 2XSTA 2FLJA 4YGGA 5FFHA 4U3QA 1VYFA 1BWYA 3AKMA 5F7GA 5D48A 4A8ZA 3HWDA 4I9SA 5EEDA 4ON1A 5FQ8E 5F1EA 5AEOA 1MX7A 2MO5A 4OMXA 1CBRA 1KT6A 2AKQA 4LZUA 4BOEA 4EDEA 4QGWA 3P6EA 3SAOA 3PQUA 5F6ZA 1ICNA 4O4XA 3B2HA 3BU1A 1SXWA 5FQ6E 5HA0A 3VG2A 4AZMA 2L68A 3OBLA 5D8JA 1LICA 1O1VA 4Y0PA 3I17A 1IFBA 1KZXA 1TW4A 3C78X 2ZAGA 5KICA 5FENA 3STNA 1X8OA 3FR4A 3CBCA 3WJEA 4GETA 1HBPA 1PBOA 2YG2A 3KZAA 5D47A 1IFCA 4MIRA 5HBSA 2OFMX 3NQ3A 2JW1A 3O2YA 1B8EA 1DZKA 3VPJE 3VU1A 1LNMA 1SXUA 3F8AA 4I6SA 1GKAB 1KOIA 4YKMA 1ACDA 3P6GA 1AELA 3FEPA 2HLVA 2MM3A 3CQRA 4GKCA 3B2LA 1KQWA 1BBPA 2A0AA 3FMZA 2RQ0A 5H9KA 1JBHA 3WJGA 2AT5X 5DPQA 2NNQA 1TVQA 1AVGI 1U18A 4KCAA 4QQ1A 4YKOA 3NR3A 1UREA 2E4JA 2FS6A 3FA8A 5AQ6A 5B27A 2OVSA 3STKA 1GT4A 2FS7A 2RCTA 2A13A 2O62A 1SXYA 2OVEA 2WWPA 3EYCA 3VG5A 3NQKA 1CBIA 5BVTA 2OZQA 3NQ9A 3UEUA 4LKTA 2BLGA 3KFGA 5LJGA 3CQNA 3VG4A 4EEJA 1FE3A 4ORUA 4ODDA 1DFVA 1BM5A 2A2UA 5LJBA 2LBVA 1DZMA 2NNEA 5LJDA 1CBQA 4A60A 1FEMA 4A1HA 1EXSA 3CR6A 1KT7A 4O4SA 3RSWA 5F58A 2GJ5A 2JMBA 3I0AA 4YMYA 4CV7A 1KT4A 2CM4A 2NP1A 1SY1A 4GH7A 1I06A 4ORYA 4GNYA 1SA8A 3HWEA 3U9PC 3K3LA 4NNSA 1OPBA 4FQBB 5L8NA 1OPAA 2A3FX 2G78A 2FTBA 3HWGA 5HZ8A 3D95A 4I9RA 3HOLA 3NX2A 4OS0A 4PJ2A 3H3IA 1MDCA 3C76X 1EUOA 3JS1A 4MVEA 1E06A 1QFTA 4DQ4A 3KQ0A 4LQZA 1KZWA 1EQDA 4NW4A 1EIOA 2W2BA 3APUA 1ADLA 1BEBA 3HK1A 5HCEC 1JJJA 1HN2A 4LKPA 4ZJ0A 4O4OA 1IIUA 3EM0A 4IAXA 3ZI8A 3JSQA 5KHPA 2ASNX 4AZNA 5HZ9A 1DV9A 4ZHFA 4HFOA 4IBAA 2CM9A 1X71A 4R0BA 5FAZA 2KT4B 2X45A 4YGHA 3WJCA 2F09A 1EPBA 4UU3A 2EU7X 3FA9A 2WEWA 3BU9A 3ZW0A 3BLGA 1A18A 5HWZA 2CBSA 3NP1A 4YH0A 1QWDA 1GM6A 5H8TA 3NPOA 3OD9A 2HMBA 2JN3A 1OBUA 3TF6A 5HZ5A 3ZZVA 1T8VA 3VE2A 1HBQA 1E5PA 2AT8X 4BVMA 3O19A 2CZTA 1ZNHA 3P24A 4O3ZA 5LKFA 3P6HA 2QO5A 4L3RA 4XMDA 1KQXA 3ZQ3A 1TXLA 3ZWEA 2JU7A 3GAQA 1JIWI 1ZNGA 4IB8A 4TKJA 5EDBA 1MUPA 1ZNDA 2FRSA 4U8UN 3EMMA 2L5PA 2RA6A 2QOSC 4ALOA 2AMMX 5F6BA 2HYSA 2Q39A 2GTLN 2HZRA 4NLJA 4HPDA 4I3CA 1XCAA 4O3WA 4ORXA 4ZHGA 1N0SA 1SY0A 1S7DA 1YWAA 2W2FA 1D2UA 4HPCA 4O3YA 4OS3A 1ZNKA 3BX7A 1X8PA 1SXXA 2HNXA 2JOZA 5CE4A 3RBYA 1GX9A 3NX1A 2A2GA 1YP6A 4ZGFA 1LIFA 5L8OA 1HQPA 3APWA 2YMSA 2BS6A 1PMPA 4QNIA 3RWXA 1JJXA 1NGLA 3BDRA 1IKJA 3MBTA 1LIEA 2OVAA 3APVA 3EBKA 4JGLA 2GC9A 4CSBA 1BSQA 4MVIA 3IA8A 4XMHA 5IO5A 5IO6A 4QYPA 4OS8A 1HMTA 1JV4A 3WJFA 5AJCA 4BQUA 2F73A 3F9DA 4U8UM 1AB0A 1R0UA 2FR3A 1BRPA 1Z24A 1DF3A 1G5WA 2G7BA 1O8VA 1CRBA 4QAEA 2GTLM 1BSYA 3CWKA 5CYBA 1T0VA 4ARHA 5IO7A 4ZHDA 5FQ7E 1LF7A 3ZUOA 2RN4A 1YIVA 4ORRA 1B56A 3UEVA 4KC8A 1QY0A 4TNNA 4ZH9A 3KFFA 4ALBA 4YFQA 1ERBA 1PM1X 4WHIA 4NNTA 1TOWA 1E00A 3AKNA 4ZHCA 3ZW1A 1MVGA 1YUPA 1G85A 1DZPA 1KXOA 1IKEA 1O1UA 3TZSA 1KGLA 3FELA 1NP1A 3DTQA 4UU2A 1DZJA 1U0XA 3UEWA 2MJIA 3L4RA 3DSZA 1ZRYA 3ELXA 1X8NA 3WJDA 3WOVA 1ICMA 2K23A 5LJHA 3OE3A 4PSQA 1S2PA 1A3YA 3U0DA 1LIDA 3G7XA 2AT0X 5EEEA 1ERXA 1UZ2X 1QABE 4INNA 5KIDA 1DC9A 4COTA 2Z4HA 4N7DA 3S60A 2AH7X 4K19A 1P6PA 3PEDA 4HPBA 1H91A 3FW4A 3VE1A 2P8GA 2RCQA 1QFVA 4GNWA 2QO4A 3BSZE 1GXAA 4I3BA 4EQAC 1Y9TA 5H9AA 1S44A 1PEEA 2W2AA 1KT3A 3KFIA 4RUUA 2LBAA 2FT9A 2X8FA 4GZVA 2OVDA 5LJKA 1BLRA 4CK4A 4FGIB 2K62A 4TLJA 4U9CA 5H9NA 1HMSA 3FEKA 2WR6A 1GGLA 4WFUA 3VG7A 1EI5A 4NLIA 1FENA 1EPAA 2LFOA 3MVFA 3T1DA 2FWVA 1GT3A 5DG4A 3P6FA 2RD7C 3FLLA 1OEJA 2QM9A 2MHDA 4ZR2A 4QZTA 2R56A 4YDBA 4HPAA 4O3XB 3UAQA 2AT6X 1OEKA 2CBRA 4GRJA 4IMOA 3B2JA 5EZ2A 4Y0RA 3PH5A 3ZW2A 1FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LIB A;  4A1Y A;  1OBQ A;  1G74 A;  4YFP A;  5EPQ A;  2QO6 A;  2FR2 A;  4EFG A;  4IB7 A;  5BVS A;  5LJE A;  3PP6 A;  3P6C A;  4YBU A;  1U17 A;  1RBP A;  4WFV A;  4ZFX A;  1ML7 A;  3WVM A;  