3PDFA

Discovery of novel cyanamide-based inhibitors of cathepsin c
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
441
structure length
351
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVFLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl peptidase 1
publication title Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
rcsb
source organism Homo sapiens
total genus 98
structure length 351
sequence length 441
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 3pdfA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pdfA02
2P7UA 3E1ZB 2YJBA 4FJCA 1KFUL 3RVXA 5JH3A 2WBFX 3MHHA 2R9OA 4KLBA 2IBIA 3P5XA 3BCNA 2AIMA 1NLJA 3TNXA 2Y6EA 4QH6A 4BS5A 3IMAA 4QRVA 3D6SA 1BY8A 3CH3X 1SP4B 3KX1A 2YJ9A 1GLOA 2VHFA 4YYUA 3AI8A 1ITOA 3LFYA 1Y08A 3N3GA 3H7DA 3S3QA 3BPFA 4YYSA 4YV8A 2FTDA 4DMYA 2OP3A 2AYNA 2CB5A 2DC7A 1PXVA 1M6DA 1EWOA 2DJGB 2FYEA 3H6SA 4Q8GA 4YVAA 2NQGA 3V6CA 2FRQA 3OVXA 3F75A 3OF8A 2PBHA 4AXMA 1POPA 1NPZA 3H8BA 1MHWA 3KSEA 2R9CA 3WXGA 2YJ8A 2ATOA 3WXEA 2Y5BA 3KW9A 1U9XA 2E00A 2H7JA 2FRAA 1KHQA 1F2BA 1FH0A 1PIPA 1A6RA 1X9YA 4CDEB 1K3BA 1GCBA 2PREA 3K24A 4FK5A 2FT2A 1YK8A 4PI3A 1IWDA 4XR7A 4BPVA 4YYRA 1VJVA 1ATKA 1CPJA 1ME3A 4MZSA 1QMYA 2DJFB 3MTNA 3OVZA 2NQAA 2G8JA 1CV8A 3KKUA 3HHIA 1AU0A 2DCAA 2NQIA 2G6DA 3PNRA 1GMYA 2FUDA 2VHSA 1THEA 1CSBB 3CH2X 2JQGR 1CB5A 2DC9A 4N4ZA 1TL9A 1TU6A 4X6HA 1QDQA 2GFOA 3P5UA 5CHVA 3QJ3A 1EWPA 4Q8HA 2GHUA 6PADA 1NB5A 4CDFB 3OF9A 1Y4HA 1EF7A 4W4UA 5CVMA 3RVVA 2G8EA 5PADA 2E03A 1YVBA 1U5IA 1AIMA 2BDZA 3OISA 4P6GA 1U9VA 1AYUA 2BDLA 5CVOB 2IPPB 2AS8A 3BC3A 4X6IA 4DMXA 1DF0A 3KWBX 4YYWA 1YT7A 1CTEA 1EWMA 4OELA 8PCHA 3BWKA 1QXPA 5JA7A 3BPMA 1PPOA 1ICFA 7PCKA 4ZUXU 5EF4A 4OEMA 2DJGA 1TLOA 2DZYA 1PCIA 2FO5A 2AVWA 4HWYA 4CDCB 3HWNA 1PPPA 2C0YA 3S3RA 2AUXA 3IEJA 3V6EA 1AU4A 3GCBA 4BQVA 3B79A 1Q6KA 2B1MA 4G54A 2R9FA 2FQ9A 4PADA 3MORA 3PDFA 2DC6A 5CVNB 4X6JA 3H89A 2P0RA 1PPNA 1MEMA 2R9NA 3KWZA 2CIOA 2AYOA 5K16A 5FPWA 3IUTA 1AECA 4CZWA 4MZOA 2AU1A 3WXFA 4CDEA 3O1GA 4K7CA 4MSXA 3BOWA 2DCCA 3KFQA 1PADA 1VSNA 4QRGA 4AXLA 2ARYA 4QBBA 1ME4A 3IHPA 2P86A 1YK7A 4YYVA 1KXRA 1PPDA 1SNKA 2DJFA 2F7DA 2HHNA 2NQDB 3M99A 3DF0A 3N4CA 3QT4A 1PBHA 2DCDA 2YJCA 1CS8A 2PNSA 3F5VA 1MDWA 1F29A 1NB3A 1BGOA 1EWLA 2HD5A 1AYVA 3P5WA 2DCBA 3NHEA 2R6NA 1STFE 3PW3A 3QSDA 1AU2A 5A24A 2E01A 1BP4A 1YALA 1NL6A 1PE6A 1AU3A 1ZIVA 2ACTA 2JQFR 1DEUA 2HXZA 4CDFA 3HD3A 1U9QX 4W5BA 1QOLA 1F2AA 4I05A 5CHTA 2XU4A 2G7YA 4CDDB 9PAPA 1GECE 2R9MA 3ZUAA 3RVWA 4RY2A 1CQDA 1HUCB 3MHSA 1KHPA 1S4VA 2F1GA 1CVZA 4N8WA 2XU5A 4PP2E 1F2CA 4CDDA 3C9EA 3IV2A 3I06A 2XU3A 2AUZA 1AYWA 3H8CA 4WA6A 3LXSA 1NQCA 2O6XA 4QRXA 4CDCA 1KFXL 1MIRA 4BS6A 5EGWA 4PP1A 4YYQA 2OZ2A 3CBJA 3P5VA 2E02A 3CBKA 3I3TA 3IOQA 1K3BB 3HHAA 5F02A 1XKGA 2PADA 2B1NA 3K8UA 4FIPA 4BSQA 4W5CA 2HH5A 2DC8A 2DZZA 1MEGA 4I07A 4P6EA 2YJ2A 3ERVA 1MS6A 4XUIA 3O0UA 3PBHA 1O0EA 1CJLA 3USVA 1JQPA 2OULA 1BQIA 4N79A 2XU1A 5J94A 3N3KA 3K9MA 1ZCMA 4I04A 3U8EA 1U9WA
chains in the Genus database with same CATH superfamily
4ZCBA 2RTIB 4O9SA 3AKMA 3E1ZB 2Y3FA 3RVXA 3SZIA 3TF6A 2QO5A 1QY2A 4AZNA 1K24A 4N7DA 5AEOA 1NLJA 1VWMB 2RTCB 4MEEA 2JOZA 4XMFA 2Y3EA 3VU1A 4U8UM 3WJGA 3WZNA 5F58A 3KX1A 5F7GA 3WJEA 2YJ9A 2VHFA 4YYUA 4NNTA 1X8QA 4EFGA 2JRIA 1ACDA 3FA9A 1OSPO 4CV7A 4YYSA 4O3YA 3VG5A 1LUQA 3CBCA 3FIQA 5B5GA 4YV8A 1X8NA 4CPEA 2OP3A 1HMRA 2AYNA 1KL3A 1PXVA 1EWOA 5F6ZA 4XMEA 3WYQA 2BS6A 2FRSA 3STKA 3H6SA 3D4RA 3D9WA 1ALBA 2FRQA 2IZKA 4QQ1A 3NQ9A 3OF8A 2A13A 4AXMA 4A60A 3H8BA 4ORUA 4O4OA 2BTWA 3RDXA 1BRQA 3U0DA 2OZQA 2X56A 2GC9A 4OS8A 2R9CA 3WXEA 4BX5B 1BSYA 3SZJA 4GNWA 2H7JA 1SWFA 4HPCA 1F2BA 1FH0A 2ZAGA 1KXOA 2X46A 5F2BA 1X9YA 1PBYA 3BRNA 2MM3A 2IZEB 1K3BA 4ON1A 4FK5A 4DCBA 3CMPA 4YCHA 2JU3A 1SWTA 1JJJA 2CBSA 4BPVA 1SWPA 2WSJA 2RD7C 1DZMA 2DJFB 3MTNA 2NNDA 3KKUA 1JV4A 4MVEA 1SRGA 4NLIA 2VHSA 1SWQA 2JQGR 3W30A 4BX6B 2RTDB 3F8AA 4GK9A 4A1YA 2X32A 4I60A 4MVLA 2OYBO 5JD2A 3KFFA 3PRMA 2Z84A 5F6BA 4BCSA 1AVDA 5D45A 2Z4HA 2AKQA 1VWQB 4YBUA 2M4LA 1JYJA 4I3BA 6PADA 4JNJA 4NV7A 2YG2A 4XMCA 1RXKA 2POAA 1S2PA 4GU8A 1HQPA 4ZHHA 4ZTBA 2J7QA 3RNVA 1XCAA 3FELA 3KQ0A 2WWPA 1EI5A 5HZ5A 4MVKA 4X6IA 4Z2OA 1YT7A 5CYBA 3P6HA 1QXPA 1VWIB 1ICFA 2OY1O 1LIDA 1TLOA 3P6EA 1RSUB 1PCIA 2ASNX 2FO5A 3TGCA 4HPDA 3PRPA 1NGLA 3EYCA 2C0YA 2QCBA 3V6EA 4NW4A 1ZNDA 1AU4A 4OVZB 4IB6A 4BQVA 1Q6KA 2R9FA 3MX7A 1ZNGA 4PADA 2A5BA 2P0RA 3T6LA 4IB9A 4CPFA 1PPNA 2CIOA 4TKBA 2I5VO 5K67A 1ZNLA 5C0NA 4WFUA 3FEPA 1UREA 1HN2A 3ZZVA 3FW5A 3WXFA 4TLJA 1GX8A 3O1GA 4K7CA 4NNSA 4WFVA 1CBIA 4O3WA 1PADA 3VPJE 2ARYA 4ZHCA 1OEKA 2KD2A 4C5PA 4BQUA 1KXRA 4EXZA 3ZWEA 2MWHA 1U0XA 4RUNA 4D6AA 2IFBA 2YJCA 2PNSA 2UZ2A 2C1QA 3GAQA 1G85A 1SREA 4UU3A 4D8EA 4BOSA 4I9SA 5BVSA 3NHEA 3RE6A 5A24A 1LF7A 1KZXA 4IRWA 1G74A 2RTKA 1TOWA 3FR4A 3HTYA 1JJUA 1VWPB 5JZEA 3VG7A 3VGWA 