3PDFA

Discovery of novel cyanamide-based inhibitors of cathepsin c
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
441
structure length
351
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVFLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl peptidase 1
total genus 98
structure length 351
sequence length 441
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 3pdfA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pdfA02
2P7UA 2YJCA 1QDQA 2GHUA 3LXSA 3CH2X 2F7DA 2YJ8A 1A6RA 2Y5BA 3BWKA 2AYNA 2XU5A 1VJVA 5F02A 3HHIA 4YYSA 4CZWA 1BQIA 2FTDA 2OP3A 3OF9A 4MSXA 1U9WA 1MEGA 3IOQA 2R9NA 3LFYA 3I06A 4PADA 3P5VA 3TNXA 2VHFA 4P6EA 2DJFB 1KHPA 1PADA 1AU3A 3CBKA 3S3QA 3KWBX 3IEJA 1GCBA 1CJLA 2F1GA 4YVAA 4YYWA 2DC8A 1GMYA 3B79A 2FYEA 1TLOA 1DEUA 2PNSA 1U9QX 3O0UA 3WXFA 5CVOB 3OF8A 3OVXA 3MORA 4X6IA 2E03A 1XKGA 2B1MA 1K3BA 3MHSA 1BGOA 4CDDA 1AIMA 4AXMA 4Q8GA 3IHPA 3MHHA 4XUIA 4QRVA 3KX1A 2OZ2A 3KSEA 4BPVA 4CDFA 4BQVA 2FUDA 1DF0A 3K24A 1KHQA 1PPDA 4P6GA 4CDCA 1CPJA 2R9OA 2G7YA 1NB3A 1EWLA 3P5WA 2P86A 1TU6A 4CDCB 1MEMA 1ZIVA 3NHEA 3RVVA 1NQCA 1NLJA 1ZCMA 4W5CA 3QSDA 3RVXA 4ZUXU 2OULA 4CDFB 2BDLA 4QBBA 2DCCA 1Y08A 2AS8A 3USVA 1ICFA 2DCBA 1AU2A 3OISA 5CVMA 1K3BB 2B1NA 4XR7A 2NQGA 2DC6A 3IMAA 2DZZA 1NL6A 3N3GA 3QT4A 2YJBA 1MS6A 1PBHA 5CHTA 3ERVA 2JQGR 2HD5A 4AXLA 4I04A 4X6HA 3KFQA 2NQDB 1BP4A 3P5UA 3WXGA 3BOWA 1SNKA 1PCIA 4FJCA 1NPZA 3D6SA 5A24A 1KXRA 4FIPA 2XU4A 2AU1A 4HWYA 1YVBA 4OEMA 1FH0A 1CVZA 3BPFA 2VHSA 1KFXL 3C9EA 2YJ2A 2XU1A 3S3RA 4MZSA 2BDZA 1M6DA 1EF7A 2HH5A 3H6SA 3KW9A 3RVWA 2AUZA 1CV8A 1MHWA 1THEA 2P0RA 1QMYA 4PP2E 2HHNA 3QJ3A 2ARYA 1YALA 3AI8A 1MIRA 1EWPA 1EWOA 3HD3A 3PW3A 3H89A 3CBJA 4K7CA 1SP4B 4YYVA 2DCDA 3BCNA 1QXPA 2E00A 3E1ZB 3PNRA 5K16A 2DCAA 2CIOA 4W5BA 1AYVA 4Q8HA 