3PDFA

Discovery of novel cyanamide-based inhibitors of cathepsin c
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
441
structure length
351
Chain Sequence
b'DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVFLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1
publication title Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 98
structure length 351
sequence length 441
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 3pdfA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pdfA02
4QRGA 2P86A 1POPA 4CDCA 4CDDB 1PPDA 2DJFB 4CDEA 8PCHA 4QBBA 4XR7A 2PREA 7PCKA 1NB3A 1PIPA 3PBHA 2JQFR 5F02A 2GHUA 4Q8HA 2HHNA 3S3RA 3V6CA 3PDFA 2G6DA 3RVXA 4Q8GA 3CBJA 2AU1A 3K24A 2XU1A 3CBKA 2E03A 4P6EA 4CDCB 3I3TA 1CSBB 1F2AA 4CDEB 2P7UA 1JQPA 3WXGA 4N4ZA 1PADA 4N8WA 2DC7A 2G8JA 3H6SA 2XU4A 2DCDA 1BP4A 3RVWA 1CTEA 2NQAA 2ATOA 1CJLA 2HH5A 2DCAA 2YJCA 6PADA 5A24A 3V6EA 3MHSA 5CVNB 4BPVA 2FRQA 3USVA 1YK7A 3CH3X 3KWZA 4PI3A 3IUTA 2P0RA 2E01A 2Y5BA 2R9OA 1F29A 1AU3A 2HXZA 1GCBA 3DF0A 1IWDA 3U8EA 2DJFA 1VJVA 1CQDA 2F7DA 2VHFA 4BS6A 3HD3A 3H7DA 2XU3A 2DC9A 2R9NA 4CDFA 4K7CA 4W4UA 1ZIVA 2H7JA 4YVAA 1YT7A 3OISA 2AYNA 4I07A 5EF4A 3ERVA 2R9CA 1AU4A 4MZSA 2AYOA 2FQ9A 1KFUL 1F2BA 3NHEA 3KX1A 1KHQA 1KFXL 2FO5A 3D6SA 2CB5A 1CS8A 1THEA 3P5VA 4KLBA 4RY2A 1NPZA 4AXLA 1AYUA 1M6DA 2DZZA 5CVMA 1QMYA 3N4CA 4QRXA 2Y6EA 2FT2A 3O1GA 2G7YA 4CDFB 2G8EA 1ME3A 2CIOA 4BQVA 1CPJA 1ZCMA 1EWPA 2B1NA 1K3BA 1KXRA 2AIMA 2AVWA 2YJ9A 3WXFA 3BC3A 3K8UA 4FJCA 3IMAA 1X9YA 2XU5A 4X6JA 3P5XA 2PADA 3HHIA 4X6HA 1EF7A 4YYRA 3QJ3A 3MORA 4XUIA 3MHHA 1Q6KA 4BS5A 1FH0A 3HWNA 4YYVA 1AYWA 3OVXA 3H8BA 1O0EA 1CB5A 2NQDB 3MTNA 3E1ZB 1K3BB 2BDZA 1TLOA 1Y08A 1GECE 4AXMA 1QDQA 2FYEA 1BY8A 4N79A 1DF0A 1NB5A 1NLJA 4W5CA 3OF8A 3N3KA 2DC6A 2OZ2A 3GCBA 4YV8A 1XKGA 2AUXA 2E00A 2PNSA 4QRVA 3P5UA 4CZWA 4P6GA 2DCBA 4ZUXU 2PBHA 4OELA 1AECA 1U5IA 3KWBX 1PPOA 1MIRA 2BDLA 4G54A 3TNXA 2F1GA 3PNRA 1SNKA 3I06A 2R6NA 2HD5A 3OVZA 1S4VA 2OP3A 2ARYA 3OF9A 1VSNA 1U9VA 1YK8A 3S3QA 5JA7A 1TU6A 2R9MA 2YJBA 1PXVA 1GLOA 3WXEA 1HUCB 3F75A 3KW9A 3BOWA 1PCIA 1PPPA 3O0UA 1Y4HA 4W5BA 3IV2A 2R9FA 1BQIA 1MS6A 2IBIA 3C9EA 4BSQA 9PAPA 2DZYA 3KKUA 5J94A 4DMXA 1NQCA 5JH3A 4HWYA 1KHPA 3LFYA 2E02A 2ACTA 5FPWA 4PP2E 2OULA 1AIMA 1EWLA 1DEUA 1U9QX 3KFQA 1STFE 4QH6A 2AS8A 1U9WA 4MZOA 2DJGB 2IPPB 1F2CA 2O6XA 3IEJA 3LXSA 4OEMA 1EWMA 1CV8A 5K16A 3BPMA 3H89A 1AU0A 3IOQA 5CHTA 1QXPA 2VHSA 2YJ8A 1MDWA 4I05A 2B1MA 1PE6A 3PW3A 1ATKA 1ITOA 1AU2A 3BPFA 3K9MA 1ICFA 1U9XA 4YYQA 3BWKA 2FUDA 1BGOA 1YALA 5CVOB 2GFOA 5EGWA 3B79A 1SP4B 1A6RA 4MSXA 1MHWA 1EWOA 4X6IA 3KSEA 2FRAA 3N3GA 3QSDA 4PADA 3RVVA 5PADA 1NL6A 3P5WA 2DC8A 1PBHA 3H8CA 2FTDA 1AYVA 4YYUA 4PP1A 1YVBA 4CDDA 2C0YA 4FK5A 1GMYA 2YJ2A 3HHAA 3M99A 2AUZA 3ZUAA 1MEGA 4DMYA 4YYSA 3AI8A 5CHVA 1ME4A 2WBFX 4YYWA 2NQGA 2JQGR 2NQIA 3BCNA 1TL9A 1CVZA 3QT4A 4WA6A 1MEMA 2DJGA 1PPNA 3CH2X 4FIPA 4I04A 2DCCA 1QOLA 3IHPA 3F5VA
chains in the Genus database with same CATH superfamily
1QG5A 1Y52X 4CDDB 2AVIA 2G7BA 4NV7A 3NBXX 1AVDA 3PBHA 5HZ5A 1OEEA 1JMXA 1SWGA 2NP1A 2JU8A 3L4RA 2Y3EA 2BU3A 5DPQA 4NNTA 4XZXA 2OL7A 3V6CA 1VWOB 1VWFB 2G79A 4BX6B 3F6ZB 3FW5A 1E2TA 4ORXA 3PK2A 1WUBA 3H3IA 1SMPI 3NQKA 3K24A 2C1SA 3CBKA 3B2HA 2IZGB 3F9DA 3S60A 2XKLA 3ZNHA 4D6BA 1F2AA 1SXXA 1SLEB 1SXYA 1JIWI 4WBKA 4EQAC 4N7DA 2A5BA 4R3DA 1LFOA 2N93A 4AW8A 1A2DA 2RCQA 1I06A 3VG5A 2XU4A 3RVWA 5HTDA 3O65A 3BS2A 2RTRB 2RTOB 1XCAA 3LHNA 3QKGA 1BRQA 2BSZA 1N7YA 2HH5A 3WOVA 4ZGUA 1KT3A 3ZQ3A 3CMPA 1DF8A 1GGLA 2LKKA 3V6EA 3MHSA 5CVNB 5AJBA 4INNA 4UU2A 3USVA 5F1EA 1YK7A 1GX8A 1HQQA 4PI3A 1RXHA 5D47A 2FGSA 2X55A 5JZEA 2G78A 4GJSA 4BQUA 3HWEA 3ELZA 2OY7A 4I9RA 1SREA 3ZW1A 3U8EA 5LJEA 2FE8A 1CBIA 1RAVA 3H7DA 3HOLA 4CK4A 2FR2A 4K7CA 1KQWA 1ZIVA 2AT5X 2FS7A 2VDFA 4YVAA 4ZH6A 4GD9A 1KT4A 1ICMA 2IZIA 4CPIA 3ERVA 5BYPA 4DCBA 4NW4A 2AT3X 3NHEA 3P6FA 3ZW1B 2FO5A 4TJZA 4O3WA 1THEA 2JN3A 1NPZA 2AT6X 4GNWA 1OBQA 1M6DA 2DZZA 1PBOA 3ZW0A 3V8UA 3T1DA 2G8EA 1HMRA 4MI7A 1PTSA 1NBXA 1CPJA 1JYJA 4CV7A 3HTYA 4KIIA 4A5UA 2J7QC 4CPEA 1VWPB 4O3XB 1SWPA 1ERXA 1IJ8A 3K8UA 5FENA 3ZW0B 3MG5A 1MEPA 1QY1A 2PADA 1YUPA 3G7XA 3HWGA 5HZ9A 5K06A 2RQ0A 4C5PA 1LCWA 4YYVA 2LBVA 4DNEA 3BU1A 3B2KA 1NP4A 2RTDB 3MX7A 1TLOA 4ZJ0A 5BVTA 5LJHA 3S26A 3VU1A 3WZNA 2Y32A 2OVAA 1BBPA 3O19A 5HCEC 1EQDA 2M4LA 4DQ3A 1W5RA 4YGGA 4I3DA 5H9KA 3WBGA 1KT6A 5AQ6A 2RTKA 5HWZA 2AUXA 2E00A 4QRVA 3BDRA 4QAEA 5EDBA 4P6GA 1BRPA 1GKAA 4QQ1A 4Y59A 1NQMA 4OELA 1U5IA 5IRAA 2IZJA 4L3RA 3SLJA 2BDLA 4G54A 4TKBA 2RTJA 4YMYA 1X8OA 5AJCA 1S4VA 2ARYA 3OF9A 5F58A 1VSNA 4A60A 4OS3A 4ES7A 3S3QA 4D8BA 5JA7A 3NQ3A 2R9MA 3W30A 3B2IA 1PXVA 2ACOA 2P8GA 4UU3A 1IKEA 2OFBA 1PCIA 3U0DA 1TXLA 1GKAB 2QM9A 4IB7A 5IO6A 1MS6A 1JJJA 4O49A 2CM9A 3VG7A 2DZYA 5J94A 3PHUA 5JH3A 4HWYA 5D48A 1YWDA 1X8PA 4OS8A 3HK1A 4PP2E 