3CMP A;  4D6B A;  1JYJ A;  4OMW A;  4ZCB A;  1SY3 A;  3TGB A;  3PH6 A;  4IB9 A;  2IFB A;  1CJ5 A;  5HCC C;  4ZHH A;  1L6M A;  1QQS A;  4WBK A;  4QYN A;  4YBP A;  3FA7 A;  4NYQ A;  5HTE A;  2Q4N A;  2WEX A;  2NND A;  4ZGU A;  3FR5 A;  3FW5 A;  2ACP X;  5LKE A;  1FTP A;  5HZQ A;  4M7M A;  1X8Q A;  4RUN A;  1VPR A;  4QGV A;  1NP4 A;  4AYH A;  2OFR X;  1GKA A;  4D6A A;  4YCE A;  2ALL X;  5HTD A;  4TKB A;  5HCD C;  4IAW A;  2AL0 X;  5HZ6 A;  4ORW A;  2L67 A;  2WSJ A;  2LKK A;  5D4A A;  3CBS A;  1B0O A;  4XMG A;  1FDQ A;  2Q2M A;  2R73 A;  3TGA A;  4ES7 A;  2N93 A;  1QG5 A;  3D96 A;  2ANS A;  3IFB A;  1BSO A;  1GX8 A;  3FEN A;  2LB6 A;  3ELZ A;  3B2K A;  1I4U A;  4AZQ A;  5C0N A;  1QY1 A;  5HA1 A;  5B29 A;  1LFO A;  3BX8 A;  3APX A;  3VG6 A;  2Q9S A;  4I3D A;  4IB6 A;  1X89 A;  5LJC A;  1ZNL A;  4YGZ A;  3STM X;  1B4M A;  4GE1 A;  4XME A;  4XMC A;  2X46 A;  1IW2 A;  3D97 A;  2GTF X;  1T68 X;  3HWF A;  2L9C A;  3S26 A;  3C77 X;  2PY1 A;  2JU8 A;  4Y0S A;  4ZH6 A;  3VG3 A;  2AT3 X;  4TKH A;  1QY2 A;  1MX8 A;  1OBP A;  3PPT A;  5HAE A;  3NAD A;  5JR8 A;  3ZUI A;  3Q6L A;  4YDA A;  1OEE A;  1YWB A;  4YCH A;  2HZQ A;  4MVK A;  3QKG A;  4QZU A;  1HMR A;  1RLB E;  5K06 A;  4QGX A;  1TOU A;  3O22 A;  4YFR A;  1VYG A;  2Q2P A;  4AZP A;  2WQA E;  3FA6 A;  3B2I A;  1I04 A;  4IMN A;  1D3S A;  1A2D A;  5L8I A;  3OJY C;  4KII A;  3UEX A;  3WXQ A;  3FIQ A;  4M6S A;  3WJB A;  2G79 A;  5D45 A;  4Y0Q A;  1X8U A;  4NYR A;  1GT1 A;  1G7N A;  4N7C A;  3WBG A;  1BRQ A;  2XKL A;  4TQ2 A;  3BY0 A;  3EBW A;  1ZNE A;  1EAL A;  4TJZ A;  1GT5 A;  4ORS A;  2CZU A;  2POA A;  3BS2 A;  1A57 A;  2R74 A;  1AQB A;  1KT5 A;  1JZU A;  1E02 A;  3BRN A;  4DQ3 A;  2WQ9 A;  1I05 A;  1JYD A;  2JU3 A;  3TGC A;  3RZY A;  4O9S A;  1BJ7 A;  1EII A;  4EXZ A;  2KTD A;  3FR2 A;  1SY2 A;  3KFH A;  4XMF A;  4AW8 A;  3P6D A;  2ACO A;  1LKE A;  1CBS A;  3U03 A;  2WUT A;  4AZR A;  1YWD A;  5H9L A;  1XKI A;  3PEC A;  4AZO A;  1LPJ A;  4MVL A;  4NP1 A;  1ALB A;  4LZV A;  1EW3 A;  1YP7 A;  1YWC A;  2DM5 A;  5BVQ A;  5EDC A;  2XST A;  2FLJ A;  4YGG A;  5FFH A;  1VYF A;  1BWY A;  3AKM A;  5F7G A;  5D48 A;  4A8Z A;  3HWD A;  4I9S A;  5EED A;  5F1E A;  1MX7 A;  2MO5 A;  4OMX A;  1CBR A;  1KT6 A;  2AKQ A;  4LZU A;  4BOE A;  4EDE A;  4QGW A;  3P6E A;  3SAO A;  5F6Z A;  1ICN A;  3B2H A;  3BU1 A;  1SXW A;  5HA0 A;  3VG2 A;  4AZM A;  2L68 A;  5D8J A;  1LIC A;  1O1V A;  4Y0P A;  3I17 A;  1IFB A;  1KZX A;  1TW4 A;  3C78 X;  5KIC A;  5FEN A;  3STN A;  1X8O A;  3FR4 A;  3CBC A;  3WJE A;  4GET A;  1HBP A;  1PBO A;  2YG2 A;  3KZA A;  5D47 A;  1IFC A;  5HBS A;  2OFM X;  3NQ3 A;  3O2Y A;  1B8E A;  1DZK A;  1LNM A;  1SXU A;  3F8A A;  1GKA B;  1KOI A;  4YKM A;  1ACD A;  3P6G A;  1AEL A;  3FEP A;  2HLV A;  2MM3 A;  3CQR A;  4GKC A;  3B2L A;  1KQW A;  1BBP A;  2A0A A;  3FMZ A;  2RQ0 A;  5H9K A;  1JBH A;  3WJG A;  2AT5 X;  5DPQ A;  2NNQ A;  1TVQ A;  1AVG I;  1U18 A;  4YKO A;  3NR3 A;  1URE A;  2E4J A;  2FS6 A;  3FA8 A;  5AQ6 A;  5B27 A;  3STK A;  1GT4 A;  2FS7 A;  2RCT A;  2A13 A;  2O62 A;  1SXY A;  2OVE A;  2WWP A;  3EYC A;  3VG5 A;  1CBI A;  5BVT A;  2OZQ A;  3NQ9 A;  3UEU A;  4LKT A;  2BLG A;  3KFG A;  5LJG A;  3CQN A;  3VG4 A;  4EEJ A;  1FE3 A;  4ORU A;  4ODD A;  1DFV A;  1BM5 A;  2A2U A;  5LJB A;  2LBV A;  1DZM A;  2NNE A;  5LJD A;  1CBQ A;  4A60 A;  1FEM A;  4A1H A;  1EXS A;  3CR6 A;  1KT7 A;  3RSW A;  5F58 A;  2GJ5 A;  3I0A A;  4YMY A;  1KT4 A;  2CM4 A;  2NP1 A;  1SY1 A;  4GH7 A;  1I06 A;  4ORY A;  4GNY A;  1SA8 A;  3HWE A;  3U9P C;  3K3L A;  4NNS A;  1OPB A;  1OPA A;  2A3F X;  2G78 A;  2FTB A;  3HWG A;  5HZ8 