5PADA 2PADA 2E01A 1U5IA 1F2CA 2PREA 1YK8A 2DJGB 1ME3A 2AYOA 1AU0A 2G6DA 1CTEA 1CS8A 2FO5A 3DF0A 1F2BA 1TL9A 4YYQA 4X6JA 5CHVA 2FQ9A 3KWZA 1CB5A 3H7DA 2YJ9A 4QH6A 8PCHA 1PPPA 4N79A 5CVNB 3H8CA 1STFE 3K8UA 3V6EA 2H7JA 2NQIA 1X9YA 2DC7A 1BY8A 1QOLA 3F75A 4W4UA 5JA7A 2FRQA 1IWDA 3U8EA 4CDDB 1GLOA 2XU3A 3I3TA 2DZYA 4RY2A 2NQAA 3MTNA 1VSNA 4DMYA 4CDEB 3N3KA 4MZOA 1AYWA 2G8EA 4YYUA 1NB5A 4QRXA 1AYUA 4I05A 4WA6A 3K9MA 2IPPB 2R9CA 3GCBA 1PIPA 2C0YA 3KKUA 2FRAA 4BS6A 3HWNA 2JQFR 4QRGA 4CDEA 3H8BA 3IV2A 9PAPA 1KFUL 1HUCB 3ZUAA 2R9MA 4DMXA 2DJFA 1U9XA 4YV8A 1F2AA 1PPOA 2ATOA 2R9FA 2AIMA 4YYRA 2PBHA 4PP1A 2FT2A 2R6NA 2GFOA 3CH3X 3WXEA 2AUXA 1S4VA 6PADA 2E02A 2CB5A 2IBIA 3BC3A 4G54A 1YT7A 2Y6EA 1ME4A 5JH3A 3F5VA 5FPWA 4N8WA 3PBHA 1ATKA 2HXZA 4I07A 1EWMA 1MDWA 1U9VA 5EGWA 3P5XA 2G8JA 1AU4A 2WBFX 1PPNA 2DC9A 5J94A 3PDFA 3M99A 3IUTA 2DJGA 1CQDA 7PCKA 4BSQA 3BPMA 1AECA 1PXVA 1ITOA 5EF4A 1JQPA 1Y4HA 4OELA 1Q6KA 4FK5A 3N4CA 4PI3A 1POPA 3OVZA 1GECE 4BS5A 1PE6A 2ACTA 4KLBA 4N4ZA 1CSBB 2O6XA 3HHAA 2AVWA 3O1GA 1YK7A 1O0EA 3V6CA 1F29A
chains in the Genus database with same CATH superfamily
3F6ZB 1DV9A 2GHUA 3U03A 4IMNA 3GAQA 4Y0PA 2BSZA 2K62A 3O19A 2AYNA 1LIBA 2GTFX 2XU5A 3HHIA 5F02A 2CBRA 4QNIA 5B11O 4GUAA 4A1YA 1SWNA 3OF9A 1SWGA 4M0WA 2L67A 1KT7A 3I06A 2POAA 4PADA 3P5VA 3PPTA 3KFFA 2Y3EA 1QWDA 3WOVA 2AT5X 5IO6A 3BX7A 2L68A 5IRAA 1KGLA 4LQZA 4DNEA 1AU3A 2HKDA 2OVSA 1UYOX 4LKPA 4ZHHA 3KWBX 3IEJA 1SWPA 5FENA 2FYEA 3ZWEA 5LJCA 2PNSA 1KT5A 4I6SA 3KZAA 4QAEA 4EDEA 2QOMA 1FELA 1BGOA 1K24A 3KQ0A 1H91A 5B5GA 4CDDA 1KL4A 2LB6A 3BX8A 1UKFA 4AXMA 1S2PA 1HMRA 1ALBA 2OVDA 3HOEA 1QFVA 4ES7A 4KIIA 4IAWA 4CDFA 3Q6LA 1X8PA 2FUDA 5EDCA 5HZ9A 1U18A 4P6GA 2BT9A 3PQUA 2F01A 2X8SA 1NB3A 1SRIA 3P5WA 1SMPI 3APXA 1MEMA 3NHEA 1FE3A 3AUMO 4Z2PA 