2HXZA 1SXWA 1KT7A 1IFCA 3VG3A 3FR5A 5IRUA 1F2AA 2FKJA 3TMPA 2XU4A 4CDDB 4KH8A 1E2TA 4FBOA 2FLJA 3RDOA 1SWOA 1SWHA 2CAMA 1S4VA 2L67A 1STPA 5FQ6E 2XU5A 4PP2E 3FEKA 4TQ2A 4GUZA 2KW1A 2W2FA 4EKVA 2AF5A 3KFHA 2G8CO 1SWEA 1ZNKA 4ML7B 1YP6A 3WJBA 1NQCA 4QRXA 4GJVA 5FAZA 1A2DA 1BSOA 1H91A 2Q2MA 2O62A 1MIRA 4M0WA 3QKGA 4BS6A 4L3RA 2OFBA 3PH5A 4YYQA 1YIVA 2JW1A 4BVMA 2ALLX 2HKDA 3K8UA 1SY3A 5FQ7E 2XSTA 4ZGFA 1YP7A 1VWFB 3BY0A 4AZRA 3E3CA 2Q39A 4I07A 2DM5A 1QG5A 1KOIA 3B2JA 1SWDA 1I78A 1JQPA 3FDCA 3OBLA 1N0SA 4INNA 4GDZA 1W6FA 3K9MA 1ZCMA 4Y0SA 3JQOA 2F01A 2P7UA 2QMIA 5IRWA 3WJCA 4TKHA 2BHVA 3ELXA 2WBFX 5JH3A 4YDBA 2PI3O 4HWMA 4GETA 4BGFA 4BOUA 4XMDA 4IAWA 4KLBA 2IBIA 3BCNA 1GKAA 2Y6EA 3IFUA 5B29A 3U03A 4M6SA 4D8IA 2IZDB 4ZHFA 1MOYA 3G7XA 5HTDA 5KIDA 1SP4B 2X4MA 2FWVA 1ADLA 1KQXA 3HWDA 5LKFA 2F73A 3BPFA 5LJGA 3IFBA 3NQ3A 4PT5A 3ELZA 2RN4A 1STSB 4YMYA 3NBXX 5LJBA 3VG4A 3RWXA 2FTBA 3ZW0B 2LBAA 2DC7A 2VDFA 1ZNEA 4GH7A 1GM6A 2DJGB 2FYEA 4CPHB 3FMZA 5FQ8E 3CWKA 1OPAA 5FFHA 4GGRA 1VWDB 1OPBA 1T8VA 2R73A 2WPUA 5HCEC 3I0AA 3S26A 1MHWA 3U9PC 4ZHDA 3WXGA 2YJ8A 3KW9A 3VHHA 1SLGB 3NP1A 4Y5DA 3B21A 4Z2VA 1GT3A 3RDQA 2UZJA 1YWBA 4CDEB 4EQAC 2OFRX 1IWDA 1SRJA 2RTOB 2KT4B 3HPEA 5B10O 1EALA 4YYRA 1QY0A 2MJIA 1XKIA 5D47A 1ATKA 4TJZA 5IO6A 1WBIA 1SY2A 2NQAA 3HHIA 1VPRA 2DCAA 2HZRA 2G6DA 2OFMX 3VHIA 1LCZA 1JIWI 4Y0RA 1ZRYA 2A2GA 1GMYA 1VWOB 3K3LA 4BJ8A 2RTPB 4ORRA 2HYSA 2L68A 1THEA 3VE1A 1CSBB 1P6PA 4I95A 1CB5A 4I3CA 4LKPA 5CSEA 4N4ZA 2GTLN 4ZH9A 4KT5A 5DG4A 3BSZE 3P5UA 2GFOA 2WR6A 3ZW1B 3HOLA 3OF9A 5K06A 4W4UA 2WEXA 4OKAA 1T68X 2G8EA 2E03A 5PADA 1YVBA 5D8JA 3ZI8A 1AIMA 4U3QA 1KT6A 4BOEA 1SLEB 1A18A 1AYUA 1NDJA 2RTEB 1DC9A 3PT2A 4I6SA 4ALBA 1N9YA 5CVOB 2RA6A 2IZAA 2NP1A 2AS8A 4DMXA 3EC5A 1YWDA 3WYPA 1DF0A 3KWBX 4YYWA 4O49A 2CZUA 4HXDB 1SRIA 8PCHA 3BWKA 1VWNB 1R0UA 2L9CA 3APWA 1NP4A 2HLVA 3MM0A 2RTMA 4XMGA 5HCCC 3KFIA 4DQ4A 2AUXA 3S3RA 3WZPA 3RDMA 1I04A 3RY2A 3GCBA 2WQAE 2DC6A 2AH7X 1EPAA 3PECA 5IO7A 5LJKA 3O19A 3E9SA 2RTAA 1SRHA 1HXLA 5HZ8A 1HMSA 2X8SA 5F1EA 3RZYA 1MK5A 3KVNA 4CZWA 3FW4A 3O2YA 1UYOX 1YWAA 1HBQA 5EEEA 1Y55X 2AT0X 2AU1A 3SAOA 3EM0A 1A57A 2DCCA 1VSNA 1FDQA 2WEWA 4QBBA 1ME4A 2EU7X 2Z4IA 1OBUA 4TKJA 2MF6A 3IA8A 2P86A 3TGAA 1PBOA 1B4MA 1QWDA 1HMTA 1PPDA 1SNKA 1SWJA 2F7DA 1L6MA 1LDOA 1IKEA 3M99A 3DF0A 4MI7A 2DCDA 2OF9A 3O22A 3F5VA 1MDWA 1T0VA 1SLFB 1F29A 1E02A 5LJDA 2ZAIA 1ICMA 1RSTB 2HD5A 2Y32A 2R6NA 3PW3A 4FBRA 3HOEA 4YGZA 1AU2A 1X8OA 2RTJA 3WBGA 4D6BA 1SWUA 4WBKA 1S44A 1IKJA 2PY1A 1FENA 2ACTA 5B11O 2JQFR 3NADA 1HXZA 4YKMA 1DZKA 2IZHB 4CDFA 4P16A 1PM1X 4W5BA 1FE3A 3JSQA 1O1UA 1VWBB 1UZ2X 3PSEA 4AZMA 1CQDA 4RY2A 1HUCB 2RTFB 1O1VA 4N8WA 4ZGUA 5KO3A 3UEVA 1F2CA 4CDDA 1IW2A 1OEEA 3F9DA 3B2KA 3C9EA 2RTLA 3IV2A 2GTFX 2XU3A 2AUZA 4BX7A 2IZLB 2BTWB 3H8CA 3BBAA 2Q9SA 3UEUA 2LKKA 3HK1A 2IZBA 3FA8A 3SOTA 2FHLA 1S7DA 3LXSA 2O6XA 4RKXA 4TNNA 4CDCA 3P6DA 1X71A 3FIDA 3RDUA 2RQ0A 1B0OA 5EGWA 1KT3A 4B55A 2A2UA 5BYPA 4ORSA 5BVTA 2E02A 3CBKA 5HZ6A 2UYWA 3IOQA 1LCVA 1K3BB 1XKGA 3Q6LA 4FIPA 4OS0A 2QO4A 1LIFA 2HH5A 1G5WA 2X45A 2OL8O 1VWJB 3BS2A 2ZSCA 4A8ZA 2F09A 2FS7A 5HA0A 3PHUA 3FENA 4KC7A 3ERVA 4XUIA 3LHNA 5IRAA 4QGXA 2N93A 4GGZA 1CJLA 4RUUA 1KL4A 2IZFB 1X8PA 4OS3A 1LPJA 3BU1A 3U8EA 4W5CA 1JZUA 4FJCA 2CBRA 1KFUL 1SXXA 2JN3A 2ANSA 4RF1A 1Y53X 2LA7A 2R9OA 4R0BA 4Z6JA 2W2AA 1VWCB 1AELA 3STMX 2AIMA 1IIUA 1SA8A 4ZHGA 1JJXA 4QH6A 3UEWA 2OVEA 2CM9A 4BS5A 5K68A 3IMAA 4QRVA 3D6SA 1SWAA 1BY8A 3LV4A 1O8VA 1JYDA 1KGLA 3ZNHA 1GLOA 4XMHA 2JU8A 3AI8A 4Y59A 3LFYA 3D96A 1WUBA 4ODDA 4O3ZA 3Q34A 3H7DA 1VWLB 3S3QA 2WUTA 1OBQA 1BRPA 3PEDA 2RCQA 4FQBB 3C76X 3WVMA 3EBKA 2FTDA 1RXJA 4DMYA 1GT5A 2J7QC 4CPIA 5LJCA 1SWSA 2QOSC 3ZUOA 4GRJA 3AUMO 1M6DA 2NNQA 1RLBE 1HQQA 1DKIA 4Q8GA 4NP1A 2GH7A 3CQNA 3OVXA 2KTDA 5LJHA 3V8UA 2PBHA 4ID2A 1N7YA 4LQZA 4O4XA 1NPZA 4YKOA 4KC8A 1DZPA 4DQ3A 2G78A 2FR2A 1LIEA 2ATOA 2MHDA 4JHQA 5B5FA 2HWKA 1D3SA 1SWBA 4ORXA 3RE5A 2E00A 2IZGB 3VG6A 2QOMA 3EMMA 3NX1A 1OEJA 4QGVA 4HFOA 3EW2A 2DOSA 4ZH6A 5L8NA 5AJBA 4ALOA 3K24A 2FT2A 1YK8A 5HWZA 3BLGA 2RTHB 2YMSA 3QQ2A 3EBWA 2RTBB 1GT1A 2JU7A 1NQMA 5HBSA 1CPJA 1ME3A 1BBPA 4FGIB 3DSZA 3OVZA 2OVAA 2NQIA 3PNRA 2FS6A 4QZUA 2AVIA 2FUDA 5DPQA 3W31A 1GGLA 4U8UN 4U46A 1FEMA 3NR3A 4YFQA 1CBRA 4O4UA 1DF8A 2R74A 2IZIA 1TU6A 4X6HA 2MO5A 1SMPI 4PJ2A 4GNYA 4QNIA 2X8FA 1QDQA 3QJ3A 4GD9A 3D97A 2AT5X 4Q8HA 4AZOA 1NB5A 1Y4HA 1I05A 3KFGA 3BX8A 2LBVA 2K23A 1EIIA 3ZW1A 2FKGA 2BDZA 4I9RA 3S60A 3OISA 4OMXA 4Z27A 2CZTA 2AL0X 3RBYA 2FE8A 2BDLA 4YGHA 5EZ2A 3EW1A 1PTSA 3TGBA 4KIIA 3VE2A 4AZPA 3BC3A 1SXUA 5H9LA 4ZFXA 1RXHA 3APXA 1EWMA 4OELA 5HA1A 4LKTA 2RTQB 3BPMA 1PPOA 1LFOA 1LICA 4OEMA 3O65A 4MISA 4HWYA 1LNMA 4O3XB 2FGSA 3HWNA 2OF8A 1JMXA 3N91A 1PPPA 3IEJA 2GTLO 2LB6A 1Y52X 3D95A 4CK4A 5EEDA 2R56A 3B79A 2B1MA 2FQ9A 5AJCA 3MORA 3MP2A 3SZHA 1RBPA 