A;  3D95 A;  4I9R A;  3NX2 A;  4OS0 A;  1MDC A;  3C76 X;  1EUO A;  3JS1 A;  1E06 A;  1QFT A;  4DQ4 A;  3KQ0 A;  1KZW A;  1EQD A;  1EIO A;  2W2B A;  3APU A;  1ADL A;  1BEB A;  3HK1 A;  5HCE C;  1JJJ A;  1HN2 A;  4LKP A;  4ZJ0 A;  1IIU A;  3EM0 A;  4IAX A;  3JSQ A;  5KHP A;  2ASN X;  4AZN A;  5HZ9 A;  1DV9 A;  4ZHF A;  4HFO A;  4IBA A;  2CM9 A;  1X71 A;  4R0B A;  5FAZ A;  2KT4 B;  2X45 A;  4YGH A;  3WJC A;  1EPB A;  4UU3 A;  2EU7 X;  3FA9 A;  2WEW A;  3BU9 A;  3BLG A;  1A18 A;  5HWZ A;  2CBS A;  3NP1 A;  4YH0 A;  1QWD A;  1GM6 A;  5H8T A;  3NPO A;  2HMB A;  2JN3 A;  1OBU A;  3TF6 A;  5HZ5 A;  1T8V A;  1HBQ A;  1E5P A;  2AT8 X;  4BVM A;  3O19 A;  2CZT A;  1ZNH A;  5LKF A;  3P6H A;  2QO5 A;  4XMD A;  1KQX A;  3ZQ3 A;  1TXL A;  2JU7 A;  3GAQ A;  1ZNG A;  4IB8 A;  4TKJ A;  5EDB A;  1MUP A;  1ZND A;  2FRS A;  3EMM A;  2L5P A;  2RA6 A;  2QOS C;  4ALO A;  2AMM X;  5F6B A;  2HYS A;  2Q39 A;  2HZR A;  4NLJ A;  4HPD A;  4I3C A;  1XCA A;  4ORX A;  4ZHG A;  1N0S A;  1SY0 A;  1S7D A;  1YWA A;  2W2F A;  1D2U A;  4HPC A;  4OS3 A;  1ZNK A;  3BX7 A;  1X8P A;  1SXX A;  2HNX A;  2JOZ A;  5CE4 A;  1GX9 A;  3NX1 A;  2A2G A;  1YP6 A;  1LIF A;  5L8O A;  1HQP A;  3APW A;  1PMP A;  1JJX A;  1NGL A;  3BDR A;  1IKJ A;  3MBT A;  1LIE A;  2OVA A;  3APV A;  3EBK A;  5L8N A;  2GC9 A;  1BSQ A;  4MVI A;  3IA8 A;  4XMH A;  5IO5 A;  5IO6 A;  4QYP A;  4OS8 A;  1HMT A;  1JV4 A;  3WJF A;  4BQU A;  2F73 A;  3F9D A;  1AB0 A;  1R0U A;  2FR3 A;  1BRP A;  1Z24 A;  1DF3 A;  1G5W A;  2G7B A;  1O8V A;  1CRB A;  4QAE A;  1BSY A;  3CWK A;  1T0V A;  4ARH A;  5IO7 A;  4ZHD A;  1LF7 A;  3ZUO A;  1YIV A;  4ORR A;  1B56 A;  3UEV A;  4TNN A;  1QY0 A;  4ZH9 A;  3KFF A;  4ALB A;  4YFQ A;  1ERB A;  1PM1 X;  4NNT A;  1TOW A;  1E00 A;  3AKN A;  4ZHC A;  1MVG A;  1YUP A;  1G85 A;  1DZP A;  1KXO A;  1IKE A;  1O1U A;  3TZS A;  1KGL A;  3FEL A;  1NP1 A;  3DTQ A;  4UU2 A;  1DZJ A;  1U0X A;  3UEW A;  2MJI A;  3L4R A;  3DSZ A;  1ZRY A;  3ELX A;  1X8N A;  3WJD A;  5LJH A;  1ICM A;  2K23 A;  4PSQ A;  3U0D A;  1S2P A;  1A3Y A;  1LID A;  3G7X A;  2AT0 X;  5EEE A;  1ERX A;  1UZ2 X;  1QAB E;  5KID A;  1DC9 A;  4N7D A;  2AH7 X;  4K19 A;  1P6P A;  3PED A;  4HPB A;  1H91 A;  3FW4 A;  2P8G A;  2RCQ A;  1QFV A;  4GNW A;  2QO4 A;  3BSZ E;  1GXA A;  4I3B A;  5H9A A;  1S44 A;  1PEE A;  2W2A A;  1KT3 A;  3KFI A;  4RUU A;  2LBA A;  2FT9 A;  2OVD A;  5LJK A;  1BLR A;  4CK4 A;  2K62 A;  4TLJ A;  5H9N A;  1HMS A;  3FEK A;  2WR6 A;  1GGL A;  4WFU A;  3VG7 A;  4NLI A;  1FEN A;  1EPA A;  2LFO A;  3MVF A;  3T1D A;  2FWV A;  1GT3 A;  5DG4 A;  3P6F A;  2RD7 C;  3FLL A;  1OEJ A;  2QM9 A;  4ZR2 A;  4QZT A;  2R56 A;  4YDB A;  4HPA A;  2AT6 X;  1OEK A;  2CBR A;  4GRJ A;  4IMO A;  3B2J A;  5EZ2 A;  4Y0R A;  3PH5 A;  1FEL A; 
#chains in the Genus database with same CATH topology
 1LIB A;  3ZW0 B;  4A1Y A;  5K68 A;  3VHI A;  4JNJ A;  1OBQ A;  1G74 A;  4YFP A;  4U8U O;  5EPQ A;  1SWG A;  2QO6 A;  1SWO A;  2FKG A;  2FR2 A;  4HWM A;  4IB7 A;  2RTD B;  5B2A O;  3PP6 A;  4Z28 A;  5BVS A;  4EFG A;  3P6C A;  3MX7 A;  4YBU A;  2GTL O;  1SMP I;  1U17 A;  2QOM A;  1RBP A;  2KW1 A;  2OL8 O;  4WFV A;  1IJ8 A;  1KL3 A;  1ML7 A;  2X8T A;  4IAB A;  4ZFX A;  2RTF B;  3WVM A;  3CMP A;  3WYQ A;  1W4T A;  4D6B A;  1JYJ A;  2IZJ A;  4OMW A;  4ZCB A;  1SY3 A;  2RTH B;  5AJB A;  3TGB A;  3PH6 A;  4IB9 A;  1Y9L A;  4Y5D A;  2DJG A;  2IFB A;  4ML7 B;  1CJ5 A;  5HCC C;  4ZHH A;  4GJV A;  4KT5 A;  1VYO A;  1L6M A;  1QQS A;  2A5B A;  4WBK A;  4QYN A;  5IRW A;  2RTR B;  4YBP A;  3HTY A;  3FA7 A;  4NYQ A;  5HTE A;  2Q4N A;  1NC9 A;  2WEX A;  1SWK A;  2NND A;  