1O8VA 1SA8A 4CDFB 4FQBB 1VWIB 2Q39A 2NNEA 1YP7A 1SRFA 2C4IA 4QBBA 4JHQA 5BVQA 4TLJA 4GU8A 4D8IA 2OL7A 2CBSA 2DCCA 3USVA 4GUZA 1JYDA 2UZ2A 3TGCA 3CKFA 3RDMA 2NQGA 2DC6A 2JMBA 2BS5A 1MS6A 1HMSA 1QY0A 3EC5A 3MM0A 1NQNA 1PBHA 5CHTA 1W4TA 3BU9A 3ERVA 2X32A 3TGBA 1KT4A 2J7QA 3VGWA 1VWPB 4X6HA 1VWHB 5L3YA 2NQDB 1BP4A 1VWAB 2AMMX 2X8TA 1G5WA 4MISA 1MVGA 1PCIA 4TJZA 4FJCA 2FR3A 5EDBA 2X56A 1SWQA 2AU1A 4HWYA 1SXXA 1FH0A 2A2UA 3BPFA 4HXDB 1KFXL 1RLBE 4QYPA 1JBHA 3S3RA 1KXOA 3WJCA 2A5CA 3UEWA 4R3DA 1LNMA 1HQPA 2FE8A 3PHWA 3KW9A 2P0RA 2LFOA 3STKA 2HHNA 1G74A 1QFTA 1EWPA 4IRWA 4PT5A 2C1SA 1SWHA 4GJSA 5K16A 2KT4B 5EZQA 2JOZA 3FLLA 5LJHA 3ZW0B 1AYVA 1PMPA 3ZZVA 1AVDA 4BX7A 1VWOB 1STPA 2HZQA 1ME3A 1AU0A 4CK4A 3FR5A 1EIIA 4ZGUA 1A3YA 4NLJA 1KZWA 1TL9A 3HWDA 2CAMA 4ORSA 3KWZA 2IZHB 5BYPA 3H3IA 4QH6A 8PCHA 2C1QA 5EPQA 4I9SA 2RCTA 4HWMA 5FAZA 5CVNB 4U3QA 5B27A 1E2TA 2CM9A 3CBCA 4A1HA 2K23A 2RTPB 2NQIA 1X9YA 4ZHCA 4MVKA 4BX5A 1SWDA 5HA0A 2CZTA 3U8EA 4CDDB 3HWFA 1GLOA 5HA1A 2GTLM 3NADA 3VHMA 3FA9A 3IFUA 3P6FA 4BOEA 4BCSA 4RF1A 1NC9A 1VSNA 2RTOB 3EMMA 2P8GA 1TOWA 1ACDA 4TKHA 4QRLA 4CDEB 3N3KA 2Y3FA 4MZOA 3IFBA 2JW1A 1AYUA 1GKAA 1OBPA 4GZVA 1Y9TA 4WBKA 1SXYA 3RE6A 1KL3A 3T2WA 2IPPB 4ALOA 1YWBA 1IKEA 1QG5A 2HWKA 3O2YA 3G7XA 3KKUA 4MVLA 3VPJE 2LBVA 1BEBA 5IO5A 1HUCB 5B29A 2IZEB 1U9XA 4ZHDA 3HTYA 5H8TA 2AIMA 2FKJA 3ELZA 4KT5A 4PP1A 2QO4A 3MP2A 2R6NA 4TKBA 3EW1A 2WWPA 4QZUA 3FMZA 5H9NA 3CH3X 3W30A 1E06A 2JN3A 4YVBA 1S4VA 2IBIA 3BC3A 2YMSA 1VPRA 4BGFA 1SY3A 4GH7A 2MF6A 1D3SA 3S26A 2Y6EA 3BLGA 3P6EA 3RDUA 1JJXA 3UEXA 1I06A 3PBHA 2PI3O 1W6FA 2HXZA 1BBPA 4I07A 4WFVA 1MDWA 1U9VA 2OYBO 2RTJA 1AU4A 2DC9A 2FGSA 1R0UA 4NV7A 3M99A 1CQDA 1DZKA 3E9SA 1MX8A 4ZCBA 2FWVA 1IJ8A 2JU3A 3I0AA 1LICA 1DF3A 2O62A 1Q6KA 3JSQA 4B55A 3RY1A 