2BHVA 5AEOA 4RUNA 3PEDA 3PQUA 2J7QA 1IW2A 4WFUA 5F7GA 3SZJA 3SOTA 3ZW2A 4KCAA 1JZUA 1VWNB 1KOIA 5L3YA 2BS6A 1DZMA 1U9QX 2AS8A 1A57A 3JSQA 1EIOA 1VWRB 4U3QA 1QABE 1SY2A 2L9CA 4MZOA 2DJGB 2IPPB 1VWAB 4D8EA 1DFVA 2O6XA 5FQ7E 1EWMA 3I0AA 3WJDA 3H89A 2HNXA 4AZMA 1PMPA 3PECA 1QXPA 2VHSA 2YJ8A 3FYFA 2B1MA 1NC9A 4Z2VA 3K9MA 1G74A 4YBUA 4EXZA 4I60A 2OF9A 4OS0A 2OFRX 1BGOA 4YFPA 3APWA 3ELXA 2RTNB 1RSTB 2WWPA 3NPOA 3RSWA 2RTPB 4NP1A 2OY5O 2ZSCA 3WJBA 1AVGI 4ZFXA 1SXUA 2FRAA 4AZRA 3QSDA 4PADA 4WURA 3RVVA 5PADA 1NL6A 1PBHA 2QOMA 3H8CA 2OF8A 1SWSA 4PJ2A 4PP1A 1ALBA 4EKVA 2F09A 2AMMX 1YVBA 4AZPA 1EXSA 4FK5A 2FS6A 1BSYA 3HHAA 1SRGA 1UKFA 2AUZA 3P02A 1MEGA 5CHKA 4AZNA 2ACPX 5CHVA 2KW1A 1ME4A 4BOEA 4YYWA 2RCTA 4TLJA 1TL9A 4NLIA 2Z4IA 1MEMA 1SWRA 2HWKA 5FFHA 3RNVA 4CDCA 1PBYA 3FEPA 2IFBA 2CZUA 2DJFB 1LIFA 3T6FA 2AKQA 4XR7A 4IUMA 1PIPA 2JQFR 5B11O 5F02A 3IFBA 4K19A 2UZ2A 1EPAA 3S3RA 1IFBA 1KT5A 4O4UA 1RBPA 5IO5A 4Q8GA 2LFOA 4U8UN 2BTWA 2E03A 1GXAA 4CDCB 5FQ6E 3I3TA 2AT8X 2P7UA 4Z2PA 1PADA 3EBWA 1DZPA 4GZVA 1LIDA 4ODDA 1STRB 4N8WA 5FAZA 4CSBA 2DC7A 2BC3A 2FT9A 3IFUA 3H6SA 2GTFX 2NQAA 3FA7A 5H9NA 2HZRA 1CJLA 1VWLB 2HZQA 3B2JA 2YJCA 4RF1A 4M6SA 3UEWA 5JD2A 4LZUA 3PHWA 1CBSA 1SWDA 1UYOX 3LV4A 4Y5DA 3F8AA 4BCSA 3KWZA 2HMBA 1ML7A 4WHIA 5F6ZA 1CBQA 2P0RA 4BOPA 2L68A 1LNMA 2E01A 3GE2A 1ZNEA 2RTEB 1AU3A 3BBAA 3NR3A 1GCBA 2JTCA 3DF0A 1A18A 1LPJA 1VWBB 1CQDA 2F7DA 3T2WA 4ZCBA 1U17A 4XMHA 3PH5A 3HD3A 3S5VA 4KC7A 2XU3A 2I5VO 2DC9A 3SAOA 2R9NA 2X34A 3BRNA 3FR2A 3BY0A 1KL4A 1GT4A 2C4IA 2W2FA 2H7JA 3RBYA 1DZJA 2AYNA 5EF4A 4GRJA 1T68X 2R9CA 1AELA 2AGAA 2CZTA 3RDMA 4A1YA 2RTCB 3MBTA 3PRPA 1KFUL 5EEDA 1FJ1E 4HPDA 2CB5A 4KLBA 4ZHGA 1G7NA 1O8VA 1NP1A 2FHLA 4MEEA 1T0VA 2MO5A 3PRMA 5CVMA 2Y6EA 3O1GA 1L6MA 2RTIB 3EYCA 2G7YA 2GH7A 1UREA 3MM0A 1OPAA 1PM1X 2B1NA 1K3BA 3B2LA 1DF3A 2AVWA 1KT7A 4YCHA 3FIQA 3BC3A 2Q2PA 4ARHA 2XU5A 3P6CA 4X6JA 1KL5A 1I04A 2FLJA 5B10O 4GE1A 5LKFA 2G5LA 5CYBA 2IZKA 1Q6KA 1AYWA 5EZQA 4O3ZA 1B56A 4P16A 3FR5A 3P6EA 2Q39A 1CB5A 1TOUA 1OEJA 1K3BB 5F2BA 4YVBA 3D95A 1Y55X 1OPBA 2FYEA 5HZ6A 2RTBB 1DF0A 1HXZA 5EEEA 5HTEA 3WJEA 1NLJA 2VFBA 1SRIA 1UZ2X 3Q34A 3DSZA 3GCBA 3Q6LA 3OD9A 1XKGA 2OZQA 3VHHA 2Y3FA 3P6GA 1PVJA 4A1HA 4CZWA 2NNQA 4BVMA 2PBHA 5KICA 3KWBX 1U0XA 4L1NA 1MIRA 1ZNLA 5IXGA 1OSPO 1KGLA 4REZA 2OP3A 3WXQA 2R74A 4YDBA 1AVEA 3FENA 1FEMA 1GLOA 4OW0A 3WXEA 3F75A 1MX8A 5BVQA 1KQXA 3BOWA 5KHPA 1LCZA 1N9MA 2FHNX 1D2UA 4IB6A 4W5BA 4XMFA 4QZTA 2IZFB 3IV2A 4BOZA 1SWOA 4MIRA 2UZJA 2A2GA 1SWUA 3BX7A 4TNNA 1NQCA 1JMZA 3KFFA 1ACDA 3BB7A 2ACTA 4ORYA 5FPWA 4YGHA 1OBPA 4GGRA 3PT2A 3VG3A 1CJ5A 3SLTA 2O62A 3RKGA 1SWEA 2JW1A 4M0WA 3KVNA 3WJCA 1SWQA 1DEUA 4GH7A 4QH6A 4WFVA 3VPJE 4JGLA 1E06A 4OMXA 4MVKA 3UEXA 3ZWEA 1K24A 3LXSA 1NQNA 4D8IA 2KTSA 1CV8A 3ZUIA 2CM4A 4OMWA 1JV4A 4LQZA 4I05A 1PE6A 3BPFA 4HPAA 1HMSA 2QCBA 3BSZE 2LBAA 1PEEA 1U9XA 2HLVA 1VYOA 3RWXA 3BWKA 2OYBO 1HQPA 4AYHA 1YP7A 3EW1A 5CVOB 2GTLM 2OL6O 5L8OA 2WQAE 3JS1A 5EGWA 1SRHA 1LICA 1SP4B 1A6RA 4X6IA 2DOSA 3FIDA 3N3GA 1FE3A 4Y0SA 3SZHA 1MVGA 3DTQA 2RTMA 5HA1A 4B55A 3K3LA 3CKGA 1MX7A 3MTVA 2C0YA 4HWMA 2R73A 2A5CA 2FR3A 2Z84A 1N4JA 2BT9A 1GMYA 5EPQA 3JQOA 2I5ZO 3OJYC 2KT4B 3OBLA 5H8TA 3E3CA 2X56A 1I05A 1UYNX 3LTWA 2DJGA 4Z6JA 1PPNA 4ORWA 3CH2X 5D4AA 1FELA 4FIPA 3RDQA 3SLOA 1QOLA 4QRGA 1AB0A 2P86A 1POPA 1HY2A 4EDEA 5JR8A 5HZQA 1QY0A 3APXA 2PREA 1SWTA 1SXWA 3N91A 3BX8A 1SY0A 4Q8HA 2AF5A 4PT5A 3PDFA 4IAWA 1SY3A 2X32A 4QGVA 1RXJA 2G6DA 1MK5A 3CBJA 2AU1A 2A3FX 1GT5A 2QOSC 3QQ2A 3PH6A 4ID2A 2RTLA 3VE1A 4HPBA 3VHMA 1JQPA 3WXGA 4N4ZA 1KFFA 1HBPA 3UEVA 1FDQA 2UYWA 2DCDA 1BP4A 2KD2A 1YIVA 1W4TA 2A13A 2DCAA 4Y0PA 4IB9A 3FA9A 4N7CA 2ASNX 4LKTA 1I4UA 5E6JA 3FEKA 1X71A 4BPVA 4MM3B 2FRQA 1SA8A 2GTLO 1HMTA 2OFMX 4KC8A 3PP6A 1LIEA 4YH0A 3IUTA 2ZAGA 1VWCB 2L67A 4Y0QA 2Y5BA 3STKA 2R9OA 4ORRA 3RE6A 1SY1A 1SWFA 1ZNKA 2GC9A 4ZHCA 2CBSA 5EZSA 5K67A 2Q9SA 2DJFA 1VWJB 3OQCA 2WR6A 4ZH9A 2FKJA 4EEJA 1B4MA 2YG2A 4BS6A 2A0AA 2QMIA 2NNEA 1RLBE 4JHQA 4CDFA 3VG6A 2RA6A 4PSQA 4BX7A 2YMSA 1G5WA 4YBPA 2JOZA 2MM3A 4MZSA 3HWDA 4IMOA 2AYOA 2FQ9A 5IO7A 1F2BA 3KX1A 1KHQA 3D6SA 4RY2A 4ZR2A 4JO6A 1AYUA 2IZLB 1SWHA 5HAEA 1QMYA 4D6AA 2W2AA 2EU7X 2FT2A 3TGBA 4CDFB 3WZQA 2CIOA 2JMBA 3STMX 4BQVA 1GT1A 1H91A 4BX7B 1IKJA 1EWPA 3BY4A 3NX2A 4QGXA 3FR4A 1KXRA 4BBOA 3WJFA 1JBHA 3RY1A 2YJ9A 4XMGA 2ALLX 3WXFA 4QGWA 5C0NA 4FGIB 3IMAA 2K62A 3WJGA 4LKPA 2ZAIA 5KO3A 1X89A 3HHIA 4X6HA 4QYPA 4QYNA 1EF7A 4RF0A 4YYRA 1HN2A 2X8TA 3NADA 4XUIA 2L5PA 3MHHA 2PY1A 4BS5A 1OBUA 1O0EA 3BU9A 2NQDB 1QFTA 2BDZA 4GU8A 1Y08A 1LUQA 1GECE 2K23A 4AXMA 3ZUOA 4U46A 1QDQA 3CR6A 3EMMA 1LDOA 1BY8A 2CBRA 4N79A 4GJVA 3NX1A 5LKEA 3FA6A 1JJUA 4W5CA 4MVIA 1R0UA 2XSTA 2DC6A 1SLGB 3KQ0A 1W6FA 1WBIA 5FQ8E 4YV8A 3RDUA 2NNDA 5B5GA 2PNSA 3PHXA 1N9YA 3P5UA 3TMPA 1SLFB 2QO6A 5LJGA 3FA8A 1AECA 