5CVNB 4GGTA 1SY1A 3H89A 4BX5A 4U9CA 1B56A 1MEMA 2R9NA 3KWZA 5K16A 1VWAB 5FPWA 3B2HA 2QO6A 1BJ7A 4NV8A 3NX2A 4R3DA 1AECA 2A3FX 1TOUA 4Z2PA 3OJYC 4YFRA 1YZBA 4IP3A 3BOWA 3OD9A 2C1SA 3KFQA 2QM9A 4QRGA 3APVA 1QABE 3FA6A 3IHPA 4RF0A 1YK7A 2OVDA 4GUAA 2DJFA 2E4JA 2HHNA 4O4SA 2NQDB 3QT4A 1PBHA 1NQNA 4QAEA 1GKAB 1X89A 3PQUA 1DZJA 1NB3A 4YBPA 2AT8X 4YH0A 1EWLA 2X8TA 3P5WA 1X8UA 4BX6A 5HZ9A 3PQSA 3C78X 1STFE 4M7MA 5D4AA 2XKLA 4GDAA 4KCAA 4LZVA 2E01A 2JMBA 4QYNA 1YALA 1PE6A 3VHMA 1AU3A 1ZIVA 1EW3A 1CJ5A 1FTPA 4NYRA 1DFVA 3OE3A 3HD3A 1U9QX 4IAXA 1QOLA 1HY2A 2A8GA 3MVFA 4I05A 2X34A 1BSQA 1ZNHA 2AT3X 3F6ZB 9PAPA 1GECE 3ZUAA 3DTQA 3BX7A 3MHSA 1KHPA 1CBQA 1CVZA 1VYGA 4HPBA 3OQCA 4BOQA 1GXAA 5CE4A 4IMOA 1Z24A 3I06A 3B2LA 3MBTA 3WZQA 1UKFA 1LELA 4NYQA 3SLTA 3PK2A 3T2WA 4I3DA 5L8IA 1NP1A 1SLDB 2VFCA 3NQKA 3RKGA 4BOPA 2BT9A 4OVZA 2IZJA 3CBJA 2G5LA 1W4TA 3I3TA 3HHAA 2JGSA 5EPQA 4CSBA 3RSWA 2B1NA 2PADA 4GKCA 4YDAA 4COTA 3P6CA 2DZZA 3WJDA 3FYFA 3P6FA 1B8EA 1VWGB 1LIBA 4IBAA 3PH6A 1O0EA 3T1DA 1CBSA 3NPOA 1KT5A 1BQIA 4AYHA 3BB7A 3N3KA 1NBXA 5KHPA 3H3IA 5HCDC 4I04A 2WQ9A 4WHIA 1U9WA 4IABA 3CKFA 3WZOA 5HZQA 2YJBA 1PMPA 3MHHA 4OMWA 3RY1A 5H8TA 1PVJA 1W5RA 1Y0GA 3P5XA 2OL7A 3TNXA 4A1HA 1EQDA 1QQSA 3P02A 5EDBA 3I17A 1FELA 3T2XA 1SWKA 2HMBA 1VWKB 4Y0PA 3CH3X 1IFBA 4WURA 1TXLA 1VYOA 3BDRA 5EZQA 2GTLM 3TZSA 1DF3A 1ITOA 4IB8A 3SLJA 2JTCA 1Y08A 2C4IA 3N3GA 4BOZA 2I5ZO 1LCWA 1YUPA 5CHKA 1TVQA 1GX9A 4FBVA 2FR3A 1I9HA 1U18A 5B3MO 1N4JA 5L8OA 1ERBA 2L5PA 1QFVA 4OW0A 2CB5A 5IXGA 1YWCA 4QRLA 4YVBA 1OBPA 1D2UA 4K19A 1NC9A 4RNAA 4YVAA 2NQGA 5BVQA 3SLOA 3V6CA 3F75A 1SWRA 1MX7A 1E00A 1POPA 1A3YA 2BU3A 2AGAA 2ACPX 4YFPA 3APUA 2K62A 3GE2A 4IMNA 3KSEA 1TW4A 3L4RA 2Y5BA 1U9XA 1U17A 4QYPA 4Z28A 2FRAA 1KHQA 2BC3A 1PIPA 4A5UA 1A6RA 3FR2A 1N43A 3FLLA 3UAQA 5KICA 3UEXA 1GCBA 2PREA 4ORYA 4PI3A 1LKEA 5AQ6A 1DV9A 4XR7A 5H9NA 4ES7A 4N7CA 4ORWA 4QZTA 1VJVA 1AVEA 1JMZA 5IO5A 3MG5A 4MZSA 1QMYA 3PHXA 5EZSA 1SRFA 1G7NA 2G8JA 1CV8A 1AU0A 2FHNX 4UU2A 1EPBA 1PEEA 4IB7A 3AEHA 3CH2X 3CQRA 3MTVA 2DC9A 3CR6A 4HPAA 1BEBA 1TL9A 5D48A 5H9AA 1HBPA 5CHVA 2RTGB 4ZR2A 1EWPA 2OVSA 2W2BA 2GHUA 1Y9LA 4CDFB 1E06A 1EF7A 5CVMA 2A0AA 3RVVA 5B27A 1U5IA 1ML7A 4XZXA 1BLRA 4P6GA 1U9VA 2HNXA 3ZUIA 4GJSA 2OY8A 4D8BA 1UYNX 2FT9A 2IPPB 2RCTA 4LZUA 1MDCA 5E6JA 3KZAA 4NLJA 1VWEB 1LDQA 1MM9A 1CTEA 3ZW0A 4BX7B 5JA7A 2G79A 1MVGA 2ACOA 5EF4A 7PCKA 4ZUXU 2DJGA 4CPHA 3FA7A 2DZYA 3P6GA 1BWYA 3ZQ3A 2OY5O 2AVWA 4U8UO 4CDCB 1SWGA 4EDEA 5LJEA 3S5VA 1I06A 1SXYA 3B2IA 3PPTA 4G54A 5H9KA 2OL6O 2GJ5A 2BS5A 3PDFA 5JR8A 4REZA 4X6JA 2OY7A 3HWFA 1KZWA 2AYOA 1FJ1E 1MX8A 1EIOA 2Q4NA 3IUTA 3WOVA 4MZOA 3X00A 1Y9TA 1AQBA 2LFOA 4CDEA 4GZVA 3AKNA 4MSXA 3BU9A 1VWRB 5EDCA 4AXLA 2A5CA 3P24A 1ERXA 3WJFA 4YYVA 2OFAA 1AB0A 3N4CA 4ZJ0A 4EEJA 3VG2A 2KTSA 5L3YA 1CS8A 1GX3A 1QFTA 5HTEA 1BGOA 1AYVA 2DCBA 1IJ8A 1SY0A 2G7BA 3QSDA 3STNA 2BLGA 1BP4A 1NL6A 2NNEA 1KFFA 2IZCB 1KT4A 1DEUA 1BM5A 1ICNA 3T6FA 1MEPA 2AT6X 3TRKA 5CHTA 2AMMX 1GT4A 4AW8A 2G7YA 4PSQA 1EXSA 2R9MA 3HWEA 3RVWA 3MJ5A 2F1GA 4Y0QA 1CRBA 4YGGA 3RDSA 4IUMA 1JBHA 1MUPA 4ARHA 3WXQA 2VFBA 2HZQA 4GE1A 3C0RA 2RTRB 1VYFA 1QY1A 4L1NA 1AYWA 1SWLA 4WA6A 4QGWA 3LTWA 4AZQA 4BBOA 4MVIA 1SWNA 3C77X 4MM3B 1KFXL 1EUOA 4YCEA 1SWCA 2Q2PA 3CKGA 1KL5A 1AVGI 4PP1A 1E5PA 2OZ2A 2BSZA 3P5VA 5F02A 3S5XA 3ZW2A 4BSQA 1I4UA 2P8GA 2DC8A 5B2AO 1VWHB 4JGLA 3JS1A 1MEGA 4P6EA 2YJ2A 1MS6A 1RAVA 1STRB 3O0UA 2CM4A 2X55A 3PBHA 5FENA 3PP6A 3USVA 1N9MA 3HWGA 2OULA 1KQWA 2RTNB 4N79A 2XU1A 3PHWA 5J94A 4MIRA 3BY4A 4DNEA 5LKEA 4JO6A 5HAEA 3CBSA
chains in the Genus database with same CATH topology
2P7UA 3E1ZB 2YJBA 4FJCA 1KFUL 3RVXA 5JH3A 2WBFX 3MHHA 4BGFA 1W5RA 2R9OA 4KLBA 2IBIA 3P5XA 3BCNA 2AIMA 1NLJA 3TNXA 2Y6EA 4QH6A 4BS5A 3IMAA 4QRVA 3D6SA 1BY8A 3CH3X 1SP4B 3KX1A 2YJ9A 1GLOA 2VHFA 4YYUA 3AI8A 1ITOA 3LFYA 1Y08A 3N3GA 3H7DA 3S3QA 3BPFA 4YYSA 4YV8A 2FTDA 4DMYA 2OP3A 2AYNA 2CB5A 2DC7A 1PXVA 1M6DA 1EWOA 2DJGB 2FYEA 3H6SA 4Q8GA 4YVAA 2NQGA 3D9WA 3V6CA 2FRQA 3OVXA 3F75A 3OF8A 2PBHA 4AXMA 1POPA 1NPZA 3H8BA 1MHWA 3KSEA 2R9CA 3WXGA 2YJ8A 2ATOA 3WXEA 2Y5BA 3KW9A 1U9XA 2E00A 2H7JA 2FRAA 1KHQA 1F2BA 1FH0A 1PIPA 1A6RA 1X9YA 4CDEB 1K3BA 1GCBA 2PREA 3K24A 4FK5A 2FT2A 1YK8A 4PI3A 1IWDA 4XR7A 4BPVA 4YYRA 1VJVA 1ATKA 1CPJA 1ME3A 4MZSA 1QMYA 2DJFB 3MTNA 3OVZA 2NQAA 2G8JA 1CV8A 3KKUA 3HHIA 1AU0A 2DCAA 2NQIA 2G6DA 3PNRA 1GMYA 2FUDA 2VHSA 1THEA 1CSBB 3CH2X 2JQGR 1CB5A 2DC9A 4N4ZA 1TL9A 1TU6A 4X6HA 1QDQA 2GFOA 3P5UA 5CHVA 3QJ3A 1EWPA 4Q8HA 2GHUA 6PADA 1NB5A 4CDFB 3OF9A 1Y4HA 1EF7A 4NV7A 4W4UA 5CVMA 3RVVA 2G8EA 5PADA 2E03A 1YVBA 1U5IA 1AIMA 2BDZA 3OISA 4P6GA 1U9VA 1AYUA 2BDLA 5CVOB 2IPPB 2AS8A 3BC3A 4X6IA 4DMXA 1DF0A 3KWBX 4YYWA 1YT7A 1CTEA 1EWMA 4OELA 8PCHA 3BWKA 1QXPA 5JA7A 3BPMA 1PPOA 1ICFA 7PCKA 4ZUXU 5EF4A 4OEMA 2DJGA 1TLOA 2DZYA 1PCIA 2FO5A 2AVWA 