4ZGU A;  4OEL A;  4O49 A;  3FR5 A;  3FW5 A;  1K24 A;  4GGR A;  1AVD A;  2ACP X;  3E3C A;  5LKE A;  1FTP A;  1JMX A;  4M7M A;  5HZQ A;  1X8Q A;  4RUN A;  1VPR A;  4QGV A;  4KH8 A;  1NP4 A;  4AYH A;  2OFR X;  1GKA A;  1SWE A;  2KD2 A;  2M4L A;  2A8G A;  4NV8 A;  4YCE A;  3RKG A;  2ALL X;  4D6A A;  5HTD A;  2OF9 A;  4TKB A;  5HCD C;  2FGS A;  4IAW A;  1LCV A;  2AL0 X;  5HZ6 A;  1Y55 X;  4ORW A;  1OSP O;  2L67 A;  5CHK A;  1KL5 A;  1STS B;  2LKK A;  2WSJ A;  1I9H A;  5D4A A;  3CBS A;  3JQO A;  1B0O A;  3PDF A;  4XMG A;  2MWH A;  4GDZ A;  1FDQ A;  2Q2M A;  2R73 A;  3QQ2 A;  3TGA A;  4I95 A;  4ES7 A;  2N93 A;  1QG5 A;  3D96 A;  2ANS A;  3IFB A;  1WBI A;  1BSO A;  1SLF B;  1GX8 A;  3FEN A;  2VDF A;  2LB6 A;  3ELZ A;  2RTB B;  3B2K A;  3Q34 A;  1I4U A;  2X8S A;  4AZQ A;  4CDF A;  4FBR A;  5C0N A;  4BX5 A;  1QY1 A;  5HA1 A;  5B29 A;  1LFO A;  2IZG B;  3D4R A;  3BX8 A;  4BX7 B;  3V8U A;  3S5V A;  3APX A;  3VG6 A;  3F6Z B;  4CPF A;  2IZC B;  2Q9S A;  4I3D A;  4IB6 A;  4Z2O A;  1X89 A;  5LJC A;  5K67 A;  1VWR B;  1ZNL A;  2RTP B;  4GJS A;  4YGZ A;  2I5V O;  3STM X;  1B4M A;  4GE1 A;  1VWE B;  4XME A;  4XMC A;  1SRJ A;  1SWB A;  2X46 A;  1IW2 A;  2Z4I A;  4BX5 B;  3D97 A;  3LTW A;  1SWS A;  2GTF X;  1T68 X;  3HWF A;  2L9C A;  4ID2 A;  4Y59 A;  5F2B A;  3S26 A;  3RDO A;  3C77 X;  2PY1 A;  2JU8 A;  4Y0S A;  5BYP A;  2OFB A;  4ZH6 A;  3RDM A;  3VG3 A;  2AT3 X;  1JQP A;  3VGW A;  4TKH A;  3ZW1 B;  4L1N A;  1QY2 A;  1MX8 A;  1OBP A;  3PPT A;  5HAE A;  2Y32 A;  3EW1 A;  3NAD A;  2IZK A;  3ZUI A;  5JR8 A;  3Q6L A;  3SLO A;  2IZB A;  4YDA A;  1SWD A;  1OEE A;  1YWB A;  3LHN A;  1VWQ B;  2BS5 A;  3N91 A;  4YCH A;  1VWK B;  2HZQ A;  4MVK A;  3QKG A;  4QZU A;  1HMR A;  1RLB E;  3CKG A;  3P02 A;  4GDA A;  4QGX A;  5K06 A;  3GE2 A;  1TOU A;  2VFC A;  4QRL A;  3O22 A;  2BT9 A;  4C5P A;  4YFR A;  1VYG A;  2Q2P A;  4AZP A;  2WQA E;  3FA6 A;  3NBX X;  3B2I A;  1I04 A;  4FBO A;  1D3S A;  4IMN A;  1A2D A;  5L8I A;  3OJY C;  1RXH A;  3FYF A;  4KII A;  3UEX A;  1HY2 A;  3WXQ A;  3FIQ A;  4M6S A;  3WJB A;  2G79 A;  5D45 A;  4MIS A;  1X8U A;  4GU8 A;  4NYR A;  4Y0Q A;  4BGF A;  1GT1 A;  5IXG A;  3S5X A;  1G7N A;  4N7C A;  3WBG A;  3WZP A;  1BRQ A;  1LCW A;  1SLD B;  2XKL A;  1SWQ A;  3MM0 A;  4TQ2 A;  3BY0 A;  2MF6 A;  1ZNE A;  2KTS A;  3EBW A;  3HOE A;  3SOT A;  1EAL A;  4TJZ A;  1GT5 A;  4ORS A;  2CZU A;  1SWR A;  2POA A;  3BS2 A;  2R74 A;  2RTI B;  5B10 O;  1AQB A;  1KT5 A;  1SWJ A;  2DJF A;  1E02 A;  4XMF A;  1JZU A;  3BRN A;  4DQ3 A;  2WQ9 A;  3FID A;  1VWL B;  3PQS A;  1I05 A;  1JYD A;  2JU3 A;  3TGC A;  1PBY A;  3T6F A;  3RZY A;  4O9S A;  1BJ7 A;  1EII A;  4KC7 A;  5IRA A;  1DF8 A;  1VWO B;  2KTD A;  2QMI A;  1SY2 A;  2ZAI A;  3FR2 A;  3KFH A;  3LV4 A;  2ACO A;  2BHV A;  1LKE A;  2LA7 A;  1CBS A;  3P6D A;  2WUT A;  2CAM A;  1YWD A;  5H9L A;  4AZR A;  3U03 A;  1XKI A;  3RDU A;  3PEC A;  4AZO A;  1LPJ A;  1MM9 A;  4MVL A;  2FHL A;  1HXL A;  4IRW A;  2OL7 A;  1ALB A;  4FBV A;  1AVE A;  4NP1 A;  1NQM A;  4LZV A;  1EW3 A;  1VWB B;  1YP7 A;  1YWC A;  2DM5 A;  5BVQ A;  2FKJ A;  5EDC A;  4GK9 A;  2XST A;  4Z2V A;  1RXK A;  2FLJ A;  4YGG A;  5FFH A;  4U3Q A;  1VYF A;  1BWY A;  3AKM A;  5F7G A;  5D48 A;  1W5R A;  1LCZ A;  4A8Z A;  2UZ2 A;  3HWD A;  4I9S A;  4ON1 A;  5EED A;  5FQ8 E;  5F1E A;  5AEO A;  1MX7 A;  2MO5 A;  4OMX A;  1SWF A;  1CBR A;  1KT6 A;  2AKQ A;  1VWD B;  4LZU A;  4BOE A;  4QGW A;  3P6E A;  2RTG B;  1SWL A;  3SAO A;  3PQU A;  5F6Z A;  4EDE A;  1ICN A;  4O4X A;  3B2H A;  3BU1 A;  1SXW A;  5FQ6 E;  5HA0 A;  5B5G A;  3VG2 A;  4AZM A;  2L68 A;  3OBL A;  5D8J