2Q2MA 1CRBA 5EDCA 1N0SA 5D45A 4QZUA 3TNXA 2F1GA 1SNKA 2R6NA 4GK9A 2HD5A 1VWGB 1VWHB 1U9VA 4I3CA 2MJIA 4DQ4A 2Z4HA 1YK8A 1TW4A 1LDQA 4GGTA 2YJBA 1HUCB 3KW9A 1VWMB 5D8JA 3VG4A 1U18A 4RUUA 4XMDA 1PPPA 3NP1A 4ML7B 1E00A 3O0UA 3KFIA 4KT5A 2X45A 5CSEA 3KFHA 4IP3A 1KZWA 2IBIA 3C9EA 9PAPA 4DMXA 5H9AA 1RSUB 4OKAA 1SWNA 2HYSA 3LFYA 1A3YA 2E02A 2E4JA 1LKEA 3C0RA 3D96A 5B2AO 5IRWA 4IBAA 2IZDB 1STFE 3VGWA 5B27A 2AH7X 1VYFA 1U9WA 3C76X 3FW4A 3BLGA 3STNA 4I95A 5HZ8A 3ZZVA 1YZBA 4TKHA 3PPTA 2OVEA 1E02A 1YWCA 4IB8A 1VWDB 4Z27A 5HCDC 2F01A 4OEMA 4M7MA 1X8UA 5K16A 3IOQA 1QQSA 1MDWA 2IZEB 2IZAA 5DG4A 3PW3A 3FDCA 3U9PC 4I9SA 1ITOA 1AU2A 1S2PA 5B5FA 4JNJA 3VG2A 3S5XA 3ZI8A 2WSJA 2FUDA 1YALA 3RY2A 1STPA 5LJBA 1ZRYA 1SWLA 1EUOA 1BJ7A 1EWOA 2AL0X 2FTBA 1TVQA 4XMEA 3VHIA 2RN4A 3P5WA 1SWBA 2A2UA 2OVSA 1AYVA 5B3MO 3X00A 3EW2A 1GX3A 4O3YA 4IMNA 4ZTBA 1GX9A 2R56A 3EC5A 3HWFA 2OY8A 3PSEA 1BLRA 2WQ9A 3AI8A 4Y0RA 2JRIA 4OVZA 2NQGA 3O2YA 1P6PA 1MM9A 2POAA 1CVZA 4FBOA 4I04A 2DCCA 3IHPA 1CBRA 1VWQB 1X8NA 1HXLA 2C1QA 1VYGA 3SZIA 1PPDA 1YWAA 3WZOA 3TRKA 2X8FA 4CDEA 8PCHA 4QBBA 2HKDA 3HOEA 7PCKA 4LZVA 1EI5A 1VWIB 1MOYA 1NB3A 3AKNA 5HA0A 1Z24A 4NNSA 5LJDA 2CAMA 2GHUA 2HHNA 1ICNA 1ZNDA 4OVZB 3CQNA 3UEUA 2PI3O 2X4MA 3RVXA 4GETA 1SWKA 4YCEA 2XU1A 2QO4A 4P6EA 2LB6A 4QRLA 2Q4NA 3RE5A 3TGAA 1Y9TA 1CSBB 4CDEB 4YGZA 1QFVA 4MVLA 3WZPA 4O4OA 5LJCA 1VWKB 3APVA 1XKIA 4ALOA 3C77X 2G8JA 4GNYA 4ALBA 1VPRA 1CTEA 2IZHB 2WPUA 2ATOA 4Z2OA 3PQSA 3WYQA 4RNAA 2RTHB 2FKGA 6PADA 5A24A 1IIUA 1IFCA 4ORUA 1Y9LA 3FMZA 4KH8A 3CH3X 1EALA 2OFAA 2WEWA 2BS5A 1YWBA 1SRFA 1STSB 4COTA 1F29A 2HXZA 1FENA 3P6HA 5B29A 4Z28A 1IWDA 3C78X 4AZQA 4MVEA 1YP6A 1VJVA 3CQRA 3TF6A 2RD7C 2VHFA 5KIDA 1I9HA 4R0BA 3T2XA 2GJ5A 4GDZA 4ZHHA 2A8GA 2WEXA 4W4UA 3I17A 2OL8O 1ZNGA 1ZNHA 1YT7A 3OISA 2RTFB 4I07A 3MP2A 5EZ2A 4IAXA 1AU4A 1X8QA 4HXDB 2QO5A 1KFXL 2JU7A 1NGLA 1CS8A 3P5VA 2F73A 4AXLA 3T6LA 3D9WA 3N4CA 4QRXA 1ADLA 2MF6A 5F6BA 3O22A 3TZSA 1VWEB 1ME3A 3NQ9A 1KL3A 4GUAA 3UAQA 3W31A 1BSOA 4ORSA 1D3SA 4BOQA 1ZCMA 1I78A 1G85A 2JGSA 1B0OA 2AIMA 4YDAA 3IA8A 1BSQA 4U8UM 1SWAA 4FJCA 3TGCA 1X9YA 4BOSA 1DC9A 3GAQA 3P5XA 4O9SA 1KZXA 3QJ3A 3MORA 4BX5A 1FH0A 3HWNA 2BLGA 1O1VA 3OVXA 3H8BA 4IRWA 5LJKA 5IRUA 4AZOA 3MTNA 3E1ZB 1MUPA 1SWJA 5L8IA 4HFOA 1RXKA 4HPCA 4O4SA 1S44A 3AUMO 1JJXA 1LELA 1QWDA 1NB5A 1EPBA 3OF8A 3N3KA 1MDCA 2GTLN 4BX5B 2OZ2A 3P6DA 4GDAA 4CPHA 3WVMA 2OVDA 3EM0A 2DCBA 5CE4A 4ZUXU 2JU3A 1LCVA 1Y53X 2RTQB 1PPOA 4GKCA 3CKFA 1TOWA 2IZBA 5HCCC 3PNRA 3I06A 4XMCA 3OVZA 2IZCB 4YKOA 2FRSA 4YFRA 1TU6A 3RDXA 2RTGB 4CPHB 5K68A 1O1UA 4FBRA 4ZHDA 2RTAA 1GM6A 2ANSA 4ON1A 3WYPA 4FBVA 1Y4HA 3HPEA 2R9FA 1BQIA 1HBQA 1N43A 4BSQA 4IABA 3KKUA 1AQBA 4EFGA 4NYQA 1DKIA 1KHPA 2FWVA 2OULA 1LIBA 4A8ZA 1AIMA 2AT0X 3D4RA 1EWLA 3FLLA 3KFQA 4NLJA 4BJ8A 4U8UO 1BM5A 3AEHA 3VE2A 1F2CA 3IEJA 2WUTA 1SLDB 4YKMA 3BPMA 1OEKA 1AU0A 1QY2A 1JYDA 4RKXA 5BVSA 5CHTA 3E9SA 2MWHA 3P24A 4U9CA 1BWYA 3KZAA 1ATKA 1B8EA 2G8CO 4GUZA 4TKJA 3CBCA 3MVFA 3FELA 1GT3A 4CPFA 1ICFA 1DZKA 4YYQA 3AKMA 1S7DA 4TQ2A 4I3BA 2BTWB 4YFQA 1NDJA 2X46A 2GFOA 1SWCA 2KTDA 4BGFA 1KXOA 3B79A 1FTPA 3RDSA 4MSXA 4ZHFA 3RZYA 1MHWA 3KSEA 5L8NA 4GGZA 3OE3A 1EIIA 3RDOA 3MJ5A 2OY1O 4MISA 2LA7A 2DC8A 2X8SA 4NV8A 1LF7A 4O4XA 2FTDA 4YYUA 3EBKA 3U03A 4CDDA 1BEBA 1ERBA 1E5PA 3APUA 1DV9A 2W2BA 1Y0GA 4QNIA 3CWKA 2YJ2A 5H9LA 5HBSA 1EW3A 3M99A 3ZUAA 2DM5A 3KFGA 3CBSA 4ZGFA 4BOUA 1T8VA 2VFCA 4DMYA 4YYSA 4FQBB 2WBFX 1SRJA 3D97A 3B21A 2JQGR 2NQIA 3BCNA 4BX6A 4I6SA 3QT4A 4WA6A 4NYRA 2MHDA 3F5VA
chains in the Genus database with same CATH topology
4QRGA 2P86A 1POPA 4CDCA 4CDDB 1PPDA 2DJFB 4CDEA 8PCHA 4QBBA 4XR7A 2PREA 4NV7A 7PCKA 1NB3A 1PIPA 3PBHA 2JQFR 5F02A 2GHUA 4Q8HA 2HHNA 3S3RA 3V6CA 3PDFA 1E2TA 2G6DA 3RVXA 4Q8GA 3CBJA 2AU1A 3K24A 2XU1A 3CBKA 2E03A 4P6EA 4CDCB 3I3TA 1CSBB 1F2AA 4CDEB 2P7UA 1JQPA 3WXGA 4N4ZA 1PADA 4N8WA 2DC7A 2G8JA 3H6SA 2XU4A 2DCDA 1BP4A 3RVWA 1CTEA 2NQAA 2ATOA 1W4TA 2BSZA 1CJLA 2HH5A 2DCAA 2YJCA 6PADA 5A24A 3V6EA 3MHSA 5CVNB 4BPVA 2FRQA 3USVA 1YK7A 3CH3X 3KWZA 4PI3A 3IUTA 2P0RA 2E01A 2Y5BA 2R9OA 1F29A 1AU3A 2HXZA 1GCBA 3DF0A 1IWDA 3U8EA 2DJFA 1VJVA 1CQDA 2F7DA 2VHFA 4BS6A 3HD3A 3H7DA 2XU3A 2DC9A 2R9NA 4CDFA 4K7CA 4W4UA 1ZIVA 2H7JA 4YVAA 1YT7A 3OISA 2AYNA 4I07A 5EF4A 3ERVA 2R9CA 1AU4A 4MZSA 2AYOA 2FQ9A 1KFUL 1F2BA 3NHEA 3KX1A 1KHQA 1KFXL 2FO5A 3D6SA 2CB5A 1CS8A 1THEA 3P5VA 4KLBA 4RY2A 1NPZA 4AXLA 1AYUA 1M6DA 2DZZA 5CVMA 3D9WA 1QMYA 3N4CA 4QRXA 2Y6EA 2FT2A 3O1GA 2G7YA 4CDFB 2G8EA 1ME3A 2CIOA 4BQVA 1CPJA 1ZCMA 1EWPA 2B1NA 1K3BA 1KXRA 2AIMA 2AVWA 2YJ9A 3WXFA 3BC3A 3K8UA 4FJCA 3IMAA 1X9YA 2XU5A 4X6JA 3P5XA 2PADA 3HHIA 4X6HA 1EF7A 4YYRA 3QJ3A 3MORA 4XUIA 3MHHA 1Q6KA 4BS5A 1FH0A 3HWNA 4C5PA 4YYVA 1AYWA 3OVXA 3H8BA 1O0EA 1CB5A 2NQDB 3MTNA 3E1ZB 1K3BB 2BDZA 1TLOA 1Y08A 1GECE 4AXMA 1QDQA 2FYEA 1BY8A 