2IZGB 4FK5A 3N4CA 2AT3X 2OVEA 4C5PA 4BX6A 2ANSA 5HTEA 4QYNA 1GGLA 4JGLA 3TRKA 2AVWA 3FYFA 5HTDA 1BLRA 4ZGFA 4RKXA 1YK7A 5FQ7E 2IZCB 3V6CA 4BBOA 3CQRA 1OBQA 2L9CA 3VHHA 3U0DA 3FELA 1Y53X 3EBKA 3FR4A 1KQXA 1QDQA 3LXSA 1I78A 4FBVA 2F7DA 2BLGA 1JMZA 3PK2A 1W5RA 5EEDA 4KH8A 3T6FA 1MK5A 3PHXA 1ADLA 4MSXA 3WJEA 2X46A 2R9NA 3LFYA 4LZUA 3HWEA 1FDQA 5BVSA 2VHFA 4P6EA 3LHNA 3O22A 1KHPA 1SXWA 3B2LA 4CPFA 5LJKA 4U8UN 1MX7A 1SWLA 3S3QA 4ORXA 1SLGB 2Q9SA 1N0SA 3RKGA 1LCVA 4YCEA 2PY1A 3ZQ3A 2DC8A 4AYHA 1DC9A 2G8CO 1DEUA 3O0UA 3PHUA 2NNDA 5CVOB 3OF8A 4ODDA 4NP1A 2E03A 1VWFB 2BTWA 2B1MA 2IZLB 2WSJA 4Q8GA 2OZQA 4DCBA 4YGGA 4QRVA 3T6LA 1S44A 3KX1A 3KSEA 4XMCA 4BQVA 2AT8X 1DF0A 3RBYA 1ERXA 1VYOA 3P6HA 2G7YA 3RDSA 5K06A 1EWLA 3OBLA 4Y0QA 3VE2A 5E6JA 1TU6A 2X8FA 1ZIVA 1NQCA 1KZXA 4U8UO 1ZCMA 3RVXA 3QSDA 4ZUXU 3B2KA 1X89A 1SWAA 5L8OA 2BDLA 3Q34A 4NNSA 4EKVA 4MIRA 1NDJA 1U0XA 4XMGA 4O3ZA 2I5ZO 4AZMA 4O3XB 5CVMA 4YBPA 1UZ2X 4WHIA 1K3BB 4XR7A 4MI7A 1GM6A 2WEWA 3STMX 1SLFB 4UU2A 1NL6A 3N3GA 3C76X 4L3RA 3P24A 1FENA 1A18A 2FT9A 4OVZA 3HWGA 3OD9A 4KC8A 4O3WA 1IKJA 2VFBA 3KFQA 4ORYA 2A2GA 3BOWA 5B3MO 1IFCA 1LCZA 3NP1A 3NPOA 3WVMA 1DZPA 3P6DA 2KW1A 4OMWA 4Z27A 2JTCA 3MJ5A 5EEEA 2R56A 1YVBA 4OEMA 1JJJA 4LKTA 3NX1A 2BS6A 4O4XA 3CKGA 4ZH6A 4ORRA 1YP6A 3AEHA 2YJ2A 2CM4A 4ZHGA 1EPAA 2OF8A 2HH5A 2RA6A 2RD7C 2IZKA 2ZAIA 5HZ8A 1S7DA 1GT3A 1SWUA 1Z24A 4FBOA 1X8NA 3WZNA 4QGXA 3ZW1B 2RQ0A 5CE4A 1QMYA 4MM3B 1DKIA 2KTSA 3BSZE 1SWBA 3QJ3A 2ARYA 1YALA 3AI8A 4U8UM 3SLOA 2OFAA 4ZFXA 3CBJA 1E00A 3BCNA 2E00A 3E3CA 3HK1A 5HBSA 4YMYA 4EXZA 1YUPA 1WUBA 1STRB 2JU8A 4Q8HA 2PADA 2E01A 4BJ8A 5FQ8E 1LDOA 2FS7A 1I4UA 1LFOA 3MVFA 1BRQA 1TXLA 5AJCA 1IW2A 4OMXA 2FKGA 3LTWA 1YK8A 3D97A 2G6DA 5HZ5A 4RNAA 4NV8A 5FFHA 5K67A 3CWKA 1OSPO 4GDAA 5EZSA 4D6AA 2Y32A 