4HWYA 4CDCB 3HWNA 1PPPA 2C0YA 3S3RA 2AUXA 3IEJA 3V6EA 1AU4A 3GCBA 4BQVA 3B79A 1Q6KA 2B1MA 4G54A 2R9FA 2FQ9A 4PADA 3MORA 3PDFA 2DC6A 5CVNB 4X6JA 3H89A 2P0RA 1PPNA 1MEMA 2R9NA 3KWZA 2CIOA 2AYOA 5K16A 5FPWA 4NV8A 3IUTA 1AECA 4CZWA 4MZOA 2AU1A 3WXFA 4CDEA 3O1GA 4K7CA 4MSXA 3BOWA 2DCCA 3KFQA 1PADA 1VSNA 4QRGA 4AXLA 2ARYA 4QBBA 1ME4A 3IHPA 2P86A 1YK7A 4C5PA 4YYVA 1KXRA 1PPDA 1SNKA 2DJFA 2F7DA 2HHNA 2NQDB 3M99A 3DF0A 3N4CA 3QT4A 1PBHA 2DCDA 2YJCA 1CS8A 2PNSA 1GX3A 3F5VA 1MDWA 1F29A 1NB3A 1BGOA 1EWLA 2HD5A 1AYVA 3P5WA 2DCBA 3NHEA 2R6NA 1STFE 3PW3A 3QSDA 1AU2A 5A24A 2E01A 1BP4A 1YALA 1NL6A 1PE6A 1AU3A 1ZIVA 2ACTA 2JQFR 1DEUA 2HXZA 4CDFA 3HD3A 1U9QX 4W5BA 1QOLA 1F2AA 4I05A 5CHTA 2XU4A 2G7YA 4CDDB 9PAPA 1GECE 1E2TA 2R9MA 3ZUAA 3RVWA 4RY2A 1CQDA 1HUCB 3MHSA 1KHPA 1S4VA 2F1GA 1CVZA 4N8WA 2XU5A 4PP2E 1F2CA 4CDDA 4GUZA 3C9EA 2VFBA 3IV2A 3I06A 2XU3A 2AUZA 1AYWA 3H8CA 4WA6A 3LTWA 3LXSA 1NQCA 2O6XA 4QRXA 4CDCA 1KFXL 1MIRA 4BS6A 2VFCA 5EGWA 4PP1A 4B55A 4YYQA 2OZ2A 3CBJA 2BSZA 1W4TA 3P5VA 2E02A 3CBKA 3I3TA 3IOQA 1K3BB 3HHAA 5F02A 1XKGA 2PADA 2B1NA 3K8UA 4FIPA 4BSQA 4W5CA 2HH5A 2DC8A 2DZZA 1MEGA 4I07A 4P6EA 2YJ2A 3ERVA 1MS6A 4XUIA 3O0UA 3PBHA 1O0EA 1CJLA 3USVA 1JQPA 2OULA 1BQIA 4N79A 2XU1A 5J94A 3N3KA 1W6FA 3K9MA 1ZCMA 4I04A 3U8EA 1U9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7U A;  3E1Z B;  2YJB A;  4FJC A;  1KFU L;  3RVX A;  5JH3 A;  2WBF X;  3MHH A;  2R9O A;  4KLB A;  2IBI A;  3P5X A;  3BCN A;  2AIM A;  1NLJ A;  3TNX A;  2Y6E A;  4QH6 A;  4BS5 A;  3IMA A;  4QRV A;  3D6S A;  1BY8 A;  3CH3 X;  1SP4 B;  3KX1 A;  2YJ9 A;  1GLO A;  2VHF A;  4YYU A;  3AI8 A;  1ITO A;  3LFY A;  1Y08 A;  3N3G A;  3H7D A;  3S3Q A;  3BPF A;  4YYS A;  4YV8 A;  2FTD A;  4DMY A;  2OP3 A;  2AYN A;  2CB5 A;  2DC7 A;  1PXV A;  1M6D A;  1EWO A;  2DJG B;  2FYE A;  3H6S A;  4Q8G A;  4YVA A;  2NQG A;  3V6C A;  2FRQ A;  3OVX A;  3F75 A;  3OF8 A;  2PBH A;  4AXM A;  1POP A;  1NPZ A;  3H8B A;  1MHW A;  3KSE A;  2R9C A;  3WXG A;  2YJ8 A;  2ATO A;  3WXE A;  2Y5B A;  3KW9 A;  1U9X A;  2E00 A;  2H7J A;  2FRA A;  1KHQ A;  1F2B A;  1FH0 A;  1PIP A;  1A6R A;  1X9Y A;  4CDE B;  1K3B A;  1GCB A;  2PRE A;  3K24 A;  4FK5 A;  2FT2 A;  1YK8 A;  4PI3 A;  1IWD A;  4XR7 A;  4BPV A;  4YYR A;  1VJV A;  1ATK A;  1CPJ A;  1ME3 A;  4MZS A;  1QMY A;  2DJF B;  3MTN A;  3OVZ A;  2NQA A;  2G8J A;  1CV8 A;  3KKU A;  3HHI A;  1AU0 A;  2DCA A;  2NQI A;  2G6D A;  3PNR A;  1GMY A;  2FUD A;  2VHS A;  1THE A;  1CSB B;  3CH2 X;  2JQG R;  1CB5 A;  2DC9 A;  4N4Z A;  1TL9 A;  1TU6 A;  4X6H A;  1QDQ A;  2GFO A;  3P5U A;  5CHV A;  3QJ3 A;  1EWP A;  4Q8H A;  2GHU A;  6PAD A;  1NB5 A;  4CDF B;  3OF9 A;  1Y4H A;  1EF7 A;  4W4U A;  5CVM A;  3RVV A;  2G8E A;  5PAD A;  2E03 A;  1YVB A;  1U5I A;  1AIM A;  2BDZ A;  3OIS A;  4P6G A;  1U9V A;  1AYU A;  2BDL A;  5CVO B;  2IPP B;  2AS8 A;  3BC3 A;  4X6I A;  4DMX A;  1DF0 A;  3KWB X;  4YYW A;  1YT7 A;  1CTE A;  1EWM A;  4OEL A;  8PCH A;  3BWK A;  1QXP A;  5JA7 A;  3BPM A;  1PPO A;  1ICF A;  7PCK A;  4ZUX U;  5EF4 A;  4OEM A;  2DJG A;  1TLO A;  2DZY A;  1PCI A;  2FO5 A;  2AVW A;  4HWY A;  4CDC B;  3HWN A;  1PPP A;  2C0Y A;  3S3R A;  2AUX A;  3IEJ A;  3V6E A;  1AU4 A;  3GCB A;  4BQV A;  3B79 A;  1Q6K A;  2B1M A;  4G54 A;  2R9F A;  2FQ9 A;  4PAD A;  3MOR A;  3PDF A;  2DC6 A;  5CVN B;  4X6J A;  3H89 A;  2P0R A;  1PPN A;  1MEM A;  2R9N A;  3KWZ A;  2CIO A;  2AYO A;  5K16 A;  5FPW A;  3IUT A;  1AEC A;  4CZW A;  4MZO A;  2AU1 A;  3WXF A;  4CDE A;  3O1G A;  4K7C A;  4MSX A;  3BOW A;  2DCC A;  3KFQ A;  1PAD A;  1VSN A;  4QRG A;  4AXL A;  2ARY A;  4QBB A;  1ME4 A;  3IHP A;  2P86 A;  1YK7 A;  4YYV A;  1KXR A;  1PPD A;  1SNK A;  2DJF A;  2F7D A;  2HHN A;  2NQD B;  3M99 A;  3DF0 A;  3N4C A;  3QT4 A;  1PBH A;  2DCD A;  2YJC A;  1CS8 A;  2PNS A;  3F5V A;  1MDW A;  1F29 A;  1NB3 A;  1BGO A;  1EWL A;  2HD5 A;  1AYV A;  3P5W A;  2DCB A;  3NHE A;  2R6N A;  1STF E;  3PW3 A;  3QSD A;  1AU2 A;  5A24 A;  2E01 A;  1BP4 A;  1YAL A;  1NL6 A;  1PE6 A;  1AU3 A;  1ZIV A;  2ACT A;  2JQF R;  1DEU A;  2HXZ A;  4CDF A;  3HD3 A;  1U9Q X;  4W5B A;  1QOL A;  1F2A A;  4I05 A;  5CHT A;  2XU4 A;  2G7Y A;  4CDD B;  9PAP A;  1GEC E;  2R9M A;  3ZUA A;  3RVW A;  4RY2 A;  1CQD A;  1HUC B;  3MHS A;  1KHP A;  1S4V A;  2F1G A;  1CVZ A;  4N8W A;  2XU5 A;  4PP2 E;  1F2C A;  4CDD A;  3C9E A;  3IV2 A;  3I06 A;  2XU3 A;  2AUZ A;  1AYW A;  3H8C A;  4WA6 A;  3LXS A;  1NQC A;  2O6X A;  4QRX A;  4CDC A;  1KFX L;  1MIR A;  4BS6 A;  5EGW A;  4PP1 A;  4YYQ A;  2OZ2 A;  3CBJ A;  3P5V A;  2E02 A;  3CBK A;  3I3T A;  3IOQ A;  1K3B B;  3HHA A;  5F02 A;  1XKG A;  2PAD A;  2B1N A;  3K8U A;  4FIP A;  4BSQ A;  4W5C A;  2HH5 A;  2DC8 A;  2DZZ A;  1MEG A;  4I07 A;  4P6E A;  2YJ2 A;  3ERV A;  1MS6 A;  4XUI A;  3O0U A;  3PBH A;  1O0E A;  1CJL A;  3USV A;  1JQP A;  2OUL A;  1BQI A;  4N79 A;  2XU1 A;  5J94 A;  3N3K A;  3K9M A;  1ZCM A;  4I04 A;  3U8E A;  1U9W A; 