4N79A 1DF0A 1NB5A 1NLJA 4W5CA 2VFBA 1W5RA 3OF8A 3N3KA 2DC6A 2OZ2A 3GCBA 1W6FA 4YV8A 1XKGA 2AUXA 2E00A 2PNSA 4QRVA 3P5UA 4CZWA 4P6GA 2DCBA 4ZUXU 2PBHA 4OELA 1AECA 1U5IA 3KWBX 1PPOA 1MIRA 2BDLA 4G54A 3TNXA 2F1GA 3PNRA 1SNKA 3I06A 2R6NA 2HD5A 3OVZA 1S4VA 2OP3A 2ARYA 3OF9A 1VSNA 1U9VA 1YK8A 3S3QA 5JA7A 1TU6A 2R9MA 2YJBA 1PXVA 1GLOA 3WXEA 1HUCB 3F75A 3KW9A 3BOWA 1PCIA 1PPPA 3O0UA 1Y4HA 4W5BA 3IV2A 2R9FA 1BQIA 1MS6A 2IBIA 3C9EA 4BSQA 9PAPA 2DZYA 3KKUA 5J94A 4DMXA 1NQCA 5JH3A 4HWYA 1KHPA 3LFYA 2E02A 2ACTA 5FPWA 4PP2E 2OULA 1AIMA 1EWLA 1DEUA 1U9QX 3KFQA 1STFE 4QH6A 2AS8A 1U9WA 4MZOA 2DJGB 2IPPB 1F2CA 2O6XA 3IEJA 3LXSA 4OEMA 1EWMA 1CV8A 5K16A 3BPMA 3H89A 1AU0A 3IOQA 5CHTA 1QXPA 2VHSA 2YJ8A 1MDWA 4I05A 2B1MA 1PE6A 3PW3A 1ATKA 1ITOA 1AU2A 3BPFA 4GUZA 3K9MA 1ICFA 1U9XA 4YYQA 3BWKA 2FUDA 1BGOA 1YALA 5CVOB 2GFOA 4BGFA 5EGWA 3B79A 1SP4B 1A6RA 4MSXA 1MHWA 1EWOA 4X6IA 3KSEA 2FRAA 3N3GA 3QSDA 4PADA 3RVVA 5PADA 1NL6A 3P5WA 2DC8A 1PBHA 4NV8A 3H8CA 2FTDA 1AYVA 4B55A 4YYUA 4PP1A 1YVBA 4CDDA 1GX3A 2C0YA 4FK5A 1GMYA 2YJ2A 3HHAA 3M99A 2AUZA 3ZUAA 1MEGA 2VFCA 4DMYA 4YYSA 3AI8A 5CHVA 1ME4A 2WBFX 4YYWA 2NQGA 2JQGR 2NQIA 3BCNA 1TL9A 3LTWA 1CVZA 3QT4A 4WA6A 1MEMA 2DJGA 1PPNA 3CH2X 4FIPA 4I04A 2DCCA 1QOLA 3IHPA 3F5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRG A;  2P86 A;  1POP A;  4CDC A;  4CDD B;  1PPD A;  2DJF B;  4CDE A;  8PCH A;  4QBB A;  4XR7 A;  2PRE A;  7PCK A;  1NB3 A;  1PIP A;  3PBH A;  2JQF R;  5F02 A;  2GHU A;  4Q8H A;  2HHN A;  3S3R A;  3V6C A;  3PDF A;  2G6D A;  3RVX A;  4Q8G A;  3CBJ A;  2AU1 A;  3K24 A;  2XU1 A;  3CBK A;  2E03 A;  4P6E A;  4CDC B;  3I3T A;  1CSB B;  1F2A A;  4CDE B;  2P7U A;  1JQP A;  3WXG A;  4N4Z A;  1PAD A;  4N8W A;  2DC7 A;  2G8J A;  3H6S A;  2XU4 A;  2DCD A;  1BP4 A;  3RVW A;  1CTE A;  2NQA A;  2ATO A;  1CJL A;  2HH5 A;  2DCA A;  2YJC A;  6PAD A;  5A24 A;  3V6E A;  3MHS A;  5CVN B;  4BPV A;  2FRQ A;  3USV A;  1YK7 A;  3CH3 X;  3KWZ A;  4PI3 A;  3IUT A;  2P0R A;  2E01 A;  2Y5B A;  2R9O A;  1F29 A;  1AU3 A;  2HXZ A;  1GCB A;  3DF0 A;  1IWD A;  3U8E A;  2DJF A;  1VJV A;  1CQD A;  2F7D A;  2VHF A;  4BS6 A;  3HD3 A;  3H7D A;  2XU3 A;  2DC9 A;  2R9N A;  4CDF A;  4K7C A;  4W4U A;  1ZIV A;  2H7J A;  4YVA A;  1YT7 A;  3OIS A;  2AYN A;  4I07 A;  5EF4 A;  3ERV A;  2R9C A;  1AU4 A;  4MZS A;  2AYO A;  2FQ9 A;  1KFU L;  1F2B A;  3NHE A;  3KX1 A;  1KHQ A;  1KFX L;  2FO5 A;  3D6S A;  2CB5 A;  1CS8 A;  1THE A;  3P5V A;  4KLB A;  4RY2 A;  1NPZ A;  4AXL A;  1AYU A;  1M6D A;  2DZZ A;  5CVM A;  1QMY A;  3N4C A;  4QRX A;  2Y6E A;  2FT2 A;  3O1G A;  2G7Y A;  4CDF B;  2G8E A;  1ME3 A;  2CIO A;  4BQV A;  1CPJ A;  1ZCM A;  1EWP A;  2B1N A;  1K3B A;  1KXR A;  2AIM A;  2AVW A;  2YJ9 A;  3WXF A;  3BC3 A;  3K8U A;  4FJC A;  3IMA A;  1X9Y A;  2XU5 A;  4X6J A;  3P5X A;  2PAD A;  3HHI A;  4X6H A;  1EF7 A;  4YYR A;  3QJ3 A;  3MOR A;  4XUI A;  3MHH A;  1Q6K A;  4BS5 A;  1FH0 A;  3HWN A;  4YYV A;  1AYW A;  3OVX A;  3H8B A;  1O0E A;  1CB5 A;  2NQD B;  3MTN A;  3E1Z B;  1K3B B;  2BDZ A;  1TLO A;  1Y08 A;  1GEC E;  4AXM A;  1QDQ A;  2FYE A;  1BY8 A;  4N79 A;  1DF0 A;  1NB5 A;  1NLJ A;  4W5C A;  3OF8 A;  3N3K A;  2DC6 A;  2OZ2 A;  3GCB A;  4YV8 A;  1XKG A;  2AUX A;  2E00 A;  2PNS A;  4QRV A;  3P5U A;  4CZW A;  4P6G A;  2DCB A;  4ZUX U;  2PBH A;  4OEL A;  1AEC A;  1U5I A;  3KWB X;  1PPO A;  1MIR A;  2BDL A;  4G54 A;  3TNX A;  2F1G A;  3PNR A;  1SNK A;  3I06 A;  2R6N A;  2HD5 A;  3OVZ A;  1S4V A;  2OP3 A;  2ARY A;  3OF9 A;  1VSN A;  1U9V A;  1YK8 A;  3S3Q A;  5JA7 A;  1TU6 A;  2R9M A;  2YJB A;  1PXV A;  1GLO A;  3WXE A;  1HUC B;  3F75 A;  3KW9 A;  3BOW A;  1PCI A;  1PPP A;  3O0U A;  1Y4H A;  4W5B A;  3IV2 A;  2R9F A;  1BQI A;  1MS6 A;  2IBI A;  3C9E A;  4BSQ A;  9PAP A;  2DZY A;  3KKU A;  5J94 A;  4DMX A;  1NQC A;  5JH3 A;  4HWY A;  1KHP A;  3LFY A;  2E02 A;  2ACT A;  5FPW A;  4PP2 E;  2OUL A;  1AIM A;  1EWL A;  1DEU A;  1U9Q X;  3KFQ A;  1STF E;  4QH6 A;  2AS8 A;  1U9W A;  4MZO A;  2DJG B;  2IPP B;  1F2C A;  2O6X A;  3IEJ A;  3LXS A;  4OEM A;  1EWM A;  1CV8 A;  5K16 A;  3BPM A;  3H89 A;  1AU0 A;  3IOQ A;  5CHT A;  1QXP A;  2VHS A;  2YJ8 A;  1MDW A;  4I05 A;  2B1M A;  1PE6 A;  3PW3 A;  1ATK A;  1ITO A;  1AU2 A;  3BPF A;  3K9M A;  1ICF A;  1U9X A;  4YYQ A;  3BWK A;  2FUD A;  1BGO A;  1YAL A;  5CVO B;  2GFO A;  5EGW A;  3B79 A;  1SP4 B;  1A6R A;  4MSX A;  1MHW A;  1EWO A;  4X6I A;  3KSE A;  2FRA A;  3N3G A;  3QSD A;  4PAD A;  3RVV A;  5PAD A;  1NL6 A;  3P5W A;  2DC8 A;  1PBH A;  3H8C A;  2FTD A;  1AYV A;  4YYU A;  4PP1 A;  1YVB A;  4CDD A;  2C0Y A;  4FK5 A;  1GMY A;  2YJ2 A;  3HHA A;  3M99 A;  2AUZ A;  3ZUA A;  1MEG A;  4DMY A;  4YYS A;  3AI8 A;  5CHV A;  1ME4 A;  2WBF X;  4YYW A;  2NQG A;  2JQG R;  2NQI A;  3BCN A;  1TL9 A;  1CVZ A;  3QT4 A;  4WA6 A;  1MEM A;  2DJG A;  1PPN A;  3CH2 X;  4FIP A;  4I04 A;  2DCC A;  1QOL A;  3IHP A;  3F5V A; 