4X6JA 2ZSCA 3ZUIA 3APVA 3KFGA 3PRMA 2CZUA 5CHVA 3ZNHA 3WZOA 3B2HA 3NQ9A 4Y5DA 4XMFA 2JRIA 3B2JA 2NNQA 1B8EA 1LIEA 2GJ5A 4N79A 3FR2A 1P6PA 1STFE 2BU3A 2H7JA 2W2AA 1SWCA 1I9HA 1VYGA 3BBAA 5AEOA 1QOLA 3F75A 4W4UA 5JA7A 4CPHA 4Z28A 1GX3A 1PM1X 4KC7A 4ON1A 3RWXA 4GD9A 2XU3A 5F7GA 4GK9A 2DZYA 2OFBA 5F1EA 2NQAA 5H9LA 1L6MA 2RTEB 1ZNGA 5D48A 3WBGA 1AVGI 4DMYA 3OQCA 3TZSA 2X45A 2HYSA 5B5FA 4YYUA 1NB5A 4QRXA 4I05A 5D47A 3K9MA 2OL8O 1BRPA 4PJ2A 3B21A 2R9CA 5FQ6E 1X8UA 4ZHFA 3GCBA 2NP1A 2HLVA 5F58A 2C0YA 4DQ3A 4QRGA 1T0VA 5CHKA 3IV2A 1KFUL 4YV8A 1PPOA 2ATOA 1BM5A 3SOTA 2R9FA 1QQSA 4GKCA 1YWAA 2A5BA 4GNYA 2HNXA 4D6BA 2FT2A 4AZNA 4AW8A 1RXKA 4GNWA 3MBTA 4OS3A 1BWYA 1LCWA 2X55A 4GGRA 3WXEA 2GTLO 3RZYA 2E02A 3ZI8A 1N9YA 1DZJA 4D8EA 1ME4A 1HBPA 2FHNX 3F5VA 1Y55X 3AKMA 5FPWA 2FR2A 3FDCA 3MG5A 3KVNA 2G78A 1LUQA 3L4RA 5KO3A 4KCAA 1ZRYA 3HPEA 2WBFX 4PSQA 3FENA 1KQWA 1JMXA 3IUTA 2DJGA 7PCKA 4O4SA 4BSQA 3BPMA 1PXVA 5IRWA 2UYWA 3SLJA 3VE1A 4GGZA 4RUNA 1LIFA 4YFQA 3OVZA 1GECE 4YKOA 4BS5A 2ACTA 1N7YA 4Z6JA 2OVAA 1CSBB 3UEUA 4ORUA 2O6XA 4Z2VA 1ZNKA 1NBXA 2HMBA 1O0EA 1SWFA 4ARHA 1CBRA 4BOSA 2L5PA 3FA8A 2QOSC 1VWMB 3EM0A 2YJCA 1DZMA 1KFFA 2OY1O 3FEKA 1A6RA 3WJGA 4R0BA 2RTCB 2AT6X 4YYSA 4CZWA 2FTDA 2Z4IA 2OY8A 1Y0GA 4BOQA 4NYRA 1MEGA 5BVTA 4HPDA 2M4LA 3DTQA 3BB7A 1T68X 2DJFB 4NYQA 1N43A 2KD2A 1PADA 1G7NA 4BOUA 3CBKA 2Z84A 3RY2A 5HZ6A 4CPEA 2WQ9A 2R74A 3F8AA 5DPQA 5LKEA 3IA8A 1GCBA 2RTIB 3PEDA 5H9AA 2F1GA 2IZFB 2X34A 4YVAA 4YYWA 5F6BA 3WJDA 4I60A 1GMYA 3B79A 1QABE 1U9QX 5D4AA 5HCDC 3WXFA 4Z2OA 2MJIA 1SRJA 3OVXA 3MORA 2BHVA 2G5LA 2RTNB 2IFBA 1ZNDA 3X00A 3ELXA 4QZTA 2MO5A 2RTFB 2FTBA 2AH7X 1MOYA 1AIMA 4XUIA 3C77X 1AELA 1SLEB 3BS2A 3FA7A 1VWKB 1VWRB 2FRSA 1LKEA 5B2AO 2OL6O 4YFPA 1SRHA 1A2DA 3NQ3A 1UREA 3K24A 2XKLA 2EU7X 