#chains in the Genus database with same CATH topology
 4ZCB A;  2RTI B;  4O9S A;  3AKM A;  3E1Z B;  2Y3F A;  3RVX A;  3SZI A;  3TF6 A;  2QO5 A;  1QY2 A;  4AZN A;  1K24 A;  4N7D A;  5AEO A;  1NLJ A;  1VWM B;  2RTC B;  4MEE A;  2JOZ A;  4XMF A;  2Y3E A;  3VU1 A;  4U8U M;  3WJG A;  3WZN A;  5F58 A;  3KX1 A;  5F7G A;  3WJE A;  2YJ9 A;  2VHF A;  4YYU A;  4NNT A;  1X8Q A;  4EFG A;  2JRI A;  1ACD A;  3FA9 A;  1OSP O;  4CV7 A;  4YYS A;  4O3Y A;  3VG5 A;  1LUQ A;  3CBC A;  3FIQ A;  5B5G A;  4YV8 A;  1X8N A;  4CPE A;  2OP3 A;  1HMR A;  2AYN A;  1KL3 A;  1PXV A;  1EWO A;  5F6Z A;  4XME A;  3WYQ A;  2BS6 A;  2FRS A;  3STK A;  3H6S A;  3D4R A;  3D9W A;  1ALB A;  2FRQ A;  2IZK A;  4QQ1 A;  3NQ9 A;  3OF8 A;  2A13 A;  4AXM A;  4A60 A;  3H8B A;  4ORU A;  4O4O A;  2BTW A;  3RDX A;  1BRQ A;  3U0D A;  2OZQ A;  2X56 A;  2GC9 A;  4OS8 A;  2R9C A;  3WXE A;  4BX5 B;  1BSY A;  3SZJ A;  4GNW A;  2H7J A;  1SWF A;  4HPC A;  1F2B A;  1FH0 A;  2ZAG A;  1KXO A;  2X46 A;  5F2B A;  1X9Y A;  1PBY A;  3BRN A;  2MM3 A;  2IZE B;  1K3B A;  4ON1 A;  4FK5 A;  4DCB A;  3CMP A;  4YCH A;  2JU3 A;  1SWT A;  1JJJ A;  2CBS A;  4BPV A;  1SWP A;  2WSJ A;  2RD7 C;  1DZM A;  2DJF B;  3MTN A;  2NND A;  3KKU A;  1JV4 A;  4MVE A;  1SRG A;  4NLI A;  2VHS A;  1SWQ A;  2JQG R;  3W30 A;  4BX6 B;  2RTD B;  3F8A A;  4GK9 A;  4A1Y A;  2X32 A;  4I60 A;  4MVL A;  2OYB O;  5JD2 A;  3KFF A;  3PRM A;  2Z84 A;  5F6B A;  4BCS A;  1AVD A;  5D45 A;  2Z4H A;  2AKQ A;  1VWQ B;  4YBU A;  2M4L A;  1JYJ A;  4I3B A;  6PAD A;  4JNJ A;  4NV7 A;  2YG2 A;  4XMC A;  1RXK A;  2POA A;  1S2P A;  4GU8 A;  1HQP A;  4ZHH A;  4ZTB A;  2J7Q A;  3RNV A;  1XCA A;  3FEL A;  3KQ0 A;  2WWP A;  1EI5 A;  5HZ5 A;  4MVK A;  4X6I A;  4Z2O A;  1YT7 A;  5CYB A;  3P6H A;  1QXP A;  1VWI B;  1ICF A;  2OY1 O;  1LID A;  1TLO A;  3P6E A;  1RSU B;  1PCI A;  2ASN X;  2FO5 A;  3TGC A;  4HPD A;  3PRP A;  1NGL A;  3EYC A;  2C0Y A;  2QCB A;  3V6E A;  4NW4 A;  1ZND A;  1AU4 A;  4OVZ B;  4IB6 A;  4BQV A;  1Q6K A;  2R9F A;  3MX7 A;  1ZNG A;  4PAD A;  2A5B A;  2P0R A;  3T6L A;  4IB9 A;  4CPF A;  1PPN A;  2CIO A;  4TKB A;  2I5V O;  5K67 A;  1ZNL A;  5C0N A;  4WFU A;  3FEP A;  1URE A;  1HN2 A;  3ZZV A;  3FW5 A;  3WXF A;  4TLJ A;  1GX8 A;  3O1G A;  4K7C A;  4NNS A;  4WFV A;  1CBI A;  4O3W A;  1PAD A;  3VPJ E;  2ARY A;  4ZHC A;  1OEK A;  2KD2 A;  4C5P A;  4BQU A;  1KXR A;  4EXZ A;  3ZWE A;  2MWH A;  1U0X A;  4RUN A;  4D6A A;  2IFB A;  2YJC A;  2PNS A;  2UZ2 A;  2C1Q A;  3GAQ A;  1G85 A;  1SRE A;  4UU3 A;  4D8E A;  4BOS A;  4I9S A;  5BVS A;  3NHE A;  3RE6 A;  5A24 A;  1LF7 A;  1KZX A;  4IRW A;  1G74 A;  2RTK A;  1TOW A;  3FR4 A;  3HTY A;  1JJU A;  1VWP B;  5JZE A;  3VG7 A;  3VGW A;  2HXZ A;  1SXW A;  1KT7 A;  1IFC A;  3VG3 A;  3FR5 A;  5IRU A;  1F2A A;  2FKJ A;  3TMP A;  2XU4 A;  4CDD B;  4KH8 A;  1E2T A;  4FBO A;  2FLJ A;  3RDO A;  1SWO A;  1SWH A;  2CAM A;  1S4V A;  2L67 A;  1STP A;  5FQ6 E;  2XU5 A;  4PP2 E;  3FEK A;  4TQ2 A;  4GUZ A;  2KW1 A;  2W2F A;  4EKV A;  2AF5 A;  3KFH A;  2G8C O;  1SWE A;  1ZNK A;  4ML7 B;  1YP6 A;  3WJB A;  1NQC A;  4QRX A;  4GJV A;  5FAZ A;  1A2D A;  1BSO A;  1H91 A;  2Q2M A;  2O62 A;  1MIR A;  4M0W A;  3QKG A;  4BS6 A;  4L3R A;  2OFB A;  3PH5 A;  4YYQ A;  1YIV A;  2JW1 A;  4BVM A;  2ALL X;  2HKD A;  3K8U A;  1SY3 A;  5FQ7 E;  2XST A;  4ZGF A;  1YP7 A;  1VWF B;  3BY0 A;  4AZR A;  3E3C A;  2Q39 A;  4I07 A;  2DM5 A;  1QG5 A;  1KOI A;  3B2J A;  1SWD A;  1I78 A;  1JQP A;  3FDC A;  3OBL A;  1N0S A;  4INN A;  4GDZ A;  1W6F A;  3K9M A;  1ZCM A;  4Y0S A;  3JQO A;  2F01 A;  2P7U A;  2QMI A;  5IRW A;  3WJC A;  4TKH A;  2BHV A;  3ELX A;  2WBF X;  5JH3 A;  4YDB A;  2PI3 O;  4HWM A;  4GET A;  4BGF A;  4BOU A;  4XMD A;  4IAW A;  4KLB A;  2IBI A;  3BCN A;  1GKA A;  2Y6E A;  3IFU A;  5B29 A;  3U03 A;  4M6S A;  4D8I A;  2IZD B;  4ZHF A;  1MOY A;  3G7X A;  5HTD A;  5KID A;  1SP4 B;  2X4M A;  2FWV A;  1ADL A;  1KQX A;  3HWD A;  5LKF A;  2F73 A;  3BPF A;  5LJG A;  3IFB A;  3NQ3 A;  4PT5 A;  3ELZ A;  2RN4 A;  1STS B;  4YMY A;  3NBX X;  5LJB A;  3VG4 A;  3RWX A;  2FTB A;  3ZW0 B;  2LBA A;  2DC7 A;  2VDF A;  1ZNE A;  4GH7 A;  1GM6 A;  2DJG B;  2FYE A;  4CPH B;  3FMZ A;  5FQ8 E;  3CWK A;  1OPA A;  5FFH A;  4GGR A;  1VWD B;  1OPB A;  1T8V A;  2R73 A;  2WPU A;  5HCE C;  3I0A A;  3S26 A;  1MHW A;  3U9P C;  4ZHD A;  3WXG A;  2YJ8 A;  3KW9 A;  3VHH A;  1SLG B;  3NP1 A;  4Y5D A;  3B21 A;  4Z2V A;  1GT3 A;  3RDQ A;  2UZJ A;  1YWB A;  4CDE B;  4EQA C;  2OFR X;  1IWD A;  1SRJ A;  2RTO B;  2KT4 B;  3HPE A;  5B10 O;  1EAL A;  4YYR A;  1QY0 A;  2MJI A;  1XKI A;  5D47 A;  1ATK A;  4TJZ A;  5IO6 A;  1WBI A;  1SY2 A;  2NQA A;  3HHI