#chains in the Genus database with same CATH topology
 1QG5 A;  1Y52 X;  4CDD B;  2AVI A;  2G7B A;  4NV7 A;  3NBX X;  1AVD A;  3PBH A;  5HZ5 A;  1OEE A;  1JMX A;  1SWG A;  2NP1 A;  2JU8 A;  3L4R A;  2Y3E A;  2BU3 A;  5DPQ A;  4NNT A;  4XZX A;  2OL7 A;  3V6C A;  1VWO B;  1VWF B;  2G79 A;  4BX6 B;  3F6Z B;  3FW5 A;  1E2T A;  4ORX A;  3PK2 A;  1WUB A;  3H3I A;  1SMP I;  3NQK A;  3K24 A;  2C1S A;  3CBK A;  3B2H A;  2IZG B;  3F9D A;  3S60 A;  2XKL A;  3ZNH A;  4D6B A;  1F2A A;  1SXX A;  1SLE B;  1SXY A;  1JIW I;  4WBK A;  4EQA C;  4N7D A;  2A5B A;  4R3D A;  1LFO A;  2N93 A;  4AW8 A;  1A2D A;  2RCQ A;  1I06 A;  3VG5 A;  2XU4 A;  3RVW A;  5HTD A;  3O65 A;  3BS2 A;  2RTR B;  2RTO B;  1XCA A;  3LHN A;  3QKG A;  1BRQ A;  2BSZ A;  1N7Y A;  2HH5 A;  3WOV A;  4ZGU A;  1KT3 A;  3ZQ3 A;  3CMP A;  1DF8 A;  1GGL A;  2LKK A;  3V6E A;  3MHS A;  5CVN B;  5AJB A;  4INN A;  4UU2 A;  3USV A;  5F1E A;  1YK7 A;  1GX8 A;  1HQQ A;  4PI3 A;  1RXH A;  5D47 A;  2FGS A;  2X55 A;  5JZE A;  2G78 A;  4GJS A;  4BQU A;  3HWE A;  3ELZ A;  2OY7 A;  4I9R A;  1SRE A;  3ZW1 A;  3U8E A;  5LJE A;  2FE8 A;  1CBI A;  1RAV A;  3H7D A;  3HOL A;  4CK4 A;  2FR2 A;  4K7C A;  1KQW A;  1ZIV A;  2AT5 X;  2FS7 A;  2VDF A;  4YVA A;  4ZH6 A;  4GD9 A;  1KT4 A;  1ICM A;  2IZI A;  4CPI A;  3ERV A;  5BYP A;  4DCB A;  4NW4 A;  2AT3 X;  3NHE A;  3P6F A;  3ZW1 B;  2FO5 A;  4TJZ A;  4O3W A;  1THE A;  2JN3 A;  1NPZ A;  2AT6 X;  4GNW A;  1OBQ A;  1M6D A;  2DZZ A;  1PBO A;  3ZW0 A;  3V8U A;  3T1D A;  2G8E A;  1HMR A;  4MI7 A;  1PTS A;  1NBX A;  1CPJ A;  1JYJ A;  4CV7 A;  3HTY A;  4KII A;  4A5U A;  2J7Q C;  4CPE A;  1VWP B;  4O3X B;  1SWP A;  1ERX A;  1IJ8 A;  3K8U A;  5FEN A;  3ZW0 B;  3MG5 A;  1MEP A;  1QY1 A;  2PAD A;  1YUP A;  3G7X A;  3HWG A;  5HZ9 A;  5K06 A;  2RQ0 A;  4C5P A;  1LCW A;  4YYV A;  2LBV A;  4DNE A;  3BU1 A;  3B2K A;  1NP4 A;  2RTD B;  3MX7 A;  1TLO A;  4ZJ0 A;  5BVT A;  5LJH A;  3S26 A;  3VU1 A;  3WZN A;  2Y32 A;  2OVA A;  1BBP A;  3O19 A;  5HCE C;  1EQD A;  2M4L A;  4DQ3 A;  1W5R A;  4YGG A;  4I3D A;  5H9K A;  3WBG A;  1KT6 A;  5AQ6 A;  2RTK A;  5HWZ A;  2AUX A;  2E00 A;  4QRV A;  3BDR A;  4QAE A;  5EDB A;  4P6G A;  1BRP A;  1GKA A;  4QQ1 A;  4Y59 A;  1NQM A;  4OEL A;  1U5I A;  5IRA A;  2IZJ A;  4L3R A;  3SLJ A;  2BDL A;  4G54 A;  4TKB A;  2RTJ A;  4YMY A;  1X8O A;  5AJC A;  1S4V A;  2ARY A;  3OF9 A;  5F58 A;  1VSN A;  4A60 A;  4OS3 A;  4ES7 A;  3S3Q A;  4D8B A;  5JA7 A;  3NQ3 A;  2R9M A;  3W30 A;  3B2I A;  1PXV A;  2ACO A;  2P8G A;  4UU3 A;  1IKE A;  2OFB A;  1PCI A;  3U0D A;  1TXL A;  1GKA B;  2QM9 A;  4IB7 A;  5IO6 A;  1MS6 A;  1JJJ A;  4O49 A;  2CM9 A;  3VG7 A;  2DZY A;  5J94 A;  3PHU A;  5JH3 A;  4HWY A;  5D48 A;  1YWD A;  1X8P A;  4OS8 A;  3HK1 A;  4PP2 E;  2BHV A;  5AEO A;  4RUN A;  3PED A;  3PQU A;  2J7Q A;  1IW2 A;  4WFU A;  5F7G A;  3SZJ A;  3SOT A;  3ZW2 A;  4KCA A;  1JZU A;  1VWN B;  1KOI A;  5L3Y A;  2BS6 A;  1DZM A;  1U9Q X;  2AS8 A;  1A57 A;  3JSQ A;  1EIO A;  1VWR B;  4U3Q A;  1QAB E;  1SY2 A;  2L9C A;  4MZO A;  2DJG B;  2IPP B;  1VWA B;  4D8E A;  1DFV A;  2O6X A;  5FQ7 E;  1EWM A;  3I0A A;  3WJD A;  3H89 A;  2HNX A;  4AZM A;  1PMP A;  3PEC A;  1QXP A;  2VHS A;  2YJ8 A;  3FYF A;  2B1M A;  1NC9 A;  4Z2V A;  3K9M A;  1G74 A;  4YBU A;  4EXZ A;  4I60 A;  2OF9 A;  4OS0 A;  2OFR X;  1BGO A;  4YFP A;  3APW A;  3ELX A;  2RTN B;  1RST B;  2WWP A;  3NPO A;  3RSW A;  2RTP B;  4NP1 A;  2OY5 O;  2ZSC A;  3WJB A;  1AVG I;  4ZFX A;  1SXU A;  2FRA A;  4AZR A;  3QSD A;  4PAD A;  4WUR A;  3RVV A;  5PAD A;  1NL6 A;  1PBH A;  2QOM A;  3H8C A;  2OF8 A;  1SWS A;  4PJ2 A;  4PP1 A;  1ALB A;  4EKV A;  2F09 A;  2AMM X;  1YVB A;  4AZP A;  1EXS A;  4FK5 A;  2FS6 A;  1BSY A;  3HHA A;  1SRG A;  1UKF A;  2AUZ A;  3P02 A;  1MEG A;  5CHK A;  4AZN A;  2ACP X;  5CHV A;  2KW1 A;  1ME4 A;  4BOE A;  4YYW A;  2RCT A;  4TLJ A;  1TL9 A;  4NLI A;  2Z4I A;  1MEM A;  1SWR A;  2HWK A;  5FFH A;  3RNV A;  4CDC A;  1PBY A;  3FEP A;  2IFB A;  2CZU A;  2DJF B;  1LIF A;  3T6F A;  2AKQ A;  4XR7 A;  4IUM A;  1PIP A;  2JQF R;  5B11 O;  5F02 A;  3IFB A;  4K19 A;  2UZ2 A;  1EPA A;  3S3R A;  1IFB A;  1KT5 A;  4O4U A;  1RBP A;  5IO5 A;  4Q8G A;  2LFO A;  4U8U N;  2BTW A;  2E03 A;  1GXA A;  4CDC B;  5FQ6 E;  3I3T A;  2AT8 X;  2P7U A;  4Z2P A;  1PAD A;  3EBW A;  1DZP A;  4GZV A;  1LID A;  4ODD A;  1STR B;  4N8W A;  5FAZ A;  4CSB A;  2DC7 A;  2BC3 A;  2FT9 A;  3IFU A;  3H6S A;  2GTF X;  2NQA A;  3FA7 A;  5H9N A;  2HZR A;  1CJL A;  1VWL B;  2HZQ A;  3B2J A;  2YJC A;  4RF1 A;  4M6S A;  3UEW A;  5JD2 A;  4LZU A;  3PHW A;  1CBS A;  1SWD A;  1UYO X;  3LV4 A;  4Y5D A;  3F8A A;  4BCS A;  3KWZ A;  2HMB A;  1ML7 A;  