A;  1LIC A;  1O1V A;  4Y0P A;  2OY8 A;  2Y3E A;  4CDC A;  3I17 A;  2G5L A;  1LEL A;  1IFB A;  2OL6 O;  4CPH A;  1I78 A;  2RTO B;  1TW4 A;  1KZX A;  1W6F A;  3C78 X;  2IZL B;  1RSU B;  2ZAG A;  5FEN A;  3STN A;  5KIC A;  1X8O A;  3FR4 A;  3CBC A;  3WJE A;  4GET A;  1HBP A;  1PBO A;  2YG2 A;  3KZA A;  5D47 A;  1IFC A;  4MIR A;  5HBS A;  2OFM X;  3NQ3 A;  2JW1 A;  3O2Y A;  1B8E A;  1DZK A;  4GGZ A;  3VPJ E;  3VU1 A;  4EXZ A;  1LNM A;  1SXU A;  3F8A A;  4I6S A;  4CPE A;  4Z2P A;  1GKA B;  1KOI A;  4YKM A;  1ACD A;  3P6G A;  1AEL A;  3FEP A;  2HLV A;  2MM3 A;  3CQR A;  4GKC A;  4AW8 A;  3B2L A;  1KQW A;  1BBP A;  2A0A A;  3FMZ A;  2RQ0 A;  4JHQ A;  1N7Y A;  5H9K A;  3EW2 A;  1JBH A;  3WJG A;  2AT5 X;  5DPQ A;  2NNQ A;  5LJH A;  5B5F A;  1TVQ A;  3D9W A;  1AVG I;  1U18 A;  4KCA A;  4QQ1 A;  4YKO A;  3NR3 A;  1URE A;  2E4J A;  2FS6 A;  3FA8 A;  5AQ6 A;  5B27 A;  2OVS A;  3RDQ A;  3STK A;  1GT4 A;  2FS7 A;  2RCT A;  2A13 A;  4I60 A;  2O62 A;  1SXY A;  2OVE A;  2WWP A;  2RTA A;  3AUM O;  3EYC A;  3NQK A;  1CBI A;  3VG5 A;  2OZQ A;  5BVT A;  3NQ9 A;  3UEU A;  4LKT A;  2BLG A;  3KFG A;  5LJG A;  3CQN A;  3VG4 A;  4EEJ A;  1FE3 A;  2C1S A;  4ORU A;  4ODD A;  1VWJ B;  1DFV A;  4B55 A;  1BM5 A;  2A2U A;  5LJB A;  2IZD B;  2LBV A;  1DZM A;  2NNE A;  2X56 A;  5LJD A;  1CBQ A;  2WPU A;  4A60 A;  1E2T A;  1FEM A;  1Y53 X;  4A1H A;  1EXS A;  3CR6 A;  1KT7 A;  3RY1 A;  4BX6 A;  4O4S A;  3RSW A;  3RDS A;  3RE6 A;  5F58 A;  2GJ5 A;  2JMB A;  3I0A A;  1SLG B;  4EKV A;  4CV7 A;  4YMY A;  1KT4 A;  1PTS A;  2CM4 A;  2NP1 A;  1SY1 A;  4GH7 A;  1I06 A;  4ORY A;  4GNY A;  1SA8 A;  2X32 A;  3HWE A;  1JJU A;  3K3L A;  3U9P C;  4NNS A;  1OPB A;  2RTL A;  4FQB B;  1OPA A;  2A3F X;  2G78 A;  2FTB A;  3HWG A;  4GGT A;  5HZ8 A;  5L8N A;  2BSZ A;  4CDE A;  3D95 A;  2IZH B;  4I9R A;  3HOL A;  3NX2 A;  4OS0 A;  4PJ2 A;  3H3I A;  4NV7 A;  1KFF A;  1MDC A;  3C76 X;  1EUO A;  3JS1 A;  4MVE A;  1E06 A;  1WUB A;  4DNE A;  2RTK A;  1QFT A;  4DQ4 A;  3KQ0 A;  4LQZ A;  1VWC B;  1KZW A;  1EQD A;  1VWN B;  4NW4 A;  1NDJ A;  1EIO A;  1SWH A;  2OY7 A;  2W2B A;  3SZJ A;  3APU A;  1ADL A;  1BEB A;  2X4M A;  1SRG A;  1RAV A;  2RTJ A;  3HK1 A;  4CPI A;  5HCE C;  1RXJ A;  1JJJ A;  1HN2 A;  4LKP A;  4ZJ0 A;  4O4O A;  1IIU A;  4CDD A;  3RE5 A;  3EM0 A;  4IAX A;  2X55 A;  3ZI8 A;  3JSQ A;  5KHP A;  3PK2 A;  3KVN A;  2ASN X;  4AZN A;  5HZ9 A;  1DV9 A;  1MK5 A;  4ZHF A;  4HFO A;  4IBA A;  2CM9 A;  1X71 A;  4R0B A;  5FAZ A;  1Y0G A;  2KT4 B;  2X45 A;  4YGH A;  3WJC A;  2F09 A;  1EPB A;  2OY1 O;  4UU3 A;  4YVB A;  2EU7 X;  3FA9 A;  4BJ8 A;  1A57 A;  3RY2 A;  2WEW A;  2C4I A;  3BU9 A;  3ZW0 A;  3BLG A;  2RTM A;  1A18 A;  5HWZ A;  2CBS A;  3NP1 A;  4YH0 A;  1QWD A;  1GM6 A;  5H8T A;  3NPO A;  3OD9 A;  2HMB A;  2JN3 A;  1OBU A;  5IRU A;  3TF6 A;  5HZ5 A;  3ZZV A;  1T8V A;  3VE2 A;  1HBQ A;  1E5P A;  1LUQ A;  2AT8 X;  4BVM A;  1SWA A;  3O19 A;  2CZT A;  2A5C A;  4BCS A;  1SWT A;  1FEL A;  1ZNH A;  3P24 A;  5CSE A;  2JGS A;  4O3Z A;  5LKF A;  1SRF A;  3P6H A;  2QO5 A;  2AF5 A;  1RST B;  4L3R A;  4XMD A;  1KQX A;  3ZQ3 A;  1TXL A;  5B11 O;  1N43 A;  3ZWE A;  2JU7 A;  3GAQ A;  1JIW I;  1ZNG A;  4IB8 A;  4TKJ A;  5EDB A;  1MUP A;  1ZND A;  2FRS A;  4GD9 A;  4U8U N;  1LDQ A;  2L5P A;  2RA6 A;  2QOS C;  3EMM A;  4ALO A;  2AMM X;  4OEM A;  5F6B A;  2HYS A;  2GH7 A;  2Q39 A;  2GTL N;  2HZR A;  3EC5 A;  4NLJ A;  4HPD A;  4I3C A;  1XCA A;  4O3W A;  3VHM A;  4ORX A;  4ZHG A;  1N0S A;  1SY0 A;  1S7D A;  1YWA A;  2W2F A;  1D2U A;  4HPC A;  4O3Y A;  3WOV A;  4OS3 A;  1K3B A;  1ZNK A;  3BX7 A;  1X8P A;  1SXX A;  