A;  1VPR A;  2DCA A;  2HZR A;  2G6D A;  2OFM X;  3VHI A;  1LCZ A;  1JIW I;  4Y0R A;  1ZRY A;  2A2G A;  1GMY A;  1VWO B;  3K3L A;  4BJ8 A;  2RTP B;  4ORR A;  2HYS A;  2L68 A;  1THE A;  3VE1 A;  1CSB B;  1P6P A;  4I95 A;  1CB5 A;  4I3C A;  4LKP A;  5CSE A;  4N4Z A;  2GTL N;  4ZH9 A;  4KT5 A;  5DG4 A;  3BSZ E;  3P5U A;  2GFO A;  2WR6 A;  3ZW1 B;  3HOL A;  3OF9 A;  5K06 A;  4W4U A;  2WEX A;  4OKA A;  1T68 X;  2G8E A;  2E03 A;  5PAD A;  1YVB A;  5D8J A;  3ZI8 A;  1AIM A;  4U3Q A;  1KT6 A;  4BOE A;  1SLE B;  1A18 A;  1AYU A;  1NDJ A;  2RTE B;  1DC9 A;  3PT2 A;  4I6S A;  4ALB A;  1N9Y A;  5CVO B;  2RA6 A;  2IZA A;  2NP1 A;  2AS8 A;  4DMX A;  3EC5 A;  1YWD A;  3WYP A;  1DF0 A;  3KWB X;  4YYW A;  4O49 A;  2CZU A;  4HXD B;  1SRI A;  8PCH A;  3BWK A;  1VWN B;  1R0U A;  2L9C A;  3APW A;  1NP4 A;  2HLV A;  3MM0 A;  2RTM A;  4XMG A;  5HCC C;  3KFI A;  4DQ4 A;  2AUX A;  3S3R A;  3WZP A;  3RDM A;  1I04 A;  3RY2 A;  3GCB A;  2WQA E;  2DC6 A;  2AH7 X;  1EPA A;  3PEC A;  5IO7 A;  5LJK A;  3O19 A;  3E9S A;  2RTA A;  1SRH A;  1HXL A;  5HZ8 A;  1HMS A;  2X8S A;  5F1E A;  3RZY A;  1MK5 A;  3KVN A;  4CZW A;  3FW4 A;  3O2Y A;  1UYO X;  1YWA A;  1HBQ A;  5EEE A;  1Y55 X;  2AT0 X;  2AU1 A;  3SAO A;  3EM0 A;  1A57 A;  2DCC A;  1VSN A;  1FDQ A;  2WEW A;  4QBB A;  1ME4 A;  2EU7 X;  2Z4I A;  1OBU A;  4TKJ A;  2MF6 A;  3IA8 A;  2P86 A;  3TGA A;  1PBO A;  1B4M A;  1QWD A;  1HMT A;  1PPD A;  1SNK A;  1SWJ A;  2F7D A;  1L6M A;  1LDO A;  1IKE A;  3M99 A;  3DF0 A;  4MI7 A;  2DCD A;  2OF9 A;  3O22 A;  3F5V A;  1MDW A;  1T0V A;  1SLF B;  1F29 A;  1E02 A;  5LJD A;  2ZAI A;  1ICM A;  1RST B;  2HD5 A;  2Y32 A;  2R6N A;  3PW3 A;  4FBR A;  3HOE A;  4YGZ A;  1AU2 A;  1X8O A;  2RTJ A;  3WBG A;  4D6B A;  1SWU A;  4WBK A;  1S44 A;  1IKJ A;  2PY1 A;  1FEN A;  2ACT A;  5B11 O;  2JQF R;  3NAD A;  1HXZ A;  4YKM A;  1DZK A;  2IZH B;  4CDF A;  4P16 A;  1PM1 X;  4W5B A;  1FE3 A;  3JSQ A;  1O1U A;  1VWB B;  1UZ2 X;  3PSE A;  4AZM A;  1CQD A;  4RY2 A;  1HUC B;  2RTF B;  1O1V A;  4N8W A;  4ZGU A;  5KO3 A;  3UEV A;  1F2C A;  4CDD A;  1IW2 A;  1OEE A;  3F9D A;  3B2K A;  3C9E A;  2RTL A;  3IV2 A;  2GTF X;  2XU3 A;  2AUZ A;  4BX7 A;  2IZL B;  2BTW B;  3H8C A;  3BBA A;  2Q9S A;  3UEU A;  2LKK A;  3HK1 A;  2IZB A;  3FA8 A;  3SOT A;  2FHL A;  1S7D A;  3LXS A;  2O6X A;  4RKX A;  4TNN A;  4CDC A;  3P6D A;  1X71 A;  3FID A;  3RDU A;  2RQ0 A;  1B0O A;  5EGW A;  1KT3 A;  4B55 A;  2A2U A;  5BYP A;  4ORS A;  5BVT A;  2E02 A;  3CBK A;  5HZ6 A;  2UYW A;  3IOQ A;  1LCV A;  1K3B B;  1XKG A;  3Q6L A;  4FIP A;  4OS0 A;  2QO4 A;  1LIF A;  2HH5 A;  1G5W A;  2X45 A;  2OL8 O;  1VWJ B;  3BS2 A;  2ZSC A;  4A8Z A;  2F09 A;  2FS7 A;  5HA0 A;  3PHU A;  3FEN A;  4KC7 A;  3ERV A;  4XUI A;  3LHN A;  5IRA A;  4QGX A;  2N93 A;  4GGZ A;  1CJL A;  4RUU A;  1KL4 A;  2IZF B;  1X8P A;  4OS3 A;  1LPJ A;  3BU1 A;  3U8E A;  4W5C A;  1JZU A;  4FJC A;  2CBR A;  1KFU L;  1SXX A;  2JN3 A;  2ANS A;  4RF1 A;  1Y53 X;  2LA7 A;  2R9O A;  4R0B A;  4Z6J A;  2W2A A;  1VWC B;  1AEL A;  3STM X;  2AIM A;  1IIU A;  1SA8 A;  4ZHG A;  1JJX A;  4QH6 A;  3UEW A;  2OVE A;  2CM9 A;  4BS5 A;  5K68 A;  3IMA A;  4QRV A;  3D6S A;  1SWA A;  1BY8 A;  3LV4 A;  1O8V A;  1JYD A;  1KGL A;  3ZNH A;  1GLO A;  4XMH A;  2JU8 A;  3AI8 A;  4Y59 A;  3LFY A;  3D96 A;  1WUB A;  4ODD A;  4O3Z A;  3Q34 A;  3H7D A;  1VWL B;  3S3Q A;  2WUT A;  1OBQ A;  1BRP A;  3PED A;  2RCQ A;  4FQB B;  3C76 X;  3WVM A;  3EBK A;  2FTD A;  1RXJ A;  4DMY A;  1GT5 A;  2J7Q C;  4CPI A;  5LJC A;  1SWS A;  2QOS C;  3ZUO A;  4GRJ A;  3AUM O;  1M6D A;  2NNQ A;  1RLB E;  1HQQ A;  1DKI A;  4Q8G A;  4NP1 A;  2GH7 A;  3CQN A;  3OVX A;  2KTD A;  5LJH A;  3V8U A;  2PBH A;  4ID2 A;  1N7Y A;  4LQZ A;  4O4X A;  1NPZ A;  4YKO A;  4KC8 A;  1DZP A;  4DQ3 A;  2G78 A;  2FR2 A;  1LIE A;  2ATO A;  2MHD A;  4JHQ A;  5B5F A;  2HWK A;  1D3S A;  1SWB A;  4ORX A;  3RE5 A;  2E00 A;  2IZG B;  3VG6 A;  2QOM A;  3EMM A;  3NX1 A;  1OEJ A;  4QGV A;  4HFO A;  3EW2 A;  2DOS A;  4ZH6 A;  5L8N A;  5AJB A;  4ALO A;  3K24 A;  2FT2 A;  1YK8 A;  5HWZ A;  3BLG A;  2RTH B;  2YMS A;  3QQ2 A;  3EBW A;  2RTB B;  1GT1 A;  2JU7 A;  1NQM A;  5HBS A;  1CPJ A;  1ME3 A;  1BBP A;  4FGI B;  3DSZ A;  3OVZ A;  2OVA A;  2NQI A;  3PNR A;  2FS6 A;  4QZU A;  2AVI A;  2FUD A;  5DPQ A;  3W31 A;  1GGL A;  4U8U N;  4U46 A;  1FEM A;  3NR3 A;  4YFQ A;  1CBR A;  4O4U A;  1DF8 A;  2R74 A;  2IZI A;  1TU6 A;  4X6H A;  2MO5 A;  1SMP I;  4PJ2 A;  4GNY A;  4QNI A;  2X8F A;  1QDQ A;  3QJ3 A;  4GD9 A;  3D97 A;  2AT5 X;  4Q8H A;  4AZO A;  1NB5 A;  1Y4H A;  1I05 A;  3KFG A;  3BX8 A;  2LBV A;  2K23 A;  1EII A;  3ZW1 A;  2FKG A;  2BDZ A;  4I9R A;  3S60 A;  3OIS A;  4OMX A;  4Z27 A;  2CZT A;  2AL0 X;  3RBY A;  2FE8 A;  2BDL A;  4YGH A;  5EZ2 A;  3EW1 A;  1PTS