4WHI A;  5F6Z A;  1CBQ A;  2P0R A;  4BOP A;  2L68 A;  1LNM A;  2E01 A;  3GE2 A;  1ZNE A;  2RTE B;  1AU3 A;  3BBA A;  3NR3 A;  1GCB A;  2JTC A;  3DF0 A;  1A18 A;  1LPJ A;  1VWB B;  1CQD A;  2F7D A;  3T2W A;  4ZCB A;  1U17 A;  4XMH A;  3PH5 A;  3HD3 A;  3S5V A;  4KC7 A;  2XU3 A;  2I5V O;  2DC9 A;  3SAO A;  2R9N A;  2X34 A;  3BRN A;  3FR2 A;  3BY0 A;  1KL4 A;  1GT4 A;  2C4I A;  2W2F A;  2H7J A;  3RBY A;  1DZJ A;  2AYN A;  5EF4 A;  4GRJ A;  1T68 X;  2R9C A;  1AEL A;  2AGA A;  2CZT A;  3RDM A;  4A1Y A;  2RTC B;  3MBT A;  3PRP A;  1KFU L;  5EED A;  1FJ1 E;  4HPD A;  2CB5 A;  4KLB A;  4ZHG A;  1G7N A;  1O8V A;  1NP1 A;  2FHL A;  4MEE A;  1T0V A;  2MO5 A;  3PRM A;  5CVM A;  2Y6E A;  3O1G A;  1L6M A;  2RTI B;  3EYC A;  2G7Y A;  2GH7 A;  1URE A;  3MM0 A;  1OPA A;  1PM1 X;  2B1N A;  1K3B A;  3B2L A;  1DF3 A;  2AVW A;  1KT7 A;  4YCH A;  3FIQ A;  3BC3 A;  2Q2P A;  4ARH A;  2XU5 A;  3P6C A;  4X6J A;  1KL5 A;  1I04 A;  2FLJ A;  5B10 O;  4GE1 A;  5LKF A;  2G5L A;  5CYB A;  2IZK A;  1Q6K A;  1AYW A;  5EZQ A;  4O3Z A;  1B56 A;  4P16 A;  3FR5 A;  3P6E A;  2Q39 A;  1CB5 A;  1TOU A;  1OEJ A;  1K3B B;  5F2B A;  4YVB A;  3D95 A;  1Y55 X;  1OPB A;  2FYE A;  5HZ6 A;  2RTB B;  1DF0 A;  1HXZ A;  5EEE A;  5HTE A;  3WJE A;  1NLJ A;  2VFB A;  1SRI A;  1UZ2 X;  3Q34 A;  3DSZ A;  3GCB A;  3Q6L A;  3OD9 A;  1XKG A;  2OZQ A;  3VHH A;  2Y3F A;  3P6G A;  1PVJ A;  4A1H A;  4CZW A;  2NNQ A;  4BVM A;  2PBH A;  5KIC A;  3KWB X;  1U0X A;  4L1N A;  1MIR A;  1ZNL A;  5IXG A;  1OSP O;  1KGL A;  4REZ A;  2OP3 A;  3WXQ A;  2R74 A;  4YDB A;  1AVE A;  3FEN A;  1FEM A;  1GLO A;  4OW0 A;  3WXE A;  3F75 A;  1MX8 A;  5BVQ A;  1KQX A;  3BOW A;  5KHP A;  1LCZ A;  1N9M A;  2FHN X;  1D2U A;  4IB6 A;  4W5B A;  4XMF A;  4QZT A;  2IZF B;  3IV2 A;  4BOZ A;  1SWO A;  4MIR A;  2UZJ A;  2A2G A;  1SWU A;  3BX7 A;  4TNN A;  1NQC A;  1JMZ A;  3KFF A;  1ACD A;  3BB7 A;  2ACT A;  4ORY A;  5FPW A;  4YGH A;  1OBP A;  4GGR A;  3PT2 A;  3VG3 A;  1CJ5 A;  3SLT A;  2O62 A;  3RKG A;  1SWE A;  2JW1 A;  4M0W A;  3KVN A;  3WJC A;  1SWQ A;  1DEU A;  4GH7 A;  4QH6 A;  4WFV A;  3VPJ E;  4JGL A;  1E06 A;  4OMX A;  4MVK A;  3UEX A;  3ZWE A;  1K24 A;  3LXS A;  1NQN A;  4D8I A;  2KTS A;  1CV8 A;  3ZUI A;  2CM4 A;  4OMW A;  1JV4 A;  4LQZ A;  4I05 A;  1PE6 A;  3BPF A;  4HPA A;  1HMS A;  2QCB A;  3BSZ E;  2LBA A;  1PEE A;  1U9X A;  2HLV A;  1VYO A;  3RWX A;  3BWK A;  2OYB O;  1HQP A;  4AYH A;  1YP7 A;  3EW1 A;  5CVO B;  2GTL M;  2OL6 O;  5L8O A;  2WQA E;  3JS1 A;  5EGW A;  1SRH A;  1LIC A;  1SP4 B;  1A6R A;  4X6I A;  2DOS A;  3FID A;  3N3G A;  1FE3 A;  4Y0S A;  3SZH A;  1MVG A;  3DTQ A;  2RTM A;  5HA1 A;  4B55 A;  3K3L A;  3CKG A;  1MX7 A;  3MTV A;  2C0Y A;  4HWM A;  2R73 A;  2A5C A;  2FR3 A;  2Z84 A;  1N4J A;  2BT9 A;  1GMY A;  5EPQ A;  3JQO A;  2I5Z O;  3OJY C;  2KT4 B;  3OBL A;  5H8T A;  3E3C A;  2X56 A;  1I05 A;  1UYN X;  3LTW A;  2DJG A;  4Z6J A;  1PPN A;  4ORW A;  3CH2 X;  5D4A A;  1FEL A;  4FIP A;  3RDQ A;  3SLO A;  1QOL A;  4QRG A;  1AB0 A;  2P86 A;  1POP A;  1HY2 A;  4EDE A;  5JR8 A;  5HZQ A;  1QY0 A;  3APX A;  2PRE A;  1SWT A;  1SXW A;  3N91 A;  3BX8 A;  1SY0 A;  4Q8H A;  2AF5 A;  4PT5 A;  3PDF A;  4IAW A;  1SY3 A;  2X32 A;  4QGV A;  1RXJ A;  2G6D A;  1MK5 A;  3CBJ A;  2AU1 A;  2A3F X;  1GT5 A;  2QOS C;  3QQ2 A;  3PH6 A;  4ID2 A;  2RTL A;  3VE1 A;  4HPB A;  3VHM A;  1JQP A;  3WXG A;  4N4Z A;  1KFF A;  1HBP A;  3UEV A;  1FDQ A;  2UYW A;  2DCD A;  1BP4 A;  2KD2 A;  1YIV A;  1W4T A;  2A13 A;  2DCA A;  4Y0P A;  4IB9 A;  3FA9 A;  4N7C A;  2ASN X;  4LKT A;  1I4U A;  5E6J A;  3FEK A;  1X71 A;  4BPV A;  4MM3 B;  2FRQ A;  1SA8 A;  2GTL O;  1HMT A;  2OFM X;  4KC8 A;  3PP6 A;  1LIE A;  4YH0 A;  3IUT A;  2ZAG A;  1VWC B;  2L67 A;  4Y0Q A;  2Y5B A;  3STK A;  2R9O A;  4ORR A;  3RE6 A;  1SY1 A;  1SWF A;  1ZNK A;  2GC9 A;  4ZHC A;  2CBS A;  5EZS A;  5K67 A;  2Q9S A;  2DJF A;  1VWJ B;  3OQC A;  2WR6 A;  4ZH9 A;  2FKJ A;  4EEJ A;  1B4M A;  2YG2 A;  4BS6 A;  2A0A A;  2QMI A;  2NNE A;  1RLB E;  4JHQ A;  4CDF A;  3VG6 A;  2RA6 A;  4PSQ A;  4BX7 A;  2YMS A;  1G5W A;  4YBP A;  2JOZ A;  2MM3 A;  4MZS A;  3HWD A;  4IMO A;  2AYO A;  2FQ9 A;  5IO7 A;  1F2B A;  3KX1 A;  1KHQ A;  3D6S A;  4RY2 A;  4ZR2 A;  4JO6 A;  1AYU A;  2IZL B;  1SWH A;  5HAE A;  1QMY A;  4D6A A;  2W2A A;  2EU7 X;  2FT2 A;  3TGB A;  4CDF B;  3WZQ A;  2CIO A;  2JMB A;  3STM X;  4BQV A;  1GT1 A;  1H91 A;  4BX7 B;  1IKJ A;  1EWP A;  3BY4 A;  3NX2 A;  4QGX A;  3FR4 A;  1KXR A;  4BBO A;  3WJF A;  1JBH A;  3RY1 A;  2YJ9 A;  4XMG A;  2ALL X;  3WXF A;  4QGW A;  5C0N A;  4FGI B;  3IMA A;  2K62 A;  3WJG A;  4LKP A;  2ZAI A;  5KO3 A;  1X89 A;  3HHI A;  4X6H A;  4QYP A;  4QYN A;  1EF7 A;  4RF0 A;  4YYR A;  1HN2 A;  2X8T A;  3NAD A;  4XUI A;  2L5P A;  3MHH A;  2PY1 