3PDFA

Discovery of novel cyanamide-based inhibitors of cathepsin c
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
441
structure length
351
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVFLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1
publication title Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 351
sequence length 441
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 3pdfA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pdfA02
2IPPB 2HHNA 1X9YA 3RVVA 4W5CA 3BC3A 1NB5A 3IMAA 1F29A 2E03A 4K7CA 3IHPA 1CTEA 4XUIA 3HHIA 1PPDA 1PPNA 1MEMA 2ATOA 2GHUA 4CDCA 1XKGA 1K3BA 2PNSA 4I04A 4YYRA 1K3BB 2FYEA 3F5VA 1KFXL 4MZSA 1U9XA 2E01A 3MORA 3KX1A 3CBJA 4N4ZA 2B1MA 3U8EA 4PADA 1AU4A 4BSQA 2DJFA 1NLJA 1PE6A 4N8WA 2DJFB 4MZOA 3O1GA 3HHAA 4WA6A 1VSNA 1POPA 2HH5A 1KHPA 3GCBA 3ZUAA 1CB5A 1YK8A 1MHWA 1STFE 1KXRA 5JA7A 1ITOA 4CDEA 3NHEA 3PNRA 4I07A 3MHHA 4X6JA 4CDEB 1EWMA 4CDDA 1BQIA 9PAPA 3N3GA 4CDDB 2OULA 3OF9A 3BPMA 1AYVA 1F2CA 2G7YA 2P0RA 5A24A 3IOQA 2HD5A 5CHTA 1U9QX 3LXSA 2G6DA 5CVNB 1AIMA 2FUDA 3K8UA 2R9FA 5PADA 3RVXA 3BCNA 3BOWA 2YJ9A 3IEJA 4P6GA 3BWKA 3H89A 1EWPA 3PW3A 2C0YA 1CS8A 4PP2E 2FRAA 2G8JA 4QBBA 1NL6A 2P86A 2DC9A 4Q8HA 3V6CA 2FTDA 1PBHA 2DC6A 1NPZA 1YK7A 4Q8GA 2XU5A 3IUTA 2G8EA 2DCAA 1ZCMA 1AU0A 8PCHA 2NQGA 1MS6A 1IWDA 1ATKA 2DZZA 1QXPA 3I3TA 3USVA 3QJ3A 3WXFA 1PIPA 2AYNA 2CIOA 2CB5A 1CJLA 3N4CA 4RY2A 4YYUA 1S4VA 4YYQA 4YYSA 1Q6KA 1AYWA 1PPPA 3H7DA 1GLOA 3KFQA 5EF4A 2BDZA 4MSXA 1O0EA 2P7UA 2PREA 3I06A 3S3RA 4G54A 1TLOA 1PPOA 2DZYA 1U5IA 3S3QA 1ZIVA 2AIMA 1AECA 4X6IA 2NQAA 5JH3A 2E02A 2OP3A 4OELA 3B79A 2GFOA 1JQPA 4YV8A 5J94A 4QRXA 2AS8A 4N79A 1AYUA 3F75A 3H6SA 1BY8A 3OF8A 3KWBX 1EWLA 3RVWA 4FIPA 1YALA 2NQDB 2WBFX 2YJ8A 3H8BA 1U9WA 3PDFA 1PADA 1Y08A 3P5UA 1QMYA 2FO5A 1NB3A 1VJVA 1FH0A 1Y4HA 4FK5A 1PCIA 2JQGR 4OEMA 2DC7A 2OZ2A 2AU1A 4QRGA 7PCKA 2F1GA 4CZWA 4ZUXU 3WXEA 4PI3A 2DCDA 1AU2A 2R9MA 2PADA 3K9MA 2BDLA 1SP4B 1MEGA 1M6DA 2DCBA 1ME4A 1CPJA 1AU3A 3MTNA 3K24A 2NQIA 3DF0A 1MIRA 2ARYA 1EF7A 2B1NA 4CDFA 3OISA 2IBIA 2R9NA 4CDFB 1ICFA 2ACTA 1A6RA 1KHQA 1TU6A 4PP1A 1ME3A 2XU4A 3P5VA 2YJCA 1EWOA 1HUCB 2VHFA 4QRVA 1DEUA 3KKUA 4DMXA 1SNKA 2JQFR 2R9OA 1GCBA 2YJ2A 1F2AA 3PBHA 2YJBA 1U9VA 4X6HA 4W5BA 2DC8A 2XU1A 3E1ZB 3TNXA 2FRQA 1DF0A 2AYOA 3AI8A 1YVBA 3IV2A 2E00A 4CDCB 3QT4A 1CQDA 5CVOB 2H7JA 4XR7A 3H8CA 1TL9A 3C9EA 2AUZA 1CVZA 3KW9A 5EGWA 3CH2X 3MHSA 3KSEA 1F2BA 3P5WA 4I05A 4BQVA 4AXLA 1MDWA 1YT7A 4KLBA 4YVAA 4HWYA 4W4UA 2DCCA 2DJGA 5CVMA 2DJGB 4DMYA 1QDQA 5K16A 1PXVA 3CH3X 2R6NA 5CHVA 3O0UA 4YYWA 2R9CA 1GECE 3V6EA 3P5XA 2O6XA 2XU3A 1CSBB 2HXZA 2F7DA 3D6SA 3CBKA 3LFYA 4YYVA 1QOLA 2VHSA 1BGOA 1KFUL 2Y5BA 3HWNA 1NQCA 3ERVA 4QH6A 5FPWA 3QSDA 5F02A 3OVZA 2FQ9A 1THEA 4BPVA 3WXGA 3KWZA 2AVWA 4AXMA 3BPFA 4BS6A 4BS5A 2AUXA 3M99A 4P6EA 2FT2A 3OVXA 1CV8A 4FJCA 6PADA 1GMYA 3N3KA 1BP4A 2PBHA 3HD3A 2Y6EA
chains in the Genus database with same CATH superfamily
2IPPB 4Y0PA 3WOVA 3STNA 1GXAA 4BBOA 2E03A 1PM1X 4Y0QA 1MEMA 2GHUA 1K3BA 5BYPA 1KL4A 5EDCA 3FENA 4YYRA 1SXUA 2FYEA 2OFBA 1I9HA 1A2DA 2X46A 5K68A 4MZSA 4IB9A 1AVDA 4BCSA 3VG2A 1RXHA 4N4ZA 4BSQA 3RDUA 3OJYC 2BSZA 2JU8A 1EUOA 4LZVA 4OS8A 2UZ2A 1PE6A 2FWVA 1IFBA 1S7DA 5LKEA 3P6HA 4N8WA 1OPBA 5B5FA 4JNJA 1LNMA 3HHAA 5E6JA 3TZSA 1X8UA 1POPA 1DZMA 2NNQA 3RE6A 3E3CA 1KHPA 3NR3A 2HH5A 3MJ5A 4BQUA 2I5ZO 1GM6A 1ITOA 4TQ2A 4M7MA 4YGZA 2OVEA 4CDEB 1N4JA 5EDBA 1EALA 3N3GA 4WHIA 3OF9A 1VWBB 1KQXA 4IP3A 1VWEB 4I9RA 3IOQA 2JTCA 4JGLA 4YCEA 4HXDB 1VWGB 1AIMA 2L5PA 3VU1A 4ODDA 1A18A 1YP6A 4GU8A 1SWSA 3H89A 1EW3A 1PBOA 3FIDA 2OFAA 1CS8A 3LTWA 5HZQA 3VHMA 2IZCB 4DQ4A 4N7DA 5HCDC 3GAQA 3HPEA 4GUAA 2FTDA 1NPZA 4Q8GA 1P6PA 2DCAA 1MK5A 3HOLA 1W4TA 4NYQA 4ZHHA 1LIFA 1QWDA 4ZH6A 4TKHA 1ATKA 1IW2A 3USVA 3U03A 2LBAA 5IRUA 2AVIA 1SRFA 2GTFX 4LKPA 3N4CA 3BX8A 4O49A 3PRPA 1SWTA 2OY1O 3T1DA 5HBSA 2DOSA 1PPPA 4OS0A 4QYPA 4RUUA 1GLOA 1HMSA 4I3CA 3HWEA 5EF4A 4FBRA 1O0EA 4QGXA 3I06A 4BOPA 3KQ0A 5F2BA 2RTKA 4WURA 2DZYA 3AKNA 2OVSA 2E02A 4OELA 3NADA 2GFOA 4I95A 2G79A 1JQPA 4L1NA 4BOEA 4JHQA 2JOZA 4QRXA 4R0BA 1AYUA 3P24A 1JYDA 1HQPA 2IZHB 1EWLA 2RTAA 4GGZA 3HTYA 3I17A 4O4XA 1X71A 2LKKA 3PQUA 1XKIA 4XMGA 3CR6A 2YJ8A 2OY7A 3B2JA 3SZJA 3WVMA 3PDFA 1QMYA 2FO5A 4WFUA 4GNWA 4Y0SA 2BC3A 4Z2PA 1NB3A 1VJVA 2Y32A 1IIUA 1EIIA 1WBIA 3ZZVA 1E5PA 5CHKA 1BLRA 1FH0A 4FK5A 1SWDA 2W2AA 4OEMA 2DC7A 4Z2VA 2AU1A 3BY4A 1DZJA 2HLVA 3APXA 1AU2A 5HCCC 2PADA 1PMPA 1SRIA 2HKDA 1DKIA 3S5VA 3LV4A 4Z2OA 2RTCB 1M6DA 2DCBA 1JZUA 1AVEA 3P02A 4CK4A 1ZRYA 3RWXA 2ARYA 2HNXA 4OVZA 5KO3A 2IBIA 2R9NA 4CDFB 4KCAA 1ICFA 1MDCA 5LKFA 1BJ7A 3RE5A 3NX2A 1KHQA 5IXGA 4BOSA 2XU4A 3P5VA 2R74A 1HUCB 2BS6A 2OVDA 1KT4A 2RTMA 1RAVA 1SXXA 2YJ2A 3PBHA 1SLEB 2XU1A 3APUA 1PVJA 1O1VA 1YVBA 3E9SA 1MOYA 5EEDA 1GT1A 1CQDA 1E2TA 1O8VA 1W6FA 1TXLA 2H7JA 3W30A 3H8CA 1SWOA 2GTLO 4MM3B 1KZWA 4YBPA 2RD7C 4GKCA 1CVZA 2L68A 5F6BA 1VWRB 3U9PC 1GGLA 1LICA 2Q9SA 3VGWA 4EQAC 4NLIA 4QZUA 2OFMX 3CWKA 3KFIA 4MISA 3NQ3A 4HWYA 2BHVA 4COTA 4AZPA 4GE1A 5LJBA 5EEEA 2LBVA 5CVMA 2CAMA 2DJGB 4HPCA 4YKMA 1KGLA 2OF9A 3CH3X 2AH7X 3PSEA 2R9CA 3S60A 1GECE 1HN2A 5DPQA 3ZUIA 2O6XA 2GH7A 4IB6A 3WZOA 1N43A 1CSBB 2HXZA 2F7DA 1WUBA 1LCWA 2KD2A 1GX9A 1QOLA 1VWKB 4I9SA 4XMCA 2RTFB 2AMMX 2K62A 3VHHA 2YMSA 3MG5A 3HWFA 4QH6A 1R0UA 4YFPA 1QFTA 3EYCA 1N9MA 3OVZA 4NNSA 3RDMA 3BDRA 3RNVA 4A5UA 1QFVA 3KWZA 1TOWA 4BVMA 2HZQA 4EKVA 1JBHA 3RDOA 4AXMA 2FRSA 4BS5A 4XMFA 2AUXA 1CBRA 3T2WA 1SY2A 4PJ2A 4GGRA 4KT5A 4FJCA 1B8EA 3N3KA 5F6ZA 1N7YA 1NQMA 1X9YA 1FENA 3BLGA 4AZQA 2KTSA 2KW1A 1NB5A 4LQZA 3VG6A 5LJDA 3RZYA 3KFFA 4TKJA 3HHIA 3D9WA 2HMBA 5D4AA 1I05A 5LJHA 1U9XA 1SWAA 4Y0RA 3FW4A 2WQ9A 3ZNHA 1ZNHA 1EQDA 2UYWA 3KX1A 1ZNDA 1AU4A 4YCHA 1AELA 5IO6A 2IZGB 4LZUA 1NP1A 4D8EA 1OBPA 2RTIB 2FHLA 4KIIA 2IZBA 4KH8A 1EPAA 4GRJA 2DJFA 1NLJA 3WZQA 4IUMA 4Z28A 1VWAB 2XSTA 1OBQA 3FIQA 3ZW2A 4GJVA 1GT5A 2RN4A 4WA6A 1RXJA 1LIEA 1VSNA 3IFUA 5KHPA 4ORYA 4OS3A 3F6ZB 3BB7A 2CM4A 1CB5A 1YK8A 1STRB 1STFE 1KXRA 4ZGUA 5JA7A 4YKOA 3ZQ3A 3O2YA 3FA8A 4HPBA 3NHEA 3PNRA 1AQBA 3CMPA 4MVLA 5IO5A 4P16A 4CDDA 4YMYA 2OULA 2Q2PA 3BPMA 1IKJA 2FS6A 1HBPA 1VPRA 2IZLB 2HD5A 5CHTA 5LJGA 1GX3A 1LF7A 1T0VA 5HZ8A 1SWJA 1U0XA 3K8UA 2RTBB 2ZSCA 4ON1A 1UZ2X 1AB0A 3RBYA 3BWKA 2W2FA 2F09A 2OY8A 2Y3FA 2R73A 1UYNX 2UZJA 2BLGA 1BM5A 4NYRA 1YWAA 2FRAA 4NLJA 4QBBA 4EFGA 1JJJA 2MWHA 2P86A 5B29A 1BRPA 4AZOA 2X8SA 4Q8HA 1NP4A 5LJCA 5BVTA 2QCBA 3BS2A 1PBHA 2DC6A 5D8JA 1YK7A 1TVQA 2CZTA 5HA0A 3ZW1B 2AKQA 5EZSA 1ZCMA 4IBAA 1NQNA 2MO5A 2NQGA 2Z4IA 1VWJB 5AJCA 1Y52X 1PEEA 2AYNA 4CPHB 2BTWA 1CJLA 2CBSA 1ZNKA 3WJDA 1KT7A 2PI3O 1VWFB 5JD2A 3SZHA 4EEJA 1Q6KA 3RY2A 1YWDA 1AYWA 3H7DA 1E06A 1A57A 3V8UA 3WJGA 1OSPO 3PEDA 4FQBB 3F9DA 2P7UA 2PREA 3S3RA 2O62A 4Z6JA 2GTLM 1JMZA 3X00A 1TLOA 1PPOA 1U5IA 3HOEA 1ZIVA 2AIMA 1AECA 2NQAA 5JH3A 3VE2A 2OL8O 2OP3A 3TRKA 4YV8A 3MVFA 1S2PA 4N79A 1IJ8A 1BY8A 4GDZA 1SWGA 3KWBX 4A60A 3RVWA 4AZMA 2NQDB 4Z27A 1U9WA 2AT6X 2MM3A 2FR2A 3P5UA 3MX7A 1CBIA 2FE8A 4GETA 1E00A 2X8TA 5IRWA 4BX5B 1GT4A 4MEEA 4RNAA 3S5XA 1E02A 2JQGR 2CBRA 2J7QA 2HZRA 7PCKA 1GKAA 2F1GA 4ZUXU 1QY0A 4CV7A 2JU7A 2R9MA 1DFVA 1OEEA 4GDAA 1SP4B 4CPFA 1OPAA 2IZFB 1MEGA 4WFVA 4GNYA 4YFRA 3AKMA 4ZHFA 4NV7A 1ME4A 1ALBA 3MTNA 2RTLA 4NW4A 1I78A 3SOTA 3WJCA 3KVNA 1SRJA 1G7NA 4YVBA 2EU7X 4QGWA 2Z84A 5FAZA 1HMTA 1VWQB 2RTNB 1EXSA 4GJSA 4ALOA 2AF5A 2AL0X 2X45A 1JMXA 3ELZA 4PP1A 1X89A 4BX6B 2YJCA 2X32A 1YUPA 3KKUA 4DMXA 4ZFXA 1SNKA 2JQFR 4ORSA 1I04A 5B11O 1GCBA 2A3FX 3EBWA 4NP1A 4OMXA 4XMHA 3PT2A 3NBXX 4BGFA 1X8QA 5H9KA 3IA8A 4DNEA 4HWMA 3EW1A 3SAOA 1VYGA 5CSEA 5B27A 4QYNA 4TLJA 4XR7A 1KT6A 3CQRA 3WZPA 4MVIA 3PECA 1ML7A 1NGLA 1TL9A 1N0SA 3PH6A 4O3ZA 2QOMA 1SLDB 1VWLB 3PHXA 2GC9A 3KW9A 5EGWA 4BOZA 3MHSA 3BY0A 4GK9A 1SA8A 4IB7A 4GUZA 4TJZA 3ZW0A 1B4MA 1KL5A 4AXLA 1YT7A 4YVAA 4I3BA 4W4UA 2DCCA 1Y9LA 3VG5A 5F58A 3B2KA 2WUTA 4O4SA 2CM9A 5D48A 3O0UA 4YYWA 2X34A 2IZEB 3V6EA 3T6FA 3NP1A 2BS5A 3WJFA 3EW2A 5B3MO 3LFYA 4O9SA 4YYVA 1VWHB 1ZNEA 4QQ1A 1BGOA 5KICA 1DV9A 3HWNA 1CRBA 1N9YA 1LELA 3ZWEA 2F73A 4O4OA 1SLGB 1G5WA 1QY2A 1CBSA 1Y0GA 3L4RA 1ZNLA 1STSB 5HZ5A 3BPFA 3M99A 1SWNA 2A2UA 1SWQA 1CV8A 6PADA 1GMYA 1VWCB 1HQQA 3ZUOA 2RCQA 2PBHA 1Y55X 3HD3A 1ZNGA 2QM9A 2HHNA 3RVVA 4HFOA 2RTDB 3NPOA 1ACDA 4W5CA 5EZ2A 3BC3A 5KIDA 3WYPA 3APVA 4ID2A 1ICMA 1F29A 4K7CA 2RCTA 3IHPA 1CTEA 1GT3A 3UEUA 4CSBA 2ATOA 3PK2A 1TW4A 4YH0A 2PNSA 4I04A 1K3BB 1SY1A 3F5VA 1SXYA 1VWPB 1KFXL 4A1HA 2BTWB 5FQ6E 2E01A 1LCZA 5IO7A 2FGSA 1T68X 1FEMA 1T8VA 3O22A 1W5RA 4YBUA 2B1MA 3Q34A 3STKA 1SWEA 2IZDB 4IAXA 2FTBA 1X8NA 2RQ0A 2OZQA 2BT9A 4ALBA 4R3DA 2Z4HA 4BX7A 3K3LA 4ORUA 3TGBA 3O1GA 2A5BA 3SLOA 1X8OA 2RTRB 3RDQA 1MX8A 5L8NA 4N7CA 4MIRA 3PQSA 1MHWA 4U8UN 3HWDA 4I60A 2P8GA 1MX7A 5D45A 3VPJE 4CDEA 3MHHA 4X6JA 3C78X 2ANSA 9PAPA 1PBYA 1F2CA 3PH5A 3D97A 2FR3A 3DTQA 2G7YA 2P0RA 5A24A 3P6GA 5K67A 5BVSA 3LXSA 3FELA 5CVNB 4A8ZA 3MM0A 3RDXA 1K24A 2R9FA 3I0AA 5PADA 3RVXA 3BCNA 4ZGFA 5C0NA 2G8CO 3WYQA 1EWPA 3PW3A 4FBVA 2C0YA 1IKEA 3NX1A 4ML7B 4QRLA 2G8JA 2FLJA 2RA6A 1NL6A 4QGVA 2DC9A 3UEWA 2PY1A 3FDCA 4JO6A 4UU2A 4OW0A 1CBQA 5EZQA 1HY2A 1AVGI 2XU5A 1H91A 3VHIA 4OKAA 1VWDB 3BU9A 2WPUA 4L3RA 1LCVA 3BU1A 8PCHA 1B0OA 3HK1A 1IWDA 1QXPA 3I3TA 3QJ3A 5DG4A 1PIPA 2G7BA 2RTOB 4ZHGA 1NC9A 1QABE 3DSZA 3GE2A 4RY2A 2AT8X 4Y59A 2OVAA 4YYSA 4D6BA 3KFQA 3VE1A 3U0DA 5B5GA 1DF3A 4DCBA 1G74A 4G54A 4ORWA 3TGAA 3SZIA 2X4MA 2J7QC 4X6IA 4YDAA 5F7GA 3APWA 4INNA 1MM9A 4YFQA 2AS8A 1ERBA 1I4UA 2RTPB 3D4RA 1O1UA 2Q4NA 4GH7A 5BVQA 2C1SA 2WBFX 3H8BA 1Y08A 4U46A 4YGHA 3BBAA 5AQ6A 1SRHA 1VWIB 3AUMO 4KC8A 1STPA 4BOUA 1Y4HA 1PTSA 3O19A 2DM5A 2A5CA 3PRMA 1JV4A 2OZ2A 5D47A 2LB6A 3FR4A 5FQ8E 1KL3A 3VG7A 1SWCA 3WXEA 4PI3A 4BOQA 4D8IA 1UYOX 4TNNA 3WBGA 3FR2A 1DZPA 1B56A 3K24A 3CKGA 3DF0A 1MIRA 3S26A 4ORXA 1SXWA 3STMX 4CDFA 2IZKA 3OISA 2Y3EA 5HTDA 4B55A 4UU3A 4AW8A 2ACTA 4OVZB 1FELA 4LKTA 1OBUA 3WJBA 5FENA 2QO5A 2ASNX 1TU6A 1GX8A 3UEXA 5K06A 5B2AO 1EWOA 1YP7A 1DEUA 4EDEA 2JMBA 5HZ9A 4IMNA 2R9OA 1DZKA 2NNDA 1F2AA 1Z24A 2YJBA 3VG4A 2QMIA 1BRQA 3P6CA 2DC8A 4W5BA 3E1ZB 4TKBA 1DF0A 5LJEA 2E00A 1KFFA 3SLTA 3QT4A 5CVOB 5HA1A 3FA6A 3BSZE 5CE4A 2JU3A 2NP1A 3C9EA 3EM0A 2WWPA 4ES7A 1SREA 4ZHDA 4IABA 3PHUA 2OL6O 4XMEA 1OEJA 2R56A 2X56A 1F2BA 1XCAA 4I05A 4GGTA 3MTVA 4U9CA 1SWLA 4BX7B 4IMOA 2DJGA 3KZAA 4HPDA 4HPAA 1VWMB 3IFBA 4AZRA 5FFHA 1QDQA 5K16A 3TMPA 2R6NA 4NNTA 1JYJA 2I5VO 3BX7A 4FGIB 3PPTA 2RTEB 1VYFA 1FJ1E 3RKGA 3B21A 1SMPI 1HXZA 2XU3A 1LKEA 1SWFA 4O3WA 2VHSA 2Y5BA 3ERVA 1BSQA 1NDJA 2QO4A 5FPWA 3QSDA 1RSUB 3QKGA 2AT3X 4O3XB 1THEA 2NNEA 3WXGA 3B2IA 5H8TA 2AVWA 1S44A 2VFCA 2W2BA 5JR8A 1YZBA 2C1QA 4P6EA 3OVXA 3FLLA 1QQSA 1SLFB 2OYBO 4XMDA 1NBXA 4AZNA 1LDQA 2MHDA 2A2GA 5L3YA 1JJXA 4RF1A 1KQWA 2OY5O 5HZ6A 3IMAA 4IAWA 1U17A 1YWBA 1JIWI 3UEVA 4XUIA 4U8UO 1PPDA 1PPNA 5LJKA 4CDCA 1XKGA 4DQ3A 4D8BA 4A1YA 5EPQA 1HMRA 1SWKA 1QG5A 1ERXA 4ARHA 3MORA 4ZTBA 2A13A 3CBJA 4WBKA 3U8EA 4M0WA 1MUPA 4PADA 4XZXA 2ACOA 2G5LA 2WQAE 3EMMA 2HYSA 3EC5A 2HWKA 2WEWA 2DJFB 4MZOA 4REZA 1FTPA 4GZVA 1JJUA 2QO6A 1SWPA 3W31A 1X8PA 4ZJ0A 3H3IA 1HXLA 3GCBA 3ZUAA 3T2XA 4Y5DA 2OL7A 2JW1A 1VYOA 1LDOA 1RSTB 1RBPA 1D2UA 4CPIA 4PT5A 4I07A 2AT5X 1EWMA 3EBKA 1BQIA 1BEBA 4CDDB 1AYVA 2A0AA 1G85A 1U9QX 3OE3A 1Y53X 3FA9A 2G6DA 4YGGA 1SWBA 2FUDA 2X8FA 2GJ5A 3BOWA 2L9CA 2YJ9A 3FEPA 3IEJA 4P6GA 3FW5A 1LFOA 1FE3A 2AT0X 1KOIA 2RTQB 4RF0A 5FQ7E 1UKFA 5F1EA 4PP2E 5H9AA 2LFOA 2Q39A 2BU3A 3TGCA 3CBSA 1SWUA 4YDBA 2ALLX 3V6CA 3FMZA 3HWGA 2FS7A 5AEOA 2OFRX 3D95A 3IUTA 3ZW1A 5IRAA 2G8EA 2IZIA 5HWZA 2WR6A 1AU0A 4I3DA 1MS6A 2DZZA 4CPHA 3WXFA 3B2LA 2CIOA 2CB5A 4CPEA 1KZXA 3FA7A 4YYUA 1S4VA 2LA7A 2WEXA 2RTGB 4YYQA 4ZR2A 1BSYA 5H9NA 4ZCBA 2YG2A 3FR5A 5B10O 4QNIA 1EI5A 2BDZA 4MSXA 1LPJA 3OBLA 2ZAIA 3P6EA 2ACPX 3S3QA 3ZI8A 1YIVA 2FKJA 3VG3A 3OD9A 1KXOA 3B79A 2Q2MA 3UAQA 3Q6LA 2FKGA 3TF6A 4M6SA 1BWYA 1ADLA 5J94A 3RY1A 1FDQA 3FYFA 2JN3A 3KFGA 3F75A 3H6SA 1BBPA 3OF8A 4MI7A 4FIPA 3B2HA 2A8GA 5HAEA 1YALA 4D6AA 1YWCA 1LUQA 4PSQA 2IZJA 2KT4B 1PADA 1UREA 4ZHCA 3NQKA 3T6LA 3G7XA 5HTEA 2IZAA 3ELXA 3PHWA 1DC9A 4C5PA 4BX5A 4NV8A 4OMWA 1PCIA 2FHNX 3NQ9A 1D3SA 4KC7A 4QRGA 3KFHA 4O3YA 4CZWA 2RTJA 1ICNA 5L8IA 2DCDA 1GKAB 5JZEA 3CQNA 3K9MA 4I6SA 4QAEA 2BDLA 2VDFA 4AYHA 3CKFA 1EIOA 2JRIA 1AU3A 1CPJA 2OF8A 3WJEA 2NQIA 2WSJA 1L6MA 3QQ2A 2JGSA 1KT3A 1EF7A 3FEKA 1TOUA 2MJIA 2B1NA 1KT5A 2IFBA 3MP2A 2MF6A 3N91A 1OEKA 1A6RA 2K23A 1A3YA 2POAA 4IB8A 3C76X 4BX6A 1ME3A 2VHFA 4QRVA 1MVGA 5H9LA 1HBQA 1BSOA 2VFBA 1RLBE 1U9VA 4IRWA 3LHNA 3RDSA 2FT9A 3O65A 4X6HA 4FBOA 3BRNA 1QY1A 3TNXA 2FRQA 1VWNB 2AYOA 4U8UM 3AI8A 3PP6A 1SWHA 5L8OA 3IV2A 4CDCB 3JQOA 3WXQA 3JSQA 3D96A 2G78A 4BJ8A 3AEHA 3C77X 2AUZA 4GD9A 3CH2X 2N93A 3KSEA 4O4UA 2X55A 1LIDA 3P5WA 3MBTA 4BQVA 1SY0A 3ZW0B 1CJ5A 1MDWA 4KLBA 2KTDA 5HCEC 2ZAGA 3C0RA 3CBCA 4QZTA 3WZNA 1DF8A 2QOSC 4DMYA 1RXKA 1Y9TA 2L67A 1PXVA 3OQCA 1MEPA 4U3QA 5CHVA 3JS1A 1LIBA 3P5XA 3F8AA 1SWRA 2AGAA 5CYBA 2GTLN 3D6SA 3CBKA 3RSWA 1KFUL 1VWOB 1SY3A 4K19A 2XKLA 1NQCA 2M4LA 1U18A 4ORRA 2CZUA 5F02A 2FQ9A 1IFCA 4BPVA 2RTHB 2C4IA 4RKXA 3P6DA 2F01A 5AJBA 4BS6A 1SRGA 2FT2A 4MVKA 4MVEA 4EXZA 2E4JA 3SLJA 4ZH9A 1EPBA 1I06A 4RUNA 1BP4A 3P6FA 2Y6EA
chains in the Genus database with same CATH topology
2IPPB 2HHNA 1X9YA 3RVVA 4W5CA 3BC3A 1NB5A 3IMAA 1F29A 2E03A 4K7CA 3IHPA 1CTEA 4XUIA 3HHIA 3D9WA 1PPDA 1PPNA 1MEMA 2ATOA 2GHUA 4CDCA 1XKGA 1K3BA 2PNSA 4I04A 4YYRA 1K3BB 2FYEA 3F5VA 1KFXL 4MZSA 1U9XA 2E01A 3MORA 3KX1A 3CBJA 4N4ZA 1W5RA 2B1MA 3U8EA 4PADA 1AU4A 4BSQA 2BSZA 2DJFA 1NLJA 1PE6A 4N8WA 2DJFB 4MZOA 3O1GA 3HHAA 4WA6A 1VSNA 1POPA 2HH5A 1KHPA 3GCBA 3ZUAA 1CB5A 1YK8A 1MHWA 1STFE 1KXRA 5JA7A 1ITOA 4CDEA 3NHEA 3PNRA 4I07A 3MHHA 4X6JA 4CDEB 1EWMA 4CDDA 1BQIA 9PAPA 3N3GA 4CDDB 2OULA 3OF9A 3BPMA 1AYVA 1F2CA 2G7YA 2P0RA 5A24A 3IOQA 2HD5A 5CHTA 1GX3A 1U9QX 3LXSA 2G6DA 5CVNB 1AIMA 2FUDA 3K8UA 2R9FA 5PADA 3RVXA 3BCNA 3BOWA 2YJ9A 3IEJA 4P6GA 3BWKA 3H89A 1EWPA 3PW3A 2C0YA 1CS8A 3LTWA 4PP2E 2FRAA 2G8JA 4QBBA 1NL6A 2P86A 2DC9A 4Q8HA 3V6CA 2FTDA 1PBHA 2DC6A 1NPZA 1YK7A 4Q8GA 2XU5A 3IUTA 2G8EA 2DCAA 1ZCMA 1W4TA 1AU0A 8PCHA 2NQGA 1MS6A 1IWDA 1ATKA 2DZZA 1QXPA 3I3TA 3USVA 3QJ3A 3WXFA 1PIPA 2AYNA 2CIOA 2CB5A 1CJLA 3N4CA 4RY2A 4YYUA 1S4VA 4YYQA 4YYSA 1Q6KA 1AYWA 1PPPA 3H7DA 1GLOA 3KFQA 5EF4A 2BDZA 4MSXA 1O0EA 2P7UA 2PREA 3I06A 3S3RA 4G54A 1TLOA 1PPOA 2DZYA 1U5IA 3S3QA 1ZIVA 2AIMA 1AECA 4X6IA 2NQAA 5JH3A 2E02A 2OP3A 4OELA 3B79A 2GFOA 1JQPA 4YV8A 5J94A 4QRXA 2AS8A 4N79A 1AYUA 3F75A 3H6SA 1BY8A 3OF8A 3KWBX 1EWLA 3RVWA 4FIPA 1YALA 2NQDB 2WBFX 2YJ8A 3H8BA 1U9WA 3PDFA 1PADA 1Y08A 3P5UA 1QMYA 2FO5A 1NB3A 1VJVA 4C5PA 4NV8A 1FH0A 1Y4HA 4FK5A 1PCIA 2JQGR 4OEMA 2DC7A 2OZ2A 2AU1A 4QRGA 7PCKA 2F1GA 4CZWA 4ZUXU 3WXEA 4PI3A 2DCDA 1AU2A 2R9MA 2PADA 3K9MA 2BDLA 1SP4B 1MEGA 1M6DA 2DCBA 4NV7A 1ME4A 1CPJA 1AU3A 3MTNA 3K24A 2NQIA 3DF0A 1MIRA 2ARYA 1EF7A 2B1NA 4CDFA 3OISA 2IBIA 2R9NA 4CDFB 4B55A 1ICFA 2ACTA 1A6RA 1KHQA 1TU6A 4PP1A 1ME3A 2XU4A 3P5VA 2YJCA 1EWOA 1HUCB 2VHFA 4QRVA 1DEUA 3KKUA 4DMXA 1SNKA 2JQFR 2R9OA 1GCBA 2VFBA 2YJ2A 1F2AA 3PBHA 2YJBA 1U9VA 4X6HA 4BGFA 4W5BA 2DC8A 2XU1A 3E1ZB 3TNXA 2FRQA 1DF0A 2AYOA 3AI8A 1YVBA 3IV2A 2E00A 4CDCB 3QT4A 1CQDA 1E2TA 5CVOB 1W6FA 2H7JA 4XR7A 3H8CA 1TL9A 3C9EA 2AUZA 1CVZA 3KW9A 5EGWA 3CH2X 3MHSA 3KSEA 1F2BA 3P5WA 4GUZA 4I05A 4BQVA 4AXLA 1MDWA 1YT7A 4KLBA 4YVAA 4HWYA 4W4UA 2DCCA 2DJGA 5CVMA 2DJGB 4DMYA 1QDQA 5K16A 1PXVA 3CH3X 2R6NA 5CHVA 3O0UA 4YYWA 2R9CA 1GECE 3V6EA 3P5XA 2O6XA 2XU3A 1CSBB 2HXZA 2F7DA 3D6SA 3CBKA 3LFYA 4YYVA 1QOLA 2VHSA 1BGOA 1KFUL 2Y5BA 3HWNA 1NQCA 3ERVA 4QH6A 5FPWA 3QSDA 5F02A 3OVZA 2FQ9A 1THEA 4BPVA 3WXGA 3KWZA 2AVWA 2VFCA 4AXMA 3BPFA 4BS6A 4BS5A 2AUXA 3M99A 4P6EA 2FT2A 3OVXA 1CV8A 4FJCA 6PADA 1GMYA 3N3KA 1BP4A 2PBHA 3HD3A 2Y6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP B;  2HHN A;  1X9Y A;  3RVV A;  4W5C A;  3BC3 A;  1NB5 A;  3IMA A;  1F29 A;  2E03 A;  4K7C A;  3IHP A;  1CTE A;  4XUI A;  3HHI A;  1PPD A;  1PPN A;  1MEM A;  2ATO A;  2GHU A;  4CDC A;  1XKG A;  1K3B A;  2PNS A;  4I04 A;  4YYR A;  1K3B B;  2FYE A;  3F5V A;  1KFX L;  4MZS A;  1U9X A;  2E01 A;  3MOR A;  3KX1 A;  3CBJ A;  4N4Z A;  2B1M A;  3U8E A;  4PAD A;  1AU4 A;  4BSQ A;  2DJF A;  1NLJ A;  1PE6 A;  4N8W A;  2DJF B;  4MZO A;  3O1G A;  3HHA A;  4WA6 A;  1VSN A;  1POP A;  2HH5 A;  1KHP A;  3GCB A;  3ZUA A;  1CB5 A;  1YK8 A;  1MHW A;  1STF E;  1KXR A;  5JA7 A;  1ITO A;  4CDE A;  3NHE A;  3PNR A;  4I07 A;  3MHH A;  4X6J A;  4CDE B;  1EWM A;  4CDD A;  1BQI A;  9PAP A;  3N3G A;  4CDD B;  2OUL A;  3OF9 A;  3BPM A;  1AYV A;  1F2C A;  2G7Y A;  2P0R A;  5A24 A;  3IOQ A;  2HD5 A;  5CHT A;  1U9Q X;  3LXS A;  2G6D A;  5CVN B;  1AIM A;  2FUD A;  3K8U A;  2R9F A;  5PAD A;  3RVX A;  3BCN A;  3BOW A;  2YJ9 A;  3IEJ A;  4P6G A;  3BWK A;  3H89 A;  1EWP A;  3PW3 A;  2C0Y A;  1CS8 A;  4PP2 E;  2FRA A;  2G8J A;  4QBB A;  1NL6 A;  2P86 A;  2DC9 A;  4Q8H A;  3V6C A;  2FTD A;  1PBH A;  2DC6 A;  1NPZ A;  1YK7 A;  4Q8G A;  2XU5 A;  3IUT A;  2G8E A;  2DCA A;  1ZCM A;  1AU0 A;  8PCH A;  2NQG A;  1MS6 A;  1IWD A;  1ATK A;  2DZZ A;  1QXP A;  3I3T A;  3USV A;  3QJ3 A;  3WXF A;  1PIP A;  2AYN A;  2CIO A;  2CB5 A;  1CJL A;  3N4C A;  4RY2 A;  4YYU A;  1S4V A;  4YYQ A;  4YYS A;  1Q6K A;  1AYW A;  1PPP A;  3H7D A;  1GLO A;  3KFQ A;  5EF4 A;  2BDZ A;  4MSX A;  1O0E A;  2P7U A;  2PRE A;  3I06 A;  3S3R A;  4G54 A;  1TLO A;  1PPO A;  2DZY A;  1U5I A;  3S3Q A;  1ZIV A;  2AIM A;  1AEC A;  4X6I A;  2NQA A;  5JH3 A;  2E02 A;  2OP3 A;  4OEL A;  3B79 A;  2GFO A;  1JQP A;  4YV8 A;  5J94 A;  4QRX A;  2AS8 A;  4N79 A;  1AYU A;  3F75 A;  3H6S A;  1BY8 A;  3OF8 A;  3KWB X;  1EWL A;  3RVW A;  4FIP A;  1YAL A;  2NQD B;  2WBF X;  2YJ8 A;  3H8B A;  1U9W A;  3PDF A;  1PAD A;  1Y08 A;  3P5U A;  1QMY A;  2FO5 A;  1NB3 A;  1VJV A;  1FH0 A;  1Y4H A;  4FK5 A;  1PCI A;  2JQG R;  4OEM A;  2DC7 A;  2OZ2 A;  2AU1 A;  4QRG A;  7PCK A;  2F1G A;  4CZW A;  4ZUX U;  3WXE A;  4PI3 A;  2DCD A;  1AU2 A;  2R9M A;  2PAD A;  3K9M A;  2BDL A;  1SP4 B;  1MEG A;  1M6D A;  2DCB A;  1ME4 A;  1CPJ A;  1AU3 A;  3MTN A;  3K24 A;  2NQI A;  3DF0 A;  1MIR A;  2ARY A;  1EF7 A;  2B1N A;  4CDF A;  3OIS A;  2IBI A;  2R9N A;  4CDF B;  1ICF A;  2ACT A;  1A6R A;  1KHQ A;  1TU6 A;  4PP1 A;  1ME3 A;  2XU4 A;  3P5V A;  2YJC A;  1EWO A;  1HUC B;  2VHF A;  4QRV A;  1DEU A;  3KKU A;  4DMX A;  1SNK A;  2JQF R;  2R9O A;  1GCB A;  2YJ2 A;  1F2A A;  3PBH A;  2YJB A;  1U9V A;  4X6H A;  4W5B A;  2DC8 A;  2XU1 A;  3E1Z B;  3TNX A;  2FRQ A;  1DF0 A;  2AYO A;  3AI8 A;  1YVB A;  3IV2 A;  2E00 A;  4CDC B;  3QT4 A;  1CQD A;  5CVO B;  2H7J A;  4XR7 A;  3H8C A;  1TL9 A;  3C9E A;  2AUZ A;  1CVZ A;  3KW9 A;  5EGW A;  3CH2 X;  3MHS A;  3KSE A;  1F2B A;  3P5W A;  4I05 A;  4BQV A;  4AXL A;  1MDW A;  1YT7 A;  4KLB A;  4YVA A;  4HWY A;  4W4U A;  2DCC A;  2DJG A;  5CVM A;  2DJG B;  4DMY A;  1QDQ A;  5K16 A;  1PXV A;  3CH3 X;  2R6N A;  5CHV A;  3O0U A;  4YYW A;  2R9C A;  1GEC E;  3V6E A;  3P5X A;  2O6X A;  2XU3 A;  1CSB B;  2HXZ A;  2F7D A;  3D6S A;  3CBK A;  3LFY A;  4YYV A;  1QOL A;  2VHS A;  1BGO A;  1KFU L;  2Y5B A;  3HWN A;  1NQC A;  3ERV A;  4QH6 A;  5FPW A;  3QSD A;  5F02 A;  3OVZ A;  2FQ9 A;  1THE A;  4BPV A;  3WXG A;  3KWZ A;  2AVW A;  4AXM A;  3BPF A;  4BS6 A;  4BS5 A;  2AUX A;  3M99 A;  4P6E A;  2FT2 A;  3OVX A;  1CV8 A;  4FJC A;  6PAD A;  1GMY A;  3N3K A;  1BP4 A;  2PBH A;  3HD3 A;  2Y6E A; 
#chains in the Genus database with same CATH topology
 2IPP B;  4Y0P A;  3WOV A;  3STN A;  1GXA A;  4BBO A;  2E03 A;  1PM1 X;  4Y0Q A;  1MEM A;  2GHU A;  1K3B A;  5BYP A;  1KL4 A;  5EDC A;  3FEN A;  4YYR A;  1SXU A;  2FYE A;  2OFB A;  1I9H A;  1A2D A;  2X46 A;  5K68 A;  4MZS A;  4IB9 A;  1AVD A;  4BCS A;  3VG2 A;  1RXH A;  4N4Z A;  4BSQ A;  3RDU A;  3OJY C;  2BSZ A;  2JU8 A;  1EUO A;  4LZV A;  4OS8 A;  2UZ2 A;  1PE6 A;  2FWV A;  1IFB A;  1S7D A;  5LKE A;  3P6H A;  4N8W A;  1OPB A;  5B5F A;  4JNJ A;  1LNM A;  3HHA A;  5E6J A;  3TZS A;  1X8U A;  1POP A;  1DZM A;  2NNQ A;  3RE6 A;  3E3C A;  1KHP A;  3NR3 A;  2HH5 A;  3MJ5 A;  4BQU A;  2I5Z O;  1GM6 A;  1ITO A;  4TQ2 A;  4M7M A;  4YGZ A;  2OVE A;  4CDE B;  1N4J A;  5EDB A;  1EAL A;  3N3G A;  4WHI A;  3OF9 A;  1VWB B;  1KQX A;  4IP3 A;  1VWE B;  4I9R A;  3IOQ A;  2JTC A;  4JGL A;  4YCE A;  4HXD B;  1VWG B;  1AIM A;  2L5P A;  3VU1 A;  4ODD A;  1A18 A;  1YP6 A;  4GU8 A;  1SWS A;  3H89 A;  1EW3 A;  1PBO A;  3FID A;  2OFA A;  1CS8 A;  3LTW A;  5HZQ A;  3VHM A;  2IZC B;  4DQ4 A;  4N7D A;  5HCD C;  3GAQ A;  3HPE A;  4GUA A;  2FTD A;  1NPZ A;  4Q8G A;  1P6P A;  2DCA A;  1MK5 A;  3HOL A;  1W4T A;  4NYQ A;  4ZHH A;  1LIF A;  1QWD A;  4ZH6 A;  4TKH A;  1ATK A;  1IW2 A;  3USV A;  3U03 A;  2LBA A;  5IRU A;  2AVI A;  1SRF A;  2GTF X;  4LKP A;  3N4C A;  3BX8 A;  4O49 A;  3PRP A;  1SWT A;  2OY1 O;  3T1D A;  5HBS A;  2DOS A;  1PPP A;  4OS0 A;  4QYP A;  4RUU A;  1GLO A;  1HMS A;  4I3C A;  3HWE A;  5EF4 A;  4FBR A;  1O0E A;  4QGX A;  3I06 A;  4BOP A;  3KQ0 A;  5F2B A;  2RTK A;  4WUR A;  2DZY A;  3AKN A;  2OVS A;  2E02 A;  4OEL A;  3NAD A;  2GFO A;  4I95 A;  2G79 A;  1JQP A;  4L1N A;  4BOE A;  4JHQ A;  2JOZ A;  4QRX A;  4R0B A;  1AYU A;  3P24 A;  1JYD A;  1HQP A;  2IZH B;  1EWL A;  2RTA A;  4GGZ A;  3HTY A;  3I17 A;  4O4X A;  1X71 A;  2LKK A;  3PQU A;  1XKI A;  4XMG A;  3CR6 A;  2YJ8 A;  2OY7 A;  3B2J A;  3SZJ A;  3WVM A;  3PDF A;  1QMY A;  2FO5 A;  4WFU A;  4GNW A;  4Y0S A;  2BC3 A;  4Z2P A;  1NB3 A;  1VJV A;  2Y32 A;  1IIU A;  1EII A;  1WBI A;  3ZZV A;  1E5P A;  5CHK A;  1BLR A;  1FH0 A;  4FK5 A;  1SWD A;  2W2A A;  4OEM A;  2DC7 A;  4Z2V A;  2AU1 A;  3BY4 A;  1DZJ A;  2HLV A;  3APX A;  1AU2 A;  5HCC C;  2PAD A;  1PMP A;  1SRI A;  2HKD A;  1DKI A;  3S5V A;  3LV4 A;  4Z2O A;  2RTC B;  1M6D A;  2DCB A;  1JZU A;  1AVE A;  3P02 A;  4CK4 A;  1ZRY A;  3RWX A;  2ARY A;  2HNX A;  4OVZ A;  5KO3 A;  2IBI A;  2R9N A;  4CDF B;  4KCA A;  1ICF A;  1MDC A;  5LKF A;  1BJ7 A;  3RE5 A;  3NX2 A;  1KHQ A;  5IXG A;  4BOS A;  2XU4 A;  3P5V A;  2R74 A;  1HUC B;  2BS6 A;  2OVD A;  1KT4 A;  2RTM A;  1RAV A;  1SXX A;  2YJ2 A;  3PBH A;  1SLE B;  2XU1 A;  3APU A;  1PVJ A;  1O1V A;  1YVB A;  3E9S A;  1MOY A;  5EED A;  1GT1 A;  1CQD A;  1E2T A;  1O8V A;  1W6F A;  1TXL A;  2H7J A;  3W30 A;  3H8C A;  1SWO A;  2GTL O;  4MM3 B;  1KZW A;  4YBP A;  2RD7 C;  4GKC A;  1CVZ A;  2L68 A;  5F6B A;  1VWR B;  3U9P C;  1GGL A;  1LIC A;  2Q9S A;  3VGW A;  4EQA C;  4NLI A;  4QZU A;  2OFM X;  3CWK A;  3KFI A;  4MIS A;  3NQ3 A;  4HWY A;  2BHV A;  4COT A;  4AZP A;  4GE1 A;  5LJB A;  5EEE A;  2LBV A;  5CVM A;  2CAM A;  2DJG B;  4HPC A;  4YKM A;  1KGL A;  2OF9 A;  3CH3 X;  2AH7 X;  3PSE A;  2R9C A;  3S60 A;  1GEC E;  1HN2 A;  5DPQ A;  3ZUI A;  2O6X A;  2GH7 A;  4IB6 A;  3WZO A;  1N43 A;  1CSB B;  2HXZ A;  2F7D A;  1WUB A;  1LCW A;  2KD2 A;  1GX9 A;  1QOL A;  1VWK B;  4I9S A;  4XMC A;  2RTF B;  2AMM X;  2K62 A;  3VHH A;  2YMS A;  3MG5 A;  3HWF A;  4QH6 A;  1R0U A;  4YFP A;  1QFT A;  3EYC A;  1N9M A;  3OVZ A;  4NNS A;  3RDM A;  3BDR A;  3RNV A;  4A5U A;  1QFV A;  3KWZ A;  1TOW A;  4BVM A;  2HZQ A;  4EKV A;  1JBH A;  3RDO A;  4AXM A;  2FRS A;  4BS5 A;  4XMF A;  2AUX A;  1CBR A;  3T2W A;  1SY2 A;  4PJ2 A;  4GGR A;  4KT5 A;  4FJC A;  1B8E A;  3N3K A;  5F6Z A;  1N7Y A;  1NQM A;  1X9Y A;  1FEN A;  3BLG A;  4AZQ A;  2KTS A;  2KW1 A;  1NB5 A;  4LQZ A;  3VG6 A;  5LJD A;  3RZY A;  3KFF A;  4TKJ A;  3HHI A;  3D9W A;  2HMB A;  5D4A A;  1I05 A;  5LJH A;  1U9X A;  1SWA A;  4Y0R A;  3FW4 A;  2WQ9 A;  3ZNH A;  1ZNH A;  1EQD A;  2UYW A;  3KX1 A;  1ZND A;  1AU4 A;  4YCH A;  1AEL A;  5IO6 A;  2IZG B;  4LZU A;  1NP1 A;  4D8E A;  1OBP A;  2RTI B;  2FHL A;  4KII A;  2IZB A;  4KH8 A;  1EPA A;  4GRJ A;  2DJF A;  1NLJ A;  3WZQ A;  4IUM A;  4Z28 A;  1VWA B;  2XST A;  1OBQ A;  3FIQ A;  3ZW2 A;  4GJV A;  1GT5 A;  2RN4 A;  4WA6 A;  1RXJ A;  1LIE A;  1VSN A;  3IFU A;  5KHP A;  4ORY A;  4OS3 A;  3F6Z B;  3BB7 A;  2CM4 A;  1CB5 A;  1YK8 A;  1STR B;  1STF E;  1KXR A;  4ZGU A;  5JA7 A;  4YKO A;  3ZQ3 A;  3O2Y A;  3FA8 A;  4HPB A;  3NHE A;  3PNR A;  1AQB A;  3CMP A;  4MVL A;  5IO5 A;  4P16 A;  