A;  3TGB A;  4KII A;  3VE2 A;  4AZP A;  3BC3 A;  1SXU A;  5H9L A;  4ZFX A;  1RXH A;  3APX A;  1EWM A;  4OEL A;  5HA1 A;  4LKT A;  2RTQ B;  3BPM A;  1PPO A;  1LFO A;  1LIC A;  4OEM A;  3O65 A;  4MIS A;  4HWY A;  1LNM A;  4O3X B;  2FGS A;  3HWN A;  2OF8 A;  1JMX A;  3N91 A;  1PPP A;  3IEJ A;  2GTL O;  2LB6 A;  1Y52 X;  3D95 A;  4CK4 A;  5EED A;  2R56 A;  3B79 A;  2B1M A;  2FQ9 A;  5AJC A;  3MOR A;  3MP2 A;  3SZH A;  1RBP A;  5CVN B;  4GGT A;  1SY1 A;  3H89 A;  4BX5 A;  4U9C A;  1B56 A;  1MEM A;  2R9N A;  3KWZ A;  5K16 A;  1VWA B;  5FPW A;  3B2H A;  2QO6 A;  1BJ7 A;  4NV8 A;  3NX2 A;  4R3D A;  1AEC A;  2A3F X;  1TOU A;  4Z2P A;  3OJY C;  4YFR A;  1YZB A;  4IP3 A;  3BOW A;  3OD9 A;  2C1S A;  3KFQ A;  2QM9 A;  4QRG A;  3APV A;  1QAB E;  3FA6 A;  3IHP A;  4RF0 A;  1YK7 A;  2OVD A;  4GUA A;  2DJF A;  2E4J A;  2HHN A;  4O4S A;  2NQD B;  3QT4 A;  1PBH A;  1NQN A;  4QAE A;  1GKA B;  1X89 A;  3PQU A;  1DZJ A;  1NB3 A;  4YBP A;  2AT8 X;  4YH0 A;  1EWL A;  2X8T A;  3P5W A;  1X8U A;  4BX6 A;  5HZ9 A;  3PQS A;  3C78 X;  1STF E;  4M7M A;  5D4A A;  2XKL A;  4GDA A;  4KCA A;  4LZV A;  2E01 A;  2JMB A;  4QYN A;  1YAL A;  1PE6 A;  3VHM A;  1AU3 A;  1ZIV A;  1EW3 A;  1CJ5 A;  1FTP A;  4NYR A;  1DFV A;  3OE3 A;  3HD3 A;  1U9Q X;  4IAX A;  1QOL A;  1HY2 A;  2A8G A;  3MVF A;  4I05 A;  2X34 A;  1BSQ A;  1ZNH A;  2AT3 X;  3F6Z B;  9PAP A;  1GEC E;  3ZUA A;  3DTQ A;  3BX7 A;  3MHS A;  1KHP A;  1CBQ A;  1CVZ A;  1VYG A;  4HPB A;  3OQC A;  4BOQ A;  1GXA A;  5CE4 A;  4IMO A;  1Z24 A;  3I06 A;  3B2L A;  3MBT A;  3WZQ A;  1UKF A;  1LEL A;  4NYQ A;  3SLT A;  3PK2 A;  3T2W A;  4I3D A;  5L8I A;  1NP1 A;  1SLD B;  2VFC A;  3NQK A;  3RKG A;  4BOP A;  2BT9 A;  4OVZ A;  2IZJ A;  3CBJ A;  2G5L A;  1W4T A;  3I3T A;  3HHA A;  2JGS A;  5EPQ A;  4CSB A;  3RSW A;  2B1N A;  2PAD A;  4GKC A;  4YDA A;  4COT A;  3P6C A;  2DZZ A;  3WJD A;  3FYF A;  3P6F A;  1B8E A;  1VWG B;  1LIB A;  4IBA A;  3PH6 A;  1O0E A;  3T1D A;  1CBS A;  3NPO A;  1KT5 A;  1BQI A;  4AYH A;  3BB7 A;  3N3K A;  1NBX A;  5KHP A;  3H3I A;  5HCD C;  4I04 A;  2WQ9 A;  4WHI A;  1U9W A;  4IAB A;  3CKF A;  3WZO A;  5HZQ A;  2YJB A;  1PMP A;  3MHH A;  4OMW A;  3RY1 A;  5H8T A;  1PVJ A;  1W5R A;  1Y0G A;  3P5X A;  2OL7 A;  3TNX A;  4A1H A;  1EQD A;  1QQS A;  3P02 A;  5EDB A;  3I17 A;  1FEL A;  3T2X A;  1SWK A;  2HMB A;  1VWK B;  4Y0P A;  3CH3 X;  1IFB A;  4WUR A;  1TXL A;  1VYO A;  3BDR A;  5EZQ A;  2GTL M;  3TZS A;  1DF3 A;  1ITO A;  4IB8 A;  3SLJ A;  2JTC A;  1Y08 A;  2C4I A;  3N3G A;  4BOZ A;  2I5Z O;  1LCW A;  1YUP A;  5CHK A;  1TVQ A;  1GX9 A;  4FBV A;  2FR3 A;  1I9H A;  1U18 A;  5B3M O;  1N4J A;  5L8O A;  1ERB A;  2L5P A;  1QFV A;  4OW0 A;  2CB5 A;  5IXG A;  1YWC A;  4QRL A;  4YVB A;  1OBP A;  1D2U A;  4K19 A;  1NC9 A;  4RNA A;  4YVA A;  2NQG A;  5BVQ A;  3SLO A;  3V6C A;  3F75 A;  1SWR A;  1MX7 A;  1E00 A;  1POP A;  1A3Y A;  2BU3 A;  2AGA A;  2ACP X;  4YFP A;  3APU A;  2K62 A;  3GE2 A;  4IMN A;  3KSE A;  1TW4 A;  3L4R A;  2Y5B A;  1U9X A;  1U17 A;  4QYP A;  4Z28 A;  2FRA A;  1KHQ A;  2BC3 A;  1PIP A;  4A5U A;  1A6R A;  3FR2 A;  1N43 A;  3FLL A;  3UAQ A;  5KIC A;  3UEX A;  1GCB A;  2PRE A;  4ORY A;  4PI3 A;  1LKE A;  5AQ6 A;  1DV9 A;  4XR7 A;  5H9N A;  4ES7 A;  4N7C A;  4ORW A;  4QZT A;  1VJV A;  1AVE A;  1JMZ A;  5IO5 A;  3MG5 A;  4MZS A;  1QMY A;  3PHX A;  5EZS A;  1SRF A;  1G7N A;  2G8J A;  1CV8 A;  1AU0 A;  2FHN X;  4UU2 A;  1EPB A;  1PEE A;  4IB7 A;  3AEH A;  3CH2 X;  3CQR A;  3MTV A;  2DC9 A;  3CR6 A;  4HPA A;  1BEB A;  1TL9 A;  5D48 A;  5H9A A;  1HBP A;  5CHV A;  2RTG B;  4ZR2 A;  1EWP A;  2OVS A;  2W2B A;  2GHU A;  1Y9L A;  4CDF B;  1E06 A;  1EF7 A;  5CVM A;  2A0A A;  3RVV A;  5B27 A;  1U5I A;  1ML7 A;  4XZX A;  1BLR A;  4P6G A;  1U9V A;  2HNX A;  3ZUI A;  4GJS A;  2OY8 A;  4D8B A;  1UYN X;  2FT9 A;  2IPP B;  2RCT A;  4LZU A;  1MDC A;  5E6J A;  3KZA A;  4NLJ A;  1VWE B;  1LDQ A;  1MM9 A;  1CTE A;  3ZW0 A;  4BX7 B;  5JA7 A;  2G79 A;  1MVG A;  2ACO A;  5EF4 A;  7PCK A;  4ZUX U;  2DJG A;  4CPH A;  3FA7 A;  2DZY A;  3P6G A;  1BWY A;  3ZQ3 A;  2OY5 O;  2AVW A;  4U8U O;  4CDC B;  1SWG A;  4EDE A;  5LJE A;  3S5V A;  1I06 A;  1SXY A;  3B2I A;  3PPT A;  4G54 A;  5H9K A;  2OL6 O;  2GJ5 A;  2BS5 A;  3PDF A;  5JR8 A;  4REZ A;  4X6J A;  2OY7 A;  3HWF A;  1KZW A;  2AYO A;  1FJ1 E;  1MX8 A;  1EIO A;  2Q4N A;  3IUT A;  3WOV A;  4MZO A;  3X00 A;  1Y9T A;  1AQB A;  2LFO A;  4CDE A;  4GZV A;  3AKN A;  4MSX A;  3BU9 A;  1VWR B;  5EDC A;  4AXL A;  2A5C A;  3P24 A;  1ERX A;  3WJF A;  4YYV A;  2OFA A;  1AB0 A;  3N4C A;  4ZJ0 A;  4EEJ A;  3VG2 A;  2KTS A;  5L3Y A;  1CS8 A;  1GX3 A;  1QFT A;  5HTE A;  1BGO A;  1AYV A;  2DCB A;  1IJ8 A;  1SY0 A;  2G7B A;  3QSD A;  3STN A;  2BLG A;  1BP4 A;  1NL6 A;  2NNE A;  1KFF A;  2IZC