A;  4BS5 A;  1OBU A;  1O0E A;  3BU9 A;  2NQD B;  1QFT A;  2BDZ A;  4GU8 A;  1Y08 A;  1LUQ A;  1GEC E;  2K23 A;  4AXM A;  3ZUO A;  4U46 A;  1QDQ A;  3CR6 A;  3EMM A;  1LDO A;  1BY8 A;  2CBR A;  4N79 A;  4GJV A;  3NX1 A;  5LKE A;  3FA6 A;  1JJU A;  4W5C A;  4MVI A;  1R0U A;  2XST A;  2DC6 A;  1SLG B;  3KQ0 A;  1W6F A;  1WBI A;  5FQ8 E;  4YV8 A;  3RDU A;  2NND A;  5B5G A;  2PNS A;  3PHX A;  1N9Y A;  3P5U A;  3TMP A;  1SLF B;  2QO6 A;  5LJG A;  3FA8 A;  1AEC A;  2Q2M A;  1CRB A;  5EDC A;  1N0S A;  5D45 A;  4QZU A;  3TNX A;  2F1G A;  1SNK A;  2R6N A;  4GK9 A;  2HD5 A;  1VWG B;  1VWH B;  1U9V A;  4I3C A;  2MJI A;  4DQ4 A;  2Z4H A;  1YK8 A;  1TW4 A;  1LDQ A;  4GGT A;  2YJB A;  1HUC B;  3KW9 A;  1VWM B;  5D8J A;  3VG4 A;  1U18 A;  4RUU A;  4XMD A;  1PPP A;  3NP1 A;  4ML7 B;  1E00 A;  3O0U A;  3KFI A;  4KT5 A;  2X45 A;  5CSE A;  3KFH A;  4IP3 A;  1KZW A;  2IBI A;  3C9E A;  9PAP A;  4DMX A;  5H9A A;  1RSU B;  4OKA A;  1SWN A;  2HYS A;  3LFY A;  1A3Y A;  2E02 A;  2E4J A;  1LKE A;  3C0R A;  3D96 A;  5B2A O;  5IRW A;  4IBA A;  2IZD B;  1STF E;  3VGW A;  5B27 A;  2AH7 X;  1VYF A;  1U9W A;  3C76 X;  3FW4 A;  3BLG A;  3STN A;  4I95 A;  5HZ8 A;  3ZZV A;  1YZB A;  4TKH A;  3PPT A;  2OVE A;  1E02 A;  1YWC A;  4IB8 A;  1VWD B;  4Z27 A;  5HCD C;  2F01 A;  4OEM A;  4M7M A;  1X8U A;  5K16 A;  3IOQ A;  1QQS A;  1MDW A;  2IZE B;  2IZA A;  5DG4 A;  3PW3 A;  3FDC A;  3U9P C;  4I9S A;  1ITO A;  1AU2 A;  1S2P A;  5B5F A;  4JNJ A;  3VG2 A;  3S5X A;  3ZI8 A;  2WSJ A;  2FUD A;  1YAL A;  3RY2 A;  1STP A;  5LJB A;  1ZRY A;  1SWL A;  1EUO A;  1BJ7 A;  1EWO A;  2AL0 X;  2FTB A;  1TVQ A;  4XME A;  3VHI A;  2RN4 A;  3P5W A;  1SWB A;  2A2U A;  2OVS A;  1AYV A;  5B3M O;  3X00 A;  3EW2 A;  1GX3 A;  4O3Y A;  4IMN A;  4ZTB A;  1GX9 A;  2R56 A;  3EC5 A;  3HWF A;  2OY8 A;  3PSE A;  1BLR A;  2WQ9 A;  3AI8 A;  4Y0R A;  2JRI A;  4OVZ A;  2NQG A;  3O2Y A;  1P6P A;  1MM9 A;  2POA A;  1CVZ A;  4FBO A;  4I04 A;  2DCC A;  3IHP A;  1CBR A;  1VWQ B;  1X8N A;  1HXL A;  2C1Q A;  1VYG A;  3SZI A;  1PPD A;  1YWA A;  3WZO A;  3TRK A;  2X8F A;  4CDE A;  8PCH A;  4QBB A;  2HKD A;  3HOE A;  7PCK A;  4LZV A;  1EI5 A;  1VWI B;  1MOY A;  1NB3 A;  3AKN A;  5HA0 A;  1Z24 A;  4NNS A;  5LJD A;  2CAM A;  2GHU A;  2HHN A;  1ICN A;  1ZND A;  4OVZ B;  3CQN A;  3UEU A;  2PI3 O;  2X4M A;  3RVX A;  4GET A;  1SWK A;  4YCE A;  2XU1 A;  2QO4 A;  4P6E A;  2LB6 A;  4QRL A;  2Q4N A;  3RE5 A;  3TGA A;  1Y9T A;  1CSB B;  4CDE B;  4YGZ A;  1QFV A;  4MVL A;  3WZP A;  4O4O A;  5LJC A;  1VWK B;  3APV A;  1XKI A;  4ALO A;  3C77 X;  2G8J A;  4GNY A;  4ALB A;  1VPR A;  1CTE A;  2IZH B;  2WPU A;  2ATO A;  4Z2O A;  3PQS A;  3WYQ A;  4RNA A;  2RTH B;  2FKG A;  6PAD A;  5A24 A;  1IIU A;  1IFC A;  4ORU A;  1Y9L A;  3FMZ A;  4KH8 A;  3CH3 X;  1EAL A;  2OFA A;  2WEW A;  2BS5 A;  1YWB A;  1SRF A;  1STS B;  4COT A;  1F29 A;  2HXZ A;  1FEN A;  3P6H A;  5B29 A;  4Z28 A;  1IWD A;  3C78 X;  4AZQ A;  4MVE A;  1YP6 A;  1VJV A;  3CQR A;  3TF6 A;  2RD7 C;  2VHF A;  5KID A;  1I9H A;  4R0B A;  3T2X A;  2GJ5 A;  4GDZ A;  4ZHH A;  2A8G A;  2WEX A;  4W4U A;  3I17 A;  2OL8 O;  1ZNG A;  1ZNH A;  1YT7 A;  3OIS A;  2RTF B;  4I07 A;  3MP2 A;  5EZ2 A;  4IAX A;  1AU4 A;  1X8Q A;  4HXD B;  2QO5 A;  1KFX L;  2JU7 A;  1NGL A;  1CS8 A;  3P5V A;  2F73 A;  4AXL A;  3T6L A;  3D9W A;  3N4C A;  4QRX A;  1ADL A;  2MF6 A;  5F6B A;  3O22 A;  3TZS A;  1VWE B;  1ME3 A;  3NQ9 A;  1KL3 A;  4GUA A;  3UAQ A;  3W31 A;  1BSO A;  4ORS A;  1D3S A;  4BOQ A;  1ZCM A;  1I78 A;  1G85 A;  2JGS A;  1B0O A;  2AIM A;  4YDA A;  3IA8 A;  1BSQ A;  4U8U M;  1SWA A;  4FJC A;  3TGC A;  1X9Y A;  4BOS A;  1DC9 A;  3GAQ A;  3P5X A;  4O9S A;  1KZX A;  3QJ3 A;  3MOR A;  4BX5 A;  1FH0 A;  3HWN A;  2BLG A;  1O1V A;  3OVX A;  3H8B A;  4IRW A;  5LJK A;  5IRU A;  4AZO A;  3MTN A;  3E1Z B;  1MUP A;  1SWJ A;  5L8I A;  4HFO A;  1RXK A;  4HPC A;  4O4S A;  1S44 A;  3AUM O;  1JJX A;  1LEL A;  1QWD A;  1NB5 A;  1EPB A;  3OF8 A;  3N3K A;  1MDC A;  2GTL N;  4BX5 B;  2OZ2 A;  3P6D A;  4GDA A;  4CPH A;  3WVM A;  2OVD A;  3EM0 A;  2DCB A;  5CE4 A;  4ZUX U;  2JU3 A;  1LCV A;  1Y53 X;  2RTQ B;  1PPO A;  4GKC A;  3CKF A;  1TOW A;  2IZB A;  5HCC C;  3PNR A;  3I06 A;  4XMC A;  3OVZ A;  2IZC B;  4YKO A;  2FRS A;  4YFR A;  1TU6 A;  3RDX A;  2RTG B;  4CPH B;  5K68 A;  1O1U A;  4FBR A;  4ZHD A;  2RTA A;  1GM6 A;  2ANS A;  4ON1 A;  3WYP A;  4FBV A;  1Y4H A;  3HPE A;  2R9F A;  1BQI A;  1HBQ A;  1N43 A;  4BSQ A;  4IAB A;  3KKU A;  1AQB A;  4EFG A;  4NYQ A;  1DKI A;  1KHP A;  2FWV A;  2OUL A;  1LIB A;  4A8Z A;  1AIM A;  2AT0 X;  3D4R A;  1EWL A;  3FLL A;  3KFQ A;  4NLJ A;  4BJ8 A;  4U8U O;  1BM5 A;  3AEH A;  3VE2 A;  1F2C A;  3IEJ A;  2WUT A;  1SLD B;  4YKM A;  3BPM A;  1OEK A;  1AU0 A;  1QY2 A;  1JYD A;  