4CDD A;  4YMY A;  2OUL A;  2Q2P A;  3BPM A;  1IKJ A;  2FS6 A;  1HBP A;  1VPR A;  2IZL B;  2HD5 A;  5CHT A;  5LJG A;  1GX3 A;  1LF7 A;  1T0V A;  5HZ8 A;  1SWJ A;  1U0X A;  3K8U A;  2RTB B;  2ZSC A;  4ON1 A;  1UZ2 X;  1AB0 A;  3RBY A;  3BWK A;  2W2F A;  2F09 A;  2OY8 A;  2Y3F A;  2R73 A;  1UYN X;  2UZJ A;  2BLG A;  1BM5 A;  4NYR A;  1YWA A;  2FRA A;  4NLJ A;  4QBB A;  4EFG A;  1JJJ A;  2MWH A;  2P86 A;  5B29 A;  1BRP A;  4AZO A;  2X8S A;  4Q8H A;  1NP4 A;  5LJC A;  5BVT A;  2QCB A;  3BS2 A;  1PBH A;  2DC6 A;  5D8J A;  1YK7 A;  1TVQ A;  2CZT A;  5HA0 A;  3ZW1 B;  2AKQ A;  5EZS A;  1ZCM A;  4IBA A;  1NQN A;  2MO5 A;  2NQG A;  2Z4I A;  1VWJ B;  5AJC A;  1Y52 X;  1PEE A;  2AYN A;  4CPH B;  2BTW A;  1CJL A;  2CBS A;  1ZNK A;  3WJD A;  1KT7 A;  2PI3 O;  1VWF B;  5JD2 A;  3SZH A;  4EEJ A;  1Q6K A;  3RY2 A;  1YWD A;  1AYW A;  3H7D A;  1E06 A;  1A57 A;  3V8U A;  3WJG A;  1OSP O;  3PED A;  4FQB B;  3F9D A;  2P7U A;  2PRE A;  3S3R A;  2O62 A;  4Z6J A;  2GTL M;  1JMZ A;  3X00 A;  1TLO A;  1PPO A;  1U5I A;  3HOE A;  1ZIV A;  2AIM A;  1AEC A;  2NQA A;  5JH3 A;  3VE2 A;  2OL8 O;  2OP3 A;  3TRK A;  4YV8 A;  3MVF A;  1S2P A;  4N79 A;  1IJ8 A;  1BY8 A;  4GDZ A;  1SWG A;  3KWB X;  4A60 A;  3RVW A;  4AZM A;  2NQD B;  4Z27 A;  1U9W A;  2AT6 X;  2MM3 A;  2FR2 A;  3P5U A;  3MX7 A;  1CBI A;  2FE8 A;  4GET A;  1E00 A;  2X8T A;  5IRW A;  4BX5 B;  1GT4 A;  4MEE A;  4RNA A;  3S5X A;  1E02 A;  2JQG R;  2CBR A;  2J7Q A;  2HZR A;  7PCK A;  1GKA A;  2F1G A;  4ZUX U;  1QY0 A;  4CV7 A;  2JU7 A;  2R9M A;  1DFV A;  1OEE A;  4GDA A;  1SP4 B;  4CPF A;  1OPA A;  2IZF B;  1MEG A;  4WFV A;  4GNY A;  4YFR A;  3AKM A;  4ZHF A;  4NV7 A;  1ME4 A;  1ALB A;  3MTN A;  2RTL A;  4NW4 A;  1I78 A;  3SOT A;  3WJC A;  3KVN A;  1SRJ A;  1G7N A;  4YVB A;  2EU7 X;  4QGW A;  2Z84 A;  5FAZ A;  1HMT A;  1VWQ B;  2RTN B;  1EXS A;  4GJS A;  4ALO A;  2AF5 A;  2AL0 X;  2X45 A;  1JMX A;  3ELZ A;  4PP1 A;  1X89 A;  4BX6 B;  2YJC A;  2X32 A;  1YUP A;  3KKU A;  4DMX A;  4ZFX A;  1SNK A;  2JQF R;  4ORS A;  1I04 A;  5B11 O;  1GCB A;  2A3F X;  3EBW A;  4NP1 A;  4OMX A;  4XMH A;  3PT2 A;  3NBX X;  4BGF A;  1X8Q A;  5H9K A;  3IA8 A;  4DNE A;  4HWM A;  3EW1 A;  3SAO A;  1VYG A;  5CSE A;  5B27 A;  4QYN A;  4TLJ A;  4XR7 A;  1KT6 A;  3CQR A;  3WZP A;  4MVI A;  3PEC A;  1ML7 A;  1NGL A;  1TL9 A;  1N0S A;  3PH6 A;  4O3Z A;  2QOM A;  1SLD B;  1VWL B;  3PHX A;  2GC9 A;  3KW9 A;  5EGW A;  4BOZ A;  3MHS A;  3BY0 A;  4GK9 A;  1SA8 A;  4IB7 A;  4GUZ A;  4TJZ A;  3ZW0 A;  1B4M A;  1KL5 A;  4AXL A;  1YT7 A;  4YVA A;  4I3B A;  4W4U A;  2DCC A;  1Y9L A;  3VG5 A;  5F58 A;  3B2K A;  2WUT A;  4O4S A;  2CM9 A;  5D48 A;  3O0U A;  4YYW A;  2X34 A;  2IZE B;  3V6E A;  3T6F A;  3NP1 A;  2BS5 A;  3WJF A;  3EW2 A;  5B3M O;  3LFY A;  4O9S A;  4YYV A;  1VWH B;  1ZNE A;  4QQ1 A;  1BGO A;  5KIC A;  1DV9 A;  3HWN A;  1CRB A;  1N9Y A;  1LEL A;  3ZWE A;  2F73 A;  4O4O A;  1SLG B;  1G5W A;  1QY2 A;  1CBS A;  1Y0G A;  3L4R A;  1ZNL A;  1STS B;  5HZ5 A;  3BPF A;  3M99 A;  1SWN A;  2A2U A;  1SWQ A;  1CV8 A;  6PAD A;  1GMY A;  1VWC B;  1HQQ A;  3ZUO A;  2RCQ A;  2PBH A;  1Y55 X;  3HD3 A;  1ZNG A;  2QM9 A;  2HHN A;  3RVV A;  4HFO A;  2RTD B;  3NPO A;  1ACD A;  4W5C A;  5EZ2 A;  3BC3 A;  5KID A;  3WYP A;  3APV A;  4ID2 A;  1ICM A;  1F29 A;  4K7C A;  2RCT A;  3IHP A;  1CTE A;  1GT3 A;  3UEU A;  4CSB A;  2ATO A;  3PK2 A;  1TW4 A;  4YH0 A;  2PNS A;  4I04 A;  1K3B B;  1SY1 A;  3F5V A;  1SXY A;  1VWP B;  1KFX L;  4A1H A;  2BTW B;  5FQ6 E;  2E01 A;  1LCZ A;  5IO7 A;  2FGS A;  1T68 X;  1FEM A;  1T8V A;  3O22 A;  1W5R A;  4YBU A;  2B1M A;  3Q34 A;  3STK A;  1SWE A;  2IZD B;  4IAX A;  2FTB A;  1X8N A;  2RQ0 A;  2OZQ A;  2BT9 A;  4ALB A;  4R3D A;  2Z4H A;  4BX7 A;  3K3L A;  4ORU A;  3TGB A;  3O1G A;  2A5B A;  3SLO A;  1X8O A;  2RTR B;  3RDQ A;  1MX8 A;  5L8N A;  4N7C A;  4MIR A;  3PQS A;  1MHW A;  4U8U N;  3HWD A;  4I60 A;  2P8G A;  1MX7 A;  5D45 A;  3VPJ E;  4CDE A;  3MHH A;  4X6J A;  3C78 X;  2ANS A;  9PAP A;  1PBY A;  1F2C A;  3PH5 A;  3D97 A;  2FR3 A;  3DTQ A;  2G7Y A;  2P0R A;  5A24 A;  3P6G A;  5K67 A;  5BVS A;  3LXS A;  3FEL A;  5CVN B;  4A8Z A;  3MM0 A;  3RDX A;  1K24 A;  2R9F A;  3I0A A;  5PAD A;  3RVX A;  3BCN A;  4ZGF A;  5C0N A;  2G8C O;  3WYQ A;  1EWP A;  3PW3 A;  4FBV A;  2C0Y A;  1IKE A;  3NX1 A;  4ML7 B;  4QRL A;  2G8J A;  2FLJ A;  2RA6 A;  1NL6 A;  4QGV A;  2DC9 A;  3UEW A;  2PY1 A;  3FDC A;  4JO6 A;  4UU2 A;  4OW0 A;  1CBQ A;  5EZQ A;  1HY2 A;  1AVG I;  2XU5 A;  1H91 A;  3VHI A;  4OKA A;  1VWD B;  3BU9 A;  2WPU A;  4L3R A;  1LCV A;  3BU1 A;  8PCH A;  1B0O A;  3HK1 A;  1IWD A;  1QXP A;  3I3T A;  3QJ3 A;  5DG4 A;  1PIP A;  2G7B A;  2RTO B;  4ZHG A;  1NC9 A;  1QAB E;  3DSZ A;  3GE2 A;  4RY2 A;  2AT8 X;  4Y59 A;  2OVA