1GX8A 4CDCA 4YDAA 1CPJA 3VG2A 4UU3A 4EFGA 3W31A 2P86A 2IZBA 1ZNEA 4CDCB 4I95A 3SZHA 4O4UA 4ORWA 1AQBA 3WJBA 2IZAA 4FBRA 4W5CA 3P6GA 1CRBA 1T8VA 2FHLA 2OF9A 3FA6A 1PTSA 1HY2A 3D4RA 3STNA 3HOLA 1HN2A 4IUMA 1IIUA 1ICFA 4XMDA 1Y52X 1HBQA 2RTAA 4I3DA 4AZRA 3IMAA 3BDRA 4TQ2A 1NP4A 2YJBA 1ICNA 1VWDB 4GJVA 3B2IA 4IMOA 4AXLA 4AZOA 3RE5A 3P5UA 2W2FA 3WXGA 4HPCA 1ML7A 1XCAA 2ASNX 4N7DA 1AB0A 5A24A 1KXRA 4FIPA 3KFHA 4YBUA 2BC3A 1OEEA 1YIVA 4JO6A 4ML7B 3VG3A 3C9EA 2XU1A 1GT4A 4MZSA 3NQKA 2BDZA 1M6DA 1EF7A 4GRJA 1GXAA 3BY0A 1XKIA 4XMHA 4L1NA 4LZVA 3RVWA 2ACPX 1PVJA 1RAVA 1N9MA 5IO7A 1LDQA 4TKJA 1VWGB 3HD3A 3RDOA 5L8NA 3VHIA 1QXPA 1OPBA 3E1ZB 1QY1A 3PNRA 3PT2A 2R73A 1SWEA 4W5BA 2RTRB 4HFOA 1VWJB 1F2CA 4WURA 2VFCA 1TOUA 2I5VO 3RNVA 1MM9A 1KOIA 3ZW2A 4MEEA 2DJGB 1U17A 3P02A 4IB8A 1EIOA 1UYNX 1CTEA 2MWHA 1CS8A 5HWZA 4Y0RA 5CSEA 3DF0A 4YYQA 2FQ9A 3H7DA 2JGSA 3BRNA 5LKFA 5DG4A 3LV4A 1BJ7A 2WPUA 3NX2A 1JV4A 3V6EA 1X8OA 1B4MA 1GX9A 2E4JA 4RF0A 3WXQA 1IWDA 4YDBA 4YFRA 2W2BA 2RTHB 5JR8A 4RY2A 2RTDB 3MTNA 4Y0SA 1VWNB 2RTBB 2FS6A 5KICA 5HCEC 2IZIA 3TGAA 2G8EA 3EYCA 4IAXA 3VU1A 3T2XA 1NP1A 1PIPA 2FRAA 4RUUA 4IBAA 1LF7A 3HWNA 3P6CA 3EW2A 2R9MA 1YWDA 4DMXA 2DJFA 1LPJA 2WQAE 3PH5A 4A60A 2PBHA 2QO5A 1E02A 4EQAC 1JYJA 6PADA 4G54A 4YGZA 4O3YA 3S60A 2Z4HA 1FEMA 5JH3A 4O9SA 5HCCC 1GT1A 1IFBA 3ZUOA 5IXGA 1EPBA 4CPIA 3AKNA 4U46A 1HMTA 4IB6A 1ATKA 3GE2A 1EWMA 1RBPA 5EGWA 3P5XA 2G8JA 3TF6A 1PPNA 1N4JA 5J94A 3PDFA 2OY7A 1VWBB 3SLTA 1FTPA 1SXUA 1AECA 5KIDA 1Y4HA 3BY4A 4ALBA 2J7QC 1SWSA 1PE6A 1SY2A 3HHAA 5L8IA 2UZJA 2MHDA 2OFMX 1NQMA 4Y59A 1F29A 3PSEA 2YG2A 2P7UA 4MVIA 2N93A 3CH2X 3ZW1A 3SZIA 2YJ8A 3SAOA 2Y5BA 3BWKA 3TMPA 1VJVA 2AT0X 1BQIA 2IZDB 1X8QA 4HPBA 2WR6A 4FGIB 2OP3A 1NGLA 1U9WA 3WJFA 2G79A 3IOQA 1JZUA 4OKAA 3WZPA 3PRPA 3TNXA 