2HNX A;  3RDX A;  4CPH B;  2JOZ A;  1KL4 A;  5CE4 A;  3RBY A;  1GX9 A;  3NX1 A;  2A2G A;  2G8C O;  1YP6 A;  2AVI A;  4ZGF A;  1LIF A;  2RTN B;  5L8O A;  1HQP A;  3APW A;  2YMS A;  2BS6 A;  1PMP A;  4QNI A;  3RWX A;  2RTE B;  1JJX A;  1NGL A;  5LJE A;  2X34 A;  3BDR A;  1LDO A;  1IKJ A;  1LIE A;  2OVA A;  3APV A;  3EBK A;  3MBT A;  2GC9 A;  4JGL A;  1BSQ A;  4MVI A;  4CSB A;  3IA8 A;  2FHN X;  3WYP A;  1VWA B;  4XMH A;  5IO5 A;  5IO6 A;  4QYP A;  4JO6 A;  4OS8 A;  3T2W A;  2C1Q A;  1HMT A;  5JD2 A;  4Z6J A;  1JV4 A;  4BBO A;  1STR B;  3WJF A;  5AJC A;  4BQU A;  2F73 A;  3X00 A;  2IZE B;  3F9D A;  4U8U M;  1AB0 A;  1R0U A;  2FR3 A;  1BRP A;  1Z24 A;  1DF3 A;  1G5W A;  2G7B A;  1O8V A;  4BX7 A;  1CRB A;  4QAE A;  2GTL M;  2IZA A;  1BSY A;  1VWM B;  2HKD A;  3WZO A;  3CWK A;  5CYB A;  1T0V A;  4ARH A;  5IO7 A;  1N9Y A;  1VWP B;  4ZHD A;  5FQ7 E;  1LF7 A;  3ZUO A;  2RN4 A;  2VFB A;  3AEH A;  1YIV A;  1MEP A;  4ORR A;  1SWN A;  1B56 A;  3UEV A;  2RTC B;  4KC8 A;  1QY0 A;  1GX3 A;  1SWU A;  4TNN A;  3KFF A;  4ZH9 A;  2QCB A;  4YFQ A;  4ALB A;  1ERB A;  2Y3F A;  2ZSC A;  4MEE A;  1UYO X;  1PM1 X;  4WHI A;  3FDC A;  4NNT A;  1TOW A;  1E00 A;  3AKN A;  4ZHC A;  3ZW1 A;  3WZN A;  1MVG A;  1YUP A;  5L3Y A;  1SWC A;  4BX6 B;  1G85 A;  1DZP A;  1KXO A;  1IKE A;  1O1U A;  3SZH A;  3TZS A;  2I5Z O;  3CKF A;  1KGL A;  2OYB O;  3FEL A;  4U46 A;  1NP1 A;  3DTQ A;  2RTQ B;  4UU2 A;  1DZJ A;  3WZQ A;  1U0X A;  3SLT A;  3UEW A;  2MJI A;  3L4R A;  3DSZ A;  1ZRY A;  2IZI A;  1X8N A;  3ELX A;  3WJD A;  1ICM A;  2K23 A;  1STP A;  3OE3 A;  4PSQ A;  1S2P A;  1A3Y A;  3U0D A;  1LID A;  5B3M O;  3G7X A;  1HQQ A;  1SRH A;  2AT0 X;  3HPE A;  1SWP A;  5EEE A;  1ERX A;  2UYW A;  1UZ2 X;  3SZI A;  1QAB E;  4INN A;  5KID A;  1DC9 A;  4COT A;  2Z4H A;  1N9M A;  4N7D A;  2AH7 X;  4O4U A;  3S60 A;  4K19 A;  4OKA A;  1P6P A;  3PED A;  4HPB A;  1H91 A;  3FW4 A;  3VE1 A;  2P8G A;  2RCQ A;  1QFV A;  4GNW A;  2QO4 A;  1VWI B;  3BSZ E;  2PI3 O;  1GXA A;  2OFA A;  4I3B A;  1Y9T A;  5H9A A;  2BC3 A;  3VHH A;  2OY5 O;  1S44 A;  4EQA C;  1PEE A;  4GUZ A;  2W2A A;  4Z27 A;  2F01 A;  1KT3 A;  3KFI A;  1N4J A;  2LBA A;  4RUU A;  1SRI A;  2FT9 A;  2X8F A;  4GZV A;  1VWF B;  2OVD A;  5LJK A;  1BLR A;  1VWG B;  4FGI B;  4CK4 A;  2K62 A;  4TLJ A;  4U9C A;  1HXZ A;  1HMS A;  3FEK A;  5H9N A;  2WR6 A;  3T6L A;  1GGL A;  4WFU A;  3VG7 A;  1EI5 A;  4NLI A;  1SLE B;  1FEN A;  1EPA A;  2LFO A;  3MVF A;  3T1D A;  2FWV A;  1FJ1 E;  1GT3 A;  1UYN X;  5DG4 A;  3P6F A;  2OF8 A;  2RD7 C;  3FLL A;  3T2X A;  1OEJ A;  1VWH B;  2QM9 A;  3MG5 A;  2MHD A;  4ZR2 A;  4QZT A;  2R56 A;  1JMZ A;  4DCB A;  4YDB A;  1Y52 X;  4HPA A;  4O3X B;  1NBX A;  3UAQ A;  2AT6 X;  1OEK A;  2CBR A;  1MOY A;  4GRJ A;  2IZF B;  3B2J A;  4IMO A;  5EZ2 A;  4Y0R A;  3PH5 A;  3SLJ A;  3ZW2 A;  1SRE A;  1NQN A; 
#chains in the Genus database with same CATH homology
 1LIB A;  3ZW0 B;  4A1Y A;  1OBQ A;  1G74 A;  4YFP A;  4U8U O;  5EPQ A;  2QO6 A;  2FR2 A;  4HWM A;  4IB7 A;  5BVS A;  4EFG A;  5LJE A;  3PP6 A;  3P6C A;  3MX7 A;  4YBU A;  2GTL O;  1SMP I;  1U17 A;  1RBP A;  2KW1 A;  4WFV A;  4ZFX A;  1ML7 A;  2X8T A;  4IAB A;  3WVM A;  3CMP A;  4D6B A;  1JYJ A;  4OMW A;  4ZCB A;  1SY3 A;  5AJB A;  3TGB A;  3PH6 A;  4IB9 A;  1Y9L A;  2IFB A;  4ML7 B;  1CJ5 A;  5HCC C;  4ZHH A;  4KT5 A;  1L6M A;  1QQS A;  4WBK A;  4QYN A;  4YBP A;  3HTY A;  3FA7 A;  4NYQ A;  5HTE A;  2Q4N A;  2WEX A;  2NND A;  4ZGU A;  4O49 A;  3FR5 A;  3FW5 A;  3E3C A;  2ACP X;  5LKE A;  1FTP A;  5HZQ A;  4M7M A;  1X8Q A;  4RUN A;  1VPR A;  4QGV A;  4KH8 A;  1NP4 A;  4AYH A;  2OFR X;  1GKA A;  2KD2 A;  4D6A A;  2M4L A;  4YCE A;  3RKG A;  2ALL X;  5HTD A;  4TKB A;  5HCD C;  4IAW A;  2AL0 X;  5HZ6 A;  4ORW A;  2L67 A;  2WSJ A;  2LKK A;  5D4A A;  3CBS A;  3JQO A;  1B0O A;  4XMG A;  2MWH A;  4GDZ A;  1FDQ A;  2Q2M A;  2R73 A;  3TGA A;  4I95 A;  4ES7 A;  2N93 A;  1QG5 A;  3D96 A;  2ANS A;  3IFB A;  1BSO A;  1GX8 A;  3FEN A;  2LB6 A;  3ELZ A;  3B2K A;  1I4U A;  2X8S A;  4AZQ A;  5C0N A;  4FBR A;  1QY1 A;  5HA1 A;  5B29 A;  1LFO A;  3D4R A;  3BX8 A;  3V8U A;  3S5V A;  3APX A;  3VG6 A;  3F6Z B;  2Q9S A;  4I3D A;  4IB6 A;  1X89 A;  5LJC A;  1ZNL A;  4YGZ A;  3STM X;  1B4M A;  4GE1 A;  4XME A;  4XMC A;  2X46 A;  1IW2 A;  2Z4I A;  3D97 A;  2GTF X;  1T68 X;  3HWF A;  2L9C A;  4ID2 A;  3S26 A;  3C77 X;  2PY1 A;  2JU8 A;  4Y0S A;  5BYP A;  4ZH6 A;  3VG3 A;  2AT3 X;  4TKH A;  3ZW1 B;  4L1N A;  1QY2 A;  1MX8 A;  1OBP A;  3PPT A;  5HAE A;  3NAD A;  5JR8 A;  3ZUI A;  3Q6L A;  4YDA A;  1OEE A;  1YWB A;  3LHN A;  2BS5 A;  3N91 A;  4YCH A;  2HZQ A;  4MVK A;  3QKG A;  4QZU A;  1HMR A;  1RLB E;  3P02 A;  5K06 A;  4QGX A;  3GE2 A;  1TOU A;  4QRL A;  3O22 A;  2BT9 A;  4YFR A;  1VYG A;  2Q2P A;  4AZP A;  2WQA E;  3FA6 A;  3NBX X;  3B2I A;  1I04 A;  4FBO A;  1D3S A;  4IMN A;  1A2D A;  5L8I A;  3OJY C;  3FYF A;  4KII A;  3UEX A;  3WXQ A;  3FIQ A;  4M6S A;  3WJB A;  2G79 A;  5D45 A;  4MIS A;  1X8U A;  4GU8 A;  4NYR A;  4Y0Q A;  1GT1 A;  3S5X A;  1G7N A;  4N7C A;  3WBG A;  1BRQ A;  2XKL A;  4TQ2 A;  3BY0 A;  3EBW A;  1ZNE A;  2KTS A;  3HOE A;  3SOT A;  1EAL A;  4TJZ A;  1GT5 A;  4ORS A;  2CZU A;  2POA A;  3BS2 A;  1A57 A;  2R74 A;  1AQB A;  1KT5 A;  4XMF A;  1JZU A;  1E02 A;  3BRN A;  4DQ3 A;  2WQ9 A;  3PQS A;  1I05 A;  1JYD A;  2JU3 A;  3TGC A;  3RZY A;  4O9S A;  1BJ7 A;  1EII A;  4KC7 A;  4EXZ A;  2QMI A;  2KTD A;  3FR2 A;  1SY2 A;  2ZAI A;  3KFH A;  3LV4 A;  3P6D A;  2ACO A;  2BHV A;  1LKE A;  2LA7 A;  1CBS A;  4AW8 A;  2WUT A;  4AZR A;  1YWD A;  5H9L A;  3U03 A;  1XKI A;  3PEC A;  4AZO A;  1LPJ A;  4MVL A;  4O4U A;  4NP1 A;  1ALB A;  4FBV A;  4LZV A;  1EW3 A;  1YP7 A;  1YWC A;  2DM5 A;  5BVQ A;  5EDC A;  4GK9 A;  2XST A;  2FLJ A;  4YGG A;  5FFH A;  4U3Q A;  1VYF A;  1BWY A;  3AKM A;  5F7G A;  5D48 A;  4A8Z A;  3HWD A;  4I9S A;  5EED A;  4ON1 A;  5FQ8 E;  5F1E A;  5AEO A;  1MX7 A;  2MO5 A;  4OMX A;  1CBR A;  1KT6 A;  2AKQ A;  4LZU A;  4BOE A;  4EDE A;  4QGW A;  3P6E A;  3SAO A;  3PQU A;  5F6Z A;  1ICN A;  4O4X A;  3B2H A;  3BU1 A;  1SXW A;  5FQ6 E;  5HA0 A;  3VG2 A;  4AZM A;  2L68 A;  3OBL A;  5D8J A;  1LIC A;  1O1V A;  4Y0P A;  3I17 A;  1IFB A;  1KZX A;  1TW4 A;  3C78 X;  2ZAG A;  5KIC A;  5FEN A;  3STN A;  1X8O A;  3FR4 A;  3CBC A;  3WJE A;  4GET A;  1HBP A;  1PBO A;  2YG2 A;  3KZA A;  5D47 A;  1IFC A;  4MIR A;  5HBS A;  2OFM X;  3NQ3 A;  2JW1 A;  3O2Y A;  1B8E A;  1DZK A;  3VPJ E;  3VU1 A;  1LNM A;  1SXU A;  3F8A A;  4I6S A;  1GKA B;  1KOI A;  4YKM A;  1ACD A;  3P6G A;  1AEL A;  3FEP A;  2HLV A;  2MM3 A;  3CQR A;  4GKC A;  3B2L A;  1KQW A;  1BBP A;  2A0A A;  3FMZ A;  2RQ0 A;  5H9K A;  1JBH A;  3WJG A;  2AT5 X;  5DPQ A;  2NNQ A;  1TVQ A;  1AVG I;  1U18 A;  4KCA A;  4QQ1 A;  4YKO A;  3NR3 A;  1URE A;  2E4J A;  2FS6 A;  3FA8 A;  5AQ6 A;  5B27 A;  2OVS A;  3STK A;  1GT4 A;  2FS7 A;  2RCT A;  2A13 A;  2O62 A;  1SXY A;  2OVE A;  2WWP A;  3EYC A;  3VG5 A;  3NQK A;  1CBI A;  5BVT A;  2OZQ A;  3NQ9 A;  3UEU A;  4LKT A;  2BLG A;  3KFG A;  5LJG A;  3CQN A;  3VG4 A;  4EEJ A;  1FE3 A;  4ORU A;  4ODD A;  1DFV A;  1BM5 A;  2A2U A;  5LJB A;  2LBV A;  1DZM A;  2NNE A;  5LJD A;  1CBQ A;  4A60 A;  1FEM A;  4A1H A;  1EXS A;  3CR6 A;  1KT7 A;  