A;  4YYS A;  4D6B A;  3KFQ A;  3VE1 A;  3U0D A;  5B5G A;  1DF3 A;  4DCB A;  1G74 A;  4G54 A;  4ORW A;  3TGA A;  3SZI A;  2X4M A;  2J7Q C;  4X6I A;  4YDA A;  5F7G A;  3APW A;  4INN A;  1MM9 A;  4YFQ A;  2AS8 A;  1ERB A;  1I4U A;  2RTP B;  3D4R A;  1O1U A;  2Q4N A;  4GH7 A;  5BVQ A;  2C1S A;  2WBF X;  3H8B A;  1Y08 A;  4U46 A;  4YGH A;  3BBA A;  5AQ6 A;  1SRH A;  1VWI B;  3AUM O;  4KC8 A;  1STP A;  4BOU A;  1Y4H A;  1PTS A;  3O19 A;  2DM5 A;  2A5C A;  3PRM A;  1JV4 A;  2OZ2 A;  5D47 A;  2LB6 A;  3FR4 A;  5FQ8 E;  1KL3 A;  3VG7 A;  1SWC A;  3WXE A;  4PI3 A;  4BOQ A;  4D8I A;  1UYO X;  4TNN A;  3WBG A;  3FR2 A;  1DZP A;  1B56 A;  3K24 A;  3CKG A;  3DF0 A;  1MIR A;  3S26 A;  4ORX A;  1SXW A;  3STM X;  4CDF A;  2IZK A;  3OIS A;  2Y3E A;  5HTD A;  4B55 A;  4UU3 A;  4AW8 A;  2ACT A;  4OVZ B;  1FEL A;  4LKT A;  1OBU A;  3WJB A;  5FEN A;  2QO5 A;  2ASN X;  1TU6 A;  1GX8 A;  3UEX A;  5K06 A;  5B2A O;  1EWO A;  1YP7 A;  1DEU A;  4EDE A;  2JMB A;  5HZ9 A;  4IMN A;  2R9O A;  1DZK A;  2NND A;  1F2A A;  1Z24 A;  2YJB A;  3VG4 A;  2QMI A;  1BRQ A;  3P6C A;  2DC8 A;  4W5B A;  3E1Z B;  4TKB A;  1DF0 A;  5LJE A;  2E00 A;  1KFF A;  3SLT A;  3QT4 A;  5CVO B;  5HA1 A;  3FA6 A;  3BSZ E;  5CE4 A;  2JU3 A;  2NP1 A;  3C9E A;  3EM0 A;  2WWP A;  4ES7 A;  1SRE A;  4ZHD A;  4IAB A;  3PHU A;  2OL6 O;  4XME A;  1OEJ A;  2R56 A;  2X56 A;  1F2B A;  1XCA A;  4I05 A;  4GGT A;  3MTV A;  4U9C A;  1SWL A;  4BX7 B;  4IMO A;  2DJG A;  3KZA A;  4HPD A;  4HPA A;  1VWM B;  3IFB A;  4AZR A;  5FFH A;  1QDQ A;  5K16 A;  3TMP A;  2R6N A;  4NNT A;  1JYJ A;  2I5V O;  3BX7 A;  4FGI B;  3PPT A;  2RTE B;  1VYF A;  1FJ1 E;  3RKG A;  3B21 A;  1SMP I;  1HXZ A;  2XU3 A;  1LKE A;  1SWF A;  4O3W A;  2VHS A;  2Y5B A;  3ERV A;  1BSQ A;  1NDJ A;  2QO4 A;  5FPW A;  3QSD A;  1RSU B;  3QKG A;  2AT3 X;  4O3X B;  1THE A;  2NNE A;  3WXG A;  3B2I A;  5H8T A;  2AVW A;  1S44 A;  2VFC A;  2W2B A;  5JR8 A;  1YZB A;  2C1Q A;  4P6E A;  3OVX A;  3FLL A;  1QQS A;  1SLF B;  2OYB O;  4XMD A;  1NBX A;  4AZN A;  1LDQ A;  2MHD A;  2A2G A;  5L3Y A;  1JJX A;  4RF1 A;  1KQW A;  2OY5 O;  5HZ6 A;  3IMA A;  4IAW A;  1U17 A;  1YWB A;  1JIW I;  3UEV A;  4XUI A;  4U8U O;  1PPD A;  1PPN A;  5LJK A;  4CDC A;  1XKG A;  4DQ3 A;  4D8B A;  4A1Y A;  5EPQ A;  1HMR A;  1SWK A;  1QG5 A;  1ERX A;  4ARH A;  3MOR A;  4ZTB A;  2A13 A;  3CBJ A;  4WBK A;  3U8E A;  4M0W A;  1MUP A;  4PAD A;  4XZX A;  2ACO A;  2G5L A;  2WQA E;  3EMM A;  2HYS A;  3EC5 A;  2HWK A;  2WEW A;  2DJF B;  4MZO A;  4REZ A;  1FTP A;  4GZV A;  1JJU A;  2QO6 A;  1SWP A;  3W31 A;  1X8P A;  4ZJ0 A;  3H3I A;  1HXL A;  3GCB A;  3ZUA A;  3T2X A;  4Y5D A;  2OL7 A;  2JW1 A;  1VYO A;  1LDO A;  1RST B;  1RBP A;  1D2U A;  4CPI A;  4PT5 A;  4I07 A;  2AT5 X;  1EWM A;  3EBK A;  1BQI A;  1BEB A;  4CDD B;  1AYV A;  2A0A A;  1G85 A;  1U9Q X;  3OE3 A;  1Y53 X;  3FA9 A;  2G6D A;  4YGG A;  1SWB A;  2FUD A;  2X8F A;  2GJ5 A;  3BOW A;  2L9C A;  2YJ9 A;  3FEP A;  3IEJ A;  4P6G A;  3FW5 A;  1LFO A;  1FE3 A;  2AT0 X;  1KOI A;  2RTQ B;  4RF0 A;  5FQ7 E;  1UKF A;  5F1E A;  4PP2 E;  5H9A A;  2LFO A;  2Q39 A;  2BU3 A;  3TGC A;  3CBS A;  1SWU A;  4YDB A;  2ALL X;  3V6C A;  3FMZ A;  3HWG A;  2FS7 A;  5AEO A;  2OFR X;  3D95 A;  3IUT A;  3ZW1 A;  5IRA A;  2G8E A;  2IZI A;  5HWZ A;  2WR6 A;  1AU0 A;  4I3D A;  1MS6 A;  2DZZ A;  4CPH A;  3WXF A;  3B2L A;  2CIO A;  2CB5 A;  4CPE A;  1KZX A;  3FA7 A;  4YYU A;  1S4V A;  2LA7 A;  2WEX A;  2RTG B;  4YYQ A;  4ZR2 A;  1BSY A;  5H9N A;  4ZCB A;  2YG2 A;  3FR5 A;  5B10 O;  4QNI A;  1EI5 A;  2BDZ A;  4MSX A;  1LPJ A;  3OBL A;  2ZAI A;  3P6E A;  2ACP X;  3S3Q A;  3ZI8 A;  1YIV A;  2FKJ A;  3VG3 A;  3OD9 A;  1KXO A;  3B79 A;  2Q2M A;  3UAQ A;  3Q6L A;  2FKG A;  3TF6 A;  4M6S A;  1BWY A;  1ADL A;  5J94 A;  3RY1 A;  1FDQ A;  3FYF A;  2JN3 A;  3KFG A;  3F75 A;  3H6S A;  1BBP A;  3OF8 A;  4MI7 A;  4FIP A;  3B2H A;  2A8G A;  5HAE A;  1YAL A;  4D6A A;  1YWC A;  1LUQ A;  4PSQ A;  2IZJ A;  2KT4 B;  1PAD A;  1URE A;  4ZHC A;  3NQK A;  3T6L A;  3G7X A;  5HTE A;  2IZA A;  3ELX A;  3PHW A;  1DC9 A;  4C5P A;  4BX5 A;  4NV8 A;  4OMW A;  1PCI A;  2FHN X;  3NQ9 A;  1D3S A;  4KC7 A;  4QRG A;  3KFH A;  4O3Y A;  4CZW A;  2RTJ A;  1ICN A;  5L8I A;  2DCD A;  1GKA B;  5JZE A;  3CQN A;  3K9M A;  4I6S A;  4QAE A;  2BDL A;  2VDF A;  4AYH A;  3CKF A;  1EIO A;  2JRI A;  1AU3 A;  1CPJ A;  2OF8 A;  3WJE A;  2NQI A;  2WSJ A;  1L6M A;  3QQ2 A;  2JGS A;  1KT3 A;  1EF7 A;  3FEK A;  1TOU A;  2MJI A;  2B1N A;  1KT5 A;  2IFB A;  3MP2 A;  2MF6 A;  3N91 A;  1OEK A;  1A6R A;  2K23 A;  1A3Y A;  2POA A;  4IB8 A;  3C76 X;  4BX6 A;  1ME3 A;  2VHF A;  4QRV A;  1MVG A;  5H9L A;  1HBQ A;  1BSO A;  2VFB A;  1RLB E;  1U9V A;  4IRW A;  3LHN A;  3RDS A;  2FT9 A;  3O65 A;  4X6H A;  4FBO A;  3BRN