4RKX A;  5BVS A;  5CHT A;  3E9S A;  2MWH A;  3P24 A;  4U9C A;  1BWY A;  3KZA A;  1ATK A;  1B8E A;  2G8C O;  4GUZ A;  4TKJ A;  3CBC A;  3MVF A;  3FEL A;  1GT3 A;  4CPF A;  1ICF A;  1DZK A;  4YYQ A;  3AKM A;  1S7D A;  4TQ2 A;  4I3B A;  2BTW B;  4YFQ A;  1NDJ A;  2X46 A;  2GFO A;  1SWC A;  2KTD A;  4BGF A;  1KXO A;  3B79 A;  1FTP A;  3RDS A;  4MSX A;  4ZHF A;  3RZY A;  1MHW A;  3KSE A;  5L8N A;  4GGZ A;  3OE3 A;  1EII A;  3RDO A;  3MJ5 A;  2OY1 O;  4MIS A;  2LA7 A;  2DC8 A;  2X8S A;  4NV8 A;  1LF7 A;  4O4X A;  2FTD A;  4YYU A;  3EBK A;  3U03 A;  4CDD A;  1BEB A;  1ERB A;  1E5P A;  3APU A;  1DV9 A;  2W2B A;  1Y0G A;  4QNI A;  3CWK A;  2YJ2 A;  5H9L A;  5HBS A;  1EW3 A;  3M99 A;  3ZUA A;  2DM5 A;  3KFG A;  3CBS A;  4ZGF A;  4BOU A;  1T8V A;  2VFC A;  4DMY A;  4YYS A;  4FQB B;  2WBF X;  1SRJ A;  3D97 A;  3B21 A;  2JQG R;  2NQI A;  3BCN A;  4BX6 A;  4I6S A;  3QT4 A;  4WA6 A;  4NYR A;  2MHD A;  3F5V A; 
#chains in the Genus database with same CATH homology
 4QRG A;  2P86 A;  1POP A;  4CDC A;  4CDD B;  1PPD A;  2DJF B;  4CDE A;  8PCH A;  4QBB A;  4XR7 A;  2PRE A;  4NV7 A;  7PCK A;  1NB3 A;  1PIP A;  3PBH A;  2JQF R;  5F02 A;  2GHU A;  4Q8H A;  2HHN A;  3S3R A;  3V6C A;  3PDF A;  1E2T A;  2G6D A;  3RVX A;  4Q8G A;  3CBJ A;  2AU1 A;  3K24 A;  2XU1 A;  3CBK A;  2E03 A;  4P6E A;  4CDC B;  3I3T A;  1CSB B;  1F2A A;  4CDE B;  2P7U A;  1JQP A;  3WXG A;  4N4Z A;  1PAD A;  4N8W A;  2DC7 A;  2G8J A;  3H6S A;  2XU4 A;  2DCD A;  1BP4 A;  3RVW A;  1CTE A;  2NQA A;  2ATO A;  1W4T A;  2BSZ A;  1CJL A;  2HH5 A;  2DCA A;  2YJC A;  6PAD A;  5A24 A;  3V6E A;  3MHS A;  5CVN B;  4BPV A;  2FRQ A;  3USV A;  1YK7 A;  3CH3 X;  3KWZ A;  4PI3 A;  3IUT A;  2P0R A;  2E01 A;  2Y5B A;  2R9O A;  1F29 A;  1AU3 A;  2HXZ A;  1GCB A;  3DF0 A;  1IWD A;  3U8E A;  2DJF A;  1VJV A;  1CQD A;  2F7D A;  2VHF A;  4BS6 A;  3HD3 A;  3H7D A;  2XU3 A;  2DC9 A;  2R9N A;  4CDF A;  4K7C A;  4W4U A;  1ZIV A;  2H7J A;  4YVA A;  1YT7 A;  3OIS A;  2AYN A;  4I07 A;  5EF4 A;  3ERV A;  2R9C A;  1AU4 A;  4MZS A;  2AYO A;  2FQ9 A;  1KFU L;  1F2B A;  3NHE A;  3KX1 A;  1KHQ A;  1KFX L;  2FO5 A;  3D6S A;  2CB5 A;  1CS8 A;  1THE A;  3P5V A;  4KLB A;  4RY2 A;  1NPZ A;  4AXL A;  1AYU A;  1M6D A;  2DZZ A;  5CVM A;  3D9W A;  1QMY A;  3N4C A;  4QRX A;  2Y6E A;  2FT2 A;  3O1G A;  2G7Y A;  4CDF B;  2G8E A;  1ME3 A;  2CIO A;  4BQV A;  1CPJ A;  1ZCM A;  1EWP A;  2B1N A;  1K3B A;  1KXR A;  2AIM A;  2AVW A;  2YJ9 A;  3WXF A;  3BC3 A;  3K8U A;  4FJC A;  3IMA A;  1X9Y A;  2XU5 A;  4X6J A;  3P5X A;  2PAD A;  3HHI A;  4X6H A;  1EF7 A;  4YYR A;  3QJ3 A;  3MOR A;  4XUI A;  3MHH A;  1Q6K A;  4BS5 A;  1FH0 A;  3HWN A;  4C5P A;  4YYV A;  1AYW A;  3OVX A;  3H8B A;  1O0E A;  1CB5 A;  2NQD B;  3MTN A;  3E1Z B;  1K3B B;  2BDZ A;  1TLO A;  1Y08 A;  1GEC E;  4AXM A;  1QDQ A;  2FYE A;  1BY8 A;  4N79 A;  1DF0 A;  1NB5 A;  1NLJ A;  4W5C A;  2VFB A;  1W5R A;  3OF8 A;  3N3K A;  2DC6 A;  2OZ2 A;  3GCB A;  1W6F A;  4YV8 A;  1XKG A;  2AUX A;  2E00 A;  2PNS A;  4QRV A;  3P5U A;  4CZW A;  4P6G A;  2DCB A;  4ZUX U;  2PBH A;  4OEL A;  1AEC A;  1U5I A;  3KWB X;  1PPO A;  1MIR A;  2BDL A;  4G54 A;  3TNX A;  2F1G A;  3PNR A;  1SNK A;  3I06 A;  2R6N A;  2HD5 A;  3OVZ A;  1S4V A;  2OP3 A;  2ARY A;  3OF9 A;  1VSN A;  1U9V A;  1YK8 A;  3S3Q A;  5JA7 A;  1TU6 A;  2R9M A;  2YJB A;  1PXV A;  1GLO A;  3WXE A;  1HUC B;  3F75 A;  3KW9 A;  3BOW A;  1PCI A;  1PPP A;  3O0U A;  1Y4H A;  4W5B A;  3IV2 A;  2R9F A;  1BQI A;  1MS6 A;  2IBI A;  3C9E A;  4BSQ A;  9PAP A;  2DZY A;  3KKU A;  5J94 A;  4DMX A;  1NQC A;  5JH3 A;  4HWY A;  1KHP A;  3LFY A;  2E02 A;  2ACT A;  5FPW A;  4PP2 E;  2OUL A;  1AIM A;  1EWL A;  1DEU A;  1U9Q X;  3KFQ A;  1STF E;  4QH6 A;  2AS8 A;  1U9W A;  4MZO A;  2DJG B;  2IPP B;  1F2C A;  2O6X A;  3IEJ A;  3LXS A;  4OEM A;  1EWM A;  1CV8 A;  5K16 A;  3BPM A;  3H89 A;  1AU0 A;  3IOQ A;  5CHT A;  1QXP A;  2VHS A;  2YJ8 A;  1MDW A;  4I05 A;  2B1M A;  1PE6 A;  3PW3 A;  1ATK A;  1ITO A;  1AU2 A;  3BPF A;  4GUZ A;  3K9M A;  1ICF A;  1U9X A;  4YYQ A;  3BWK A;  2FUD A;  1BGO A;  1YAL A;  5CVO B;  2GFO A;  4BGF A;  5EGW A;  3B79 A;  1SP4 B;  1A6R A;  4MSX A;  1MHW A;  1EWO A;  4X6I A;  3KSE A;  2FRA A;  3N3G A;  3QSD A;  4PAD A;  3RVV A;  5PAD A;  1NL6 A;  3P5W A;  2DC8 A;  1PBH A;  4NV8 A;  3H8C A;  2FTD A;  1AYV A;  4B55 A;  4YYU A;  4PP1 A;  1YVB A;  4CDD A;  1GX3 A;  2C0Y A;  4FK5 A;  1GMY A;  2YJ2 A;  3HHA A;  3M99 A;  2AUZ A;  3ZUA A;  1MEG A;  2VFC A;  4DMY A;  4YYS A;  3AI8 A;  5CHV A;  1ME4 A;  2WBF X;  4YYW A;  2NQG A;  2JQG R;  2NQI A;  3BCN A;  1TL9 A;  3LTW A;  1CVZ A;  3QT4 A;  4WA6 A;  1MEM A;  2DJG A;  1PPN A;  3CH2 X;  4FIP A;  4I04 A;  2DCC A;  1QOL A;  3IHP A;  3F5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...