4O4S A;  3RSW A;  5F58 A;  2GJ5 A;  2JMB A;  3I0A A;  4YMY A;  4CV7 A;  1KT4 A;  2CM4 A;  2NP1 A;  1SY1 A;  4GH7 A;  1I06 A;  4ORY A;  4GNY A;  1SA8 A;  3HWE A;  3U9P C;  3K3L A;  4NNS A;  1OPB A;  4FQB B;  5L8N A;  1OPA A;  2A3F X;  2G78 A;  2FTB A;  3HWG A;  5HZ8 A;  3D95 A;  4I9R A;  3HOL A;  3NX2 A;  4OS0 A;  4PJ2 A;  3H3I A;  1MDC A;  3C76 X;  1EUO A;  3JS1 A;  4MVE A;  1E06 A;  1QFT A;  4DQ4 A;  3KQ0 A;  4LQZ A;  1KZW A;  1EQD A;  4NW4 A;  1EIO A;  2W2B A;  3APU A;  1ADL A;  1BEB A;  3HK1 A;  5HCE C;  1JJJ A;  1HN2 A;  4LKP A;  4ZJ0 A;  4O4O A;  1IIU A;  3EM0 A;  4IAX A;  3ZI8 A;  3JSQ A;  5KHP A;  2ASN X;  4AZN A;  5HZ9 A;  1DV9 A;  4ZHF A;  4HFO A;  4IBA A;  2CM9 A;  1X71 A;  4R0B A;  5FAZ A;  2KT4 B;  2X45 A;  4YGH A;  3WJC A;  2F09 A;  1EPB A;  4UU3 A;  2EU7 X;  3FA9 A;  2WEW A;  3BU9 A;  3ZW0 A;  3BLG A;  1A18 A;  5HWZ A;  2CBS A;  3NP1 A;  4YH0 A;  1QWD A;  1GM6 A;  5H8T A;  3NPO A;  3OD9 A;  2HMB A;  2JN3 A;  1OBU A;  3TF6 A;  5HZ5 A;  3ZZV A;  1T8V A;  3VE2 A;  1HBQ A;  1E5P A;  2AT8 X;  4BVM A;  3O19 A;  2CZT A;  1ZNH A;  3P24 A;  4O3Z A;  5LKF A;  3P6H A;  2QO5 A;  4L3R A;  4XMD A;  1KQX A;  3ZQ3 A;  1TXL A;  3ZWE A;  2JU7 A;  3GAQ A;  1JIW I;  1ZNG A;  4IB8 A;  4TKJ A;  5EDB A;  1MUP A;  1ZND A;  2FRS A;  4U8U N;  3EMM A;  2L5P A;  2RA6 A;  2QOS C;  4ALO A;  2AMM X;  5F6B A;  2HYS A;  2Q39 A;  2GTL N;  2HZR A;  4NLJ A;  4HPD A;  4I3C A;  1XCA A;  4O3W A;  4ORX A;  4ZHG A;  1N0S A;  1SY0 A;  1S7D A;  1YWA A;  2W2F A;  1D2U A;  4HPC A;  4O3Y A;  4OS3 A;  1ZNK A;  3BX7 A;  1X8P A;  1SXX A;  2HNX A;  2JOZ A;  5CE4 A;  3RBY A;  1GX9 A;  3NX1 A;  2A2G A;  1YP6 A;  4ZGF A;  1LIF A;  5L8O A;  1HQP A;  3APW A;  2YMS A;  2BS6 A;  1PMP A;  4QNI A;  3RWX A;  1JJX A;  1NGL A;  3BDR A;  1IKJ A;  3MBT A;  1LIE A;  2OVA A;  3APV A;  3EBK A;  4JGL A;  2GC9 A;  4CSB A;  1BSQ A;  4MVI A;  3IA8 A;  4XMH A;  5IO5 A;  5IO6 A;  4QYP A;  4OS8 A;  1HMT A;  1JV4 A;  3WJF A;  5AJC A;  4BQU A;  2F73 A;  3F9D A;  4U8U M;  1AB0 A;  1R0U A;  2FR3 A;  1BRP A;  1Z24 A;  1DF3 A;  1G5W A;  2G7B A;  1O8V A;  1CRB A;  4QAE A;  2GTL M;  1BSY A;  3CWK A;  5CYB A;  1T0V A;  4ARH A;  5IO7 A;  4ZHD A;  5FQ7 E;  1LF7 A;  3ZUO A;  2RN4 A;  1YIV A;  4ORR A;  1B56 A;  3UEV A;  4KC8 A;  1QY0 A;  4TNN A;  4ZH9 A;  3KFF A;  4ALB A;  4YFQ A;  1ERB A;  1PM1 X;  4WHI A;  4NNT A;  1TOW A;  1E00 A;  3AKN A;  4ZHC A;  3ZW1 A;  1MVG A;  1YUP A;  1G85 A;  1DZP A;  1KXO A;  1IKE A;  1O1U A;  3TZS A;  1KGL A;  3FEL A;  1NP1 A;  3DTQ A;  4UU2 A;  1DZJ A;  1U0X A;  3UEW A;  2MJI A;  3L4R A;  3DSZ A;  1ZRY A;  3ELX A;  1X8N A;  3WJD A;  3WOV A;  1ICM A;  2K23 A;  5LJH A;  3OE3 A;  4PSQ A;  1S2P A;  1A3Y A;  3U0D A;  1LID A;  3G7X A;  2AT0 X;  5EEE A;  1ERX A;  1UZ2 X;  1QAB E;  4INN A;  5KID A;  1DC9 A;  4COT A;  2Z4H A;  4N7D A;  3S60 A;  2AH7 X;  4K19 A;  1P6P A;  3PED A;  4HPB A;  1H91 A;  3FW4 A;  3VE1 A;  2P8G A;  2RCQ A;  1QFV A;  4GNW A;  2QO4 A;  3BSZ E;  1GXA A;  4I3B A;  4EQA C;  1Y9T A;  5H9A A;  1S44 A;  1PEE A;  2W2A A;  1KT3 A;  3KFI A;  4RUU A;  2LBA A;  2FT9 A;  2X8F A;  4GZV A;  2OVD A;  5LJK A;  1BLR A;  4CK4 A;  4FGI B;  2K62 A;  4TLJ A;  4U9C A;  5H9N A;  1HMS A;  3FEK A;  2WR6 A;  1GGL A;  4WFU A;  3VG7 A;  1EI5 A;  4NLI A;  1FEN A;  1EPA A;  2LFO A;  3MVF A;  3T1D A;  2FWV A;  1GT3 A;  5DG4 A;  3P6F A;  2RD7 C;  3FLL A;  1OEJ A;  2QM9 A;  2MHD A;  4ZR2 A;  4QZT A;  2R56 A;  4YDB A;  4HPA A;  4O3X B;  3UAQ A;  2AT6 X;  1OEK A;  2CBR A;  4GRJ A;  4IMO A;  3B2J A;  5EZ2 A;  4Y0R A;  3PH5 A;  3ZW2 A;  1FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...