A;  1QY1 A;  3TNX A;  2FRQ A;  1VWN B;  2AYO A;  4U8U M;  3AI8 A;  3PP6 A;  1SWH A;  5L8O A;  3IV2 A;  4CDC B;  3JQO A;  3WXQ A;  3JSQ A;  3D96 A;  2G78 A;  4BJ8 A;  3AEH A;  3C77 X;  2AUZ A;  4GD9 A;  3CH2 X;  2N93 A;  3KSE A;  4O4U A;  2X55 A;  1LID A;  3P5W A;  3MBT A;  4BQV A;  1SY0 A;  3ZW0 B;  1CJ5 A;  1MDW A;  4KLB A;  2KTD A;  5HCE C;  2ZAG A;  3C0R A;  3CBC A;  4QZT A;  3WZN A;  1DF8 A;  2QOS C;  4DMY A;  1RXK A;  1Y9T A;  2L67 A;  1PXV A;  3OQC A;  1MEP A;  4U3Q A;  5CHV A;  3JS1 A;  1LIB A;  3P5X A;  3F8A A;  1SWR A;  2AGA A;  5CYB A;  2GTL N;  3D6S A;  3CBK A;  3RSW A;  1KFU L;  1VWO B;  1SY3 A;  4K19 A;  2XKL A;  1NQC A;  2M4L A;  1U18 A;  4ORR A;  2CZU A;  5F02 A;  2FQ9 A;  1IFC A;  4BPV A;  2RTH B;  2C4I A;  4RKX A;  3P6D A;  2F01 A;  5AJB A;  4BS6 A;  1SRG A;  2FT2 A;  4MVK A;  4MVE A;  4EXZ A;  2E4J A;  3SLJ A;  4ZH9 A;  1EPB A;  1I06 A;  4RUN A;  1BP4 A;  3P6F A;  2Y6E A; 
#chains in the Genus database with same CATH homology
 2IPP B;  2HHN A;  1X9Y A;  3RVV A;  4W5C A;  3BC3 A;  1NB5 A;  3IMA A;  1F29 A;  2E03 A;  4K7C A;  3IHP A;  1CTE A;  4XUI A;  3HHI A;  3D9W A;  1PPD A;  1PPN A;  1MEM A;  2ATO A;  2GHU A;  4CDC A;  1XKG A;  1K3B A;  2PNS A;  4I04 A;  4YYR A;  1K3B B;  2FYE A;  3F5V A;  1KFX L;  4MZS A;  1U9X A;  2E01 A;  3MOR A;  3KX1 A;  3CBJ A;  4N4Z A;  1W5R A;  2B1M A;  3U8E A;  4PAD A;  1AU4 A;  4BSQ A;  2BSZ A;  2DJF A;  1NLJ A;  1PE6 A;  4N8W A;  2DJF B;  4MZO A;  3O1G A;  3HHA A;  4WA6 A;  1VSN A;  1POP A;  2HH5 A;  1KHP A;  3GCB A;  3ZUA A;  1CB5 A;  1YK8 A;  1MHW A;  1STF E;  1KXR A;  5JA7 A;  1ITO A;  4CDE A;  3NHE A;  3PNR A;  4I07 A;  3MHH A;  4X6J A;  4CDE B;  1EWM A;  4CDD A;  1BQI A;  9PAP A;  3N3G A;  4CDD B;  2OUL A;  3OF9 A;  3BPM A;  1AYV A;  1F2C A;  2G7Y A;  2P0R A;  5A24 A;  3IOQ A;  2HD5 A;  5CHT A;  1GX3 A;  1U9Q X;  3LXS A;  2G6D A;  5CVN B;  1AIM A;  2FUD A;  3K8U A;  2R9F A;  5PAD A;  3RVX A;  3BCN A;  3BOW A;  2YJ9 A;  3IEJ A;  4P6G A;  3BWK A;  3H89 A;  1EWP A;  3PW3 A;  2C0Y A;  1CS8 A;  3LTW A;  4PP2 E;  2FRA A;  2G8J A;  4QBB A;  1NL6 A;  2P86 A;  2DC9 A;  4Q8H A;  3V6C A;  2FTD A;  1PBH A;  2DC6 A;  1NPZ A;  1YK7 A;  4Q8G A;  2XU5 A;  3IUT A;  2G8E A;  2DCA A;  1ZCM A;  1W4T A;  1AU0 A;  8PCH A;  2NQG A;  1MS6 A;  1IWD A;  1ATK A;  2DZZ A;  1QXP A;  3I3T A;  3USV A;  3QJ3 A;  3WXF A;  1PIP A;  2AYN A;  2CIO A;  2CB5 A;  1CJL A;  3N4C A;  4RY2 A;  4YYU A;  1S4V A;  4YYQ A;  4YYS A;  1Q6K A;  1AYW A;  1PPP A;  3H7D A;  1GLO A;  3KFQ A;  5EF4 A;  2BDZ A;  4MSX A;  1O0E A;  2P7U A;  2PRE A;  3I06 A;  3S3R A;  4G54 A;  1TLO A;  1PPO A;  2DZY A;  1U5I A;  3S3Q A;  1ZIV A;  2AIM A;  1AEC A;  4X6I A;  2NQA A;  5JH3 A;  2E02 A;  2OP3 A;  4OEL A;  3B79 A;  2GFO A;  1JQP A;  4YV8 A;  5J94 A;  4QRX A;  2AS8 A;  4N79 A;  1AYU A;  3F75 A;  3H6S A;  1BY8 A;  3OF8 A;  3KWB X;  1EWL A;  3RVW A;  4FIP A;  1YAL A;  2NQD B;  2WBF X;  2YJ8 A;  3H8B A;  1U9W A;  3PDF A;  1PAD A;  1Y08 A;  3P5U A;  1QMY A;  2FO5 A;  1NB3 A;  1VJV A;  4C5P A;  4NV8 A;  1FH0 A;  1Y4H A;  4FK5 A;  1PCI A;  2JQG R;  4OEM A;  2DC7 A;  2OZ2 A;  2AU1 A;  4QRG A;  7PCK A;  2F1G A;  4CZW A;  4ZUX U;  3WXE A;  4PI3 A;  2DCD A;  1AU2 A;  2R9M A;  2PAD A;  3K9M A;  2BDL A;  1SP4 B;  1MEG A;  1M6D A;  2DCB A;  4NV7 A;  1ME4 A;  1CPJ A;  1AU3 A;  3MTN A;  3K24 A;  2NQI A;  3DF0 A;  1MIR A;  2ARY A;  1EF7 A;  2B1N A;  4CDF A;  3OIS A;  2IBI A;  2R9N A;  4CDF B;  4B55 A;  1ICF A;  2ACT A;  1A6R A;  1KHQ A;  1TU6 A;  4PP1 A;  1ME3 A;  2XU4 A;  3P5V A;  2YJC A;  1EWO A;  1HUC B;  2VHF A;  4QRV A;  1DEU A;  3KKU A;  4DMX A;  1SNK A;  2JQF R;  2R9O A;  1GCB A;  2VFB A;  2YJ2 A;  1F2A A;  3PBH A;  2YJB A;  1U9V A;  4X6H A;  4BGF A;  4W5B A;  2DC8 A;  2XU1 A;  3E1Z B;  3TNX A;  2FRQ A;  1DF0 A;  2AYO A;  3AI8 A;  1YVB A;  3IV2 A;  2E00 A;  4CDC B;  3QT4 A;  1CQD A;  1E2T A;  5CVO B;  1W6F A;  2H7J A;  4XR7 A;  3H8C A;  1TL9 A;  3C9E A;  2AUZ A;  1CVZ A;  3KW9 A;  5EGW A;  3CH2 X;  3MHS A;  3KSE A;  1F2B A;  3P5W A;  4GUZ A;  4I05 A;  4BQV A;  4AXL A;  1MDW A;  1YT7 A;  4KLB A;  4YVA A;  4HWY A;  4W4U A;  2DCC A;  2DJG A;  5CVM A;  2DJG B;  4DMY A;  1QDQ A;  5K16 A;  1PXV A;  3CH3 X;  2R6N A;  5CHV A;  3O0U A;  4YYW A;  2R9C A;  1GEC E;  3V6E A;  3P5X A;  2O6X A;  2XU3 A;  1CSB B;  2HXZ A;  2F7D A;  3D6S A;  3CBK A;  3LFY A;  4YYV A;  1QOL A;  2VHS A;  1BGO A;  1KFU L;  2Y5B A;  3HWN A;  1NQC A;  3ERV A;  4QH6 A;  5FPW A;  3QSD A;  5F02 A;  3OVZ A;  2FQ9 A;  1THE A;  4BPV A;  3WXG A;  3KWZ A;  2AVW A;  2VFC A;  4AXM A;  3BPF A;  4BS6 A;  4BS5 A;  2AUX A;  3M99 A;  4P6E A;  2FT2 A;  3OVX A;  1CV8 A;  4FJC A;  6PAD A;  1GMY A;  3N3K A;  1BP4 A;  2PBH A;  3HD3 A;  2Y6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...