B;  1KT4 A;  1DEU A;  1BM5 A;  1ICN A;  3T6F A;  1MEP A;  2AT6 X;  3TRK A;  5CHT A;  2AMM X;  1GT4 A;  4AW8 A;  2G7Y A;  4PSQ A;  1EXS A;  2R9M A;  3HWE A;  3RVW A;  3MJ5 A;  2F1G A;  4Y0Q A;  1CRB A;  4YGG A;  3RDS A;  4IUM A;  1JBH A;  1MUP A;  4ARH A;  3WXQ A;  2VFB A;  2HZQ A;  4GE1 A;  3C0R A;  2RTR B;  1VYF A;  1QY1 A;  4L1N A;  1AYW A;  1SWL A;  4WA6 A;  4QGW A;  3LTW A;  4AZQ A;  4BBO A;  4MVI A;  1SWN A;  3C77 X;  4MM3 B;  1KFX L;  1EUO A;  4YCE A;  1SWC A;  2Q2P A;  3CKG A;  1KL5 A;  1AVG I;  4PP1 A;  1E5P A;  2OZ2 A;  2BSZ A;  3P5V A;  5F02 A;  3S5X A;  3ZW2 A;  4BSQ A;  1I4U A;  2P8G A;  2DC8 A;  5B2A O;  1VWH B;  4JGL A;  3JS1 A;  1MEG A;  4P6E A;  2YJ2 A;  1MS6 A;  1RAV A;  1STR B;  3O0U A;  2CM4 A;  2X55 A;  3PBH A;  5FEN A;  3PP6 A;  3USV A;  1N9M A;  3HWG A;  2OUL A;  1KQW A;  2RTN B;  4N79 A;  2XU1 A;  3PHW A;  5J94 A;  4MIR A;  3BY4 A;  4DNE A;  5LKE A;  4JO6 A;  5HAE A;  3CBS A; 
#chains in the Genus database with same CATH homology
 2P7U A;  3E1Z B;  2YJB A;  4FJC A;  1KFU L;  3RVX A;  5JH3 A;  2WBF X;  3MHH A;  4BGF A;  1W5R A;  2R9O A;  4KLB A;  2IBI A;  3P5X A;  3BCN A;  2AIM A;  1NLJ A;  3TNX A;  2Y6E A;  4QH6 A;  4BS5 A;  3IMA A;  4QRV A;  3D6S A;  1BY8 A;  3CH3 X;  1SP4 B;  3KX1 A;  2YJ9 A;  1GLO A;  2VHF A;  4YYU A;  3AI8 A;  1ITO A;  3LFY A;  1Y08 A;  3N3G A;  3H7D A;  3S3Q A;  3BPF A;  4YYS A;  4YV8 A;  2FTD A;  4DMY A;  2OP3 A;  2AYN A;  2CB5 A;  2DC7 A;  1PXV A;  1M6D A;  1EWO A;  2DJG B;  2FYE A;  3H6S A;  4Q8G A;  4YVA A;  2NQG A;  3D9W A;  3V6C A;  2FRQ A;  3OVX A;  3F75 A;  3OF8 A;  2PBH A;  4AXM A;  1POP A;  1NPZ A;  3H8B A;  1MHW A;  3KSE A;  2R9C A;  3WXG A;  2YJ8 A;  2ATO A;  3WXE A;  2Y5B A;  3KW9 A;  1U9X A;  2E00 A;  2H7J A;  2FRA A;  1KHQ A;  1F2B A;  1FH0 A;  1PIP A;  1A6R A;  1X9Y A;  4CDE B;  1K3B A;  1GCB A;  2PRE A;  3K24 A;  4FK5 A;  2FT2 A;  1YK8 A;  4PI3 A;  1IWD A;  4XR7 A;  4BPV A;  4YYR A;  1VJV A;  1ATK A;  1CPJ A;  1ME3 A;  4MZS A;  1QMY A;  2DJF B;  3MTN A;  3OVZ A;  2NQA A;  2G8J A;  1CV8 A;  3KKU A;  3HHI A;  1AU0 A;  2DCA A;  2NQI A;  2G6D A;  3PNR A;  1GMY A;  2FUD A;  2VHS A;  1THE A;  1CSB B;  3CH2 X;  2JQG R;  1CB5 A;  2DC9 A;  4N4Z A;  1TL9 A;  1TU6 A;  4X6H A;  1QDQ A;  2GFO A;  3P5U A;  5CHV A;  3QJ3 A;  1EWP A;  4Q8H A;  2GHU A;  6PAD A;  1NB5 A;  4CDF B;  3OF9 A;  1Y4H A;  1EF7 A;  4NV7 A;  4W4U A;  5CVM A;  3RVV A;  2G8E A;  5PAD A;  2E03 A;  1YVB A;  1U5I A;  1AIM A;  2BDZ A;  3OIS A;  4P6G A;  1U9V A;  1AYU A;  2BDL A;  5CVO B;  2IPP B;  2AS8 A;  3BC3 A;  4X6I A;  4DMX A;  1DF0 A;  3KWB X;  4YYW A;  1YT7 A;  1CTE A;  1EWM A;  4OEL A;  8PCH A;  3BWK A;  1QXP A;  5JA7 A;  3BPM A;  1PPO A;  1ICF A;  7PCK A;  4ZUX U;  5EF4 A;  4OEM A;  2DJG A;  1TLO A;  2DZY A;  1PCI A;  2FO5 A;  2AVW A;  4HWY A;  4CDC B;  3HWN A;  1PPP A;  2C0Y A;  3S3R A;  2AUX A;  3IEJ A;  3V6E A;  1AU4 A;  3GCB A;  4BQV A;  3B79 A;  1Q6K A;  2B1M A;  4G54 A;  2R9F A;  2FQ9 A;  4PAD A;  3MOR A;  3PDF A;  2DC6 A;  5CVN B;  4X6J A;  3H89 A;  2P0R A;  1PPN A;  1MEM A;  2R9N A;  3KWZ A;  2CIO A;  2AYO A;  5K16 A;  5FPW A;  4NV8 A;  3IUT A;  1AEC A;  4CZW A;  4MZO A;  2AU1 A;  3WXF A;  4CDE A;  3O1G A;  4K7C A;  4MSX A;  3BOW A;  2DCC A;  3KFQ A;  1PAD A;  1VSN A;  4QRG A;  4AXL A;  2ARY A;  4QBB A;  1ME4 A;  3IHP A;  2P86 A;  1YK7 A;  4C5P A;  4YYV A;  1KXR A;  1PPD A;  1SNK A;  2DJF A;  2F7D A;  2HHN A;  2NQD B;  3M99 A;  3DF0 A;  3N4C A;  3QT4 A;  1PBH A;  2DCD A;  2YJC A;  1CS8 A;  2PNS A;  1GX3 A;  3F5V A;  1MDW A;  1F29 A;  1NB3 A;  1BGO A;  1EWL A;  2HD5 A;  1AYV A;  3P5W A;  2DCB A;  3NHE A;  2R6N A;  1STF E;  3PW3 A;  3QSD A;  1AU2 A;  5A24 A;  2E01 A;  1BP4 A;  1YAL A;  1NL6 A;  1PE6 A;  1AU3 A;  1ZIV A;  2ACT A;  2JQF R;  1DEU A;  2HXZ A;  4CDF A;  3HD3 A;  1U9Q X;  4W5B A;  1QOL A;  1F2A A;  4I05 A;  5CHT A;  2XU4 A;  2G7Y A;  4CDD B;  9PAP A;  1GEC E;  1E2T A;  2R9M A;  3ZUA A;  3RVW A;  4RY2 A;  1CQD A;  1HUC B;  3MHS A;  1KHP A;  1S4V A;  2F1G A;  1CVZ A;  4N8W A;  2XU5 A;  4PP2 E;  1F2C A;  4CDD A;  4GUZ A;  3C9E A;  2VFB A;  3IV2 A;  3I06 A;  2XU3 A;  2AUZ A;  1AYW A;  3H8C A;  4WA6 A;  3LTW A;  3LXS A;  1NQC A;  2O6X A;  4QRX A;  4CDC A;  1KFX L;  1MIR A;  4BS6 A;  2VFC A;  5EGW A;  4PP1 A;  4B55 A;  4YYQ A;  2OZ2 A;  3CBJ A;  2BSZ A;  1W4T A;  3P5V A;  2E02 A;  3CBK A;  3I3T A;  3IOQ A;  1K3B B;  3HHA A;  5F02 A;  1XKG A;  2PAD A;  2B1N A;  3K8U A;  4FIP A;  4BSQ A;  4W5C A;  2HH5 A;  2DC8 A;  2DZZ A;  1MEG A;  4I07 A;  4P6E A;  2YJ2 A;  3ERV A;  1MS6 A;  4XUI A;  3O0U A;  3PBH A;  1O0E A;  1CJL A;  3USV A;  1JQP A;  2OUL A;  1BQI A;  4N79 A;  2XU1 A;  5J94 A;  3N3K A;  1W6F A;  3K9M A;  1ZCM A;  4I04 A;  3U8E A;  1U9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...