4XZXA 4IB9A 1SREA 3NBXX 2GC9A 4XMEA 5KHPA 2LBAA 5AQ6A 5AJBA 1BSQA 3S5XA 4A5UA 4QGWA 4QQ1A 1SWOA 2LA7A 4YKMA 1CJLA 5LJDA 1RXHA 4GETA 3QKGA 4ZH9A 5HAEA 1SWJA 1SWTA 3I17A 1TLOA 1SWKA 1BSYA 1E5PA 4OVZB 5H9KA 3FEPA 3SZJA 3UAQA 4OW0A 3PQSA 4X6IA 4NNTA 2HZRA 1XKGA 1I04A 1SY0A 1K3BA 4O4OA 2A8GA 3MHSA 3APWA 3KFIA 4CPHB 5B10O 4OS0A 1CBIA 3IHPA 3MHHA 2OZ2A 4BPVA 4GE1A 4BQUA 4CV7A 3JQOA 2QO6A 3RDQA 4I3CA 1KHQA 4IB7A 2DM5A 1PPDA 4M6SA 5JD2A 2R9OA 1A57A 5LJGA 1KT3A 3CBSA 4I3BA 3RVVA 4MVEA 1NLJA 2OULA 1EXSA 2AF5A 3VG6A 4WFUA 1HQQA 1TW4A 1ICMA 1KT6A 1Y08A 2AS8A 2DCBA 1AU2A 1I05A 3OISA 2B1NA 1KL5A 1OBUA 3C0RA 2A3FX 2DZZA 3QT4A 1PBYA 3DSZA 5K68A 2DOSA 3JS1A 2JQGR 1OEKA 2HD5A 5D8JA 4I04A 3NR3A 1RXJA 4ID2A 5JZEA 2VDFA 1MUPA 1SNKA 5HZQA 1NPZA 3D6SA 2QMIA 1JIWI 2XU4A 1SY1A 1O1VA 1CVZA 1ZNHA 2X4MA 5LJBA 2WEXA 2VHSA 2WUTA 4ZR2A 3VG7A 4NW4A 1MEPA 3WYPA 2RTQB 3CR6A 3H6SA 1BSOA 1EUOA 3RSWA 4COTA 1CBSA 3V8UA 4GGTA 3MTVA 1CBQA 2AUZA 3CMPA 1CV8A 1RSTB 2F09A 1O1UA 1MHWA 1THEA 4OS8A 1QY2A 1DFVA 4PP2E 2RTLA 4P16A 1MIRA 1WBIA 3D96A 1EWOA 2IZJA 4AZQA 3WYQA 3MX7A 3PW3A 3H89A 1B56A 2OY5O 3BU1A 4K7CA 3N91A 1SP4B 4YYVA 2DCDA 3FW4A 2LKKA 2ALLX 2DCAA 5LJEA 3APUA 2GTLN 2CIOA 1G85A 1MDCA 5PADA 4M7MA 1VYFA 2ACOA 1U5IA 4GDZA 2RTGB 1B0OA 1PBOA 2PREA 1OPAA 3F9DA 3QQ2A 4BVMA 2AYOA 4IABA 4INNA 2AL0X 2XSTA 3D9WA 3VG4A 2GH7A 2FO5A 1F2BA 2Q2MA 4I9RA 1Y9LA 4JNJA 1CB5A 2FLJA 4BOPA 3OJYC 2YJ9A 2A13A 1CJ5A 1PPPA 4NLIA 4ZJ0A 4IP3A 1ERBA 3H8CA 3K8UA 4REZA 2OFRX 1FJ1E 1EI5A 2DC7A 1GT5A 1BY8A 2AVIA 1HXLA 5IRUA 4YH0A 2G7BA 4YGHA 3VG5A 1LELA 2FRQA 5D45A 3T1DA 3WZQA 2MM3A 3I3TA 3OE3A 2AKQA 2BTWB 1VWCB 2RN4A 1JJUA 1YWCA 4K19A 4BOZA 2F73A 3S5VA 3FW5A 2QCBA 3PP6A 5F2BA 1AYWA 2AGAA 4WA6A 3EBWA 1EALA 1X71A 1LIDA 2RCQA 1GKAB 5CYBA 1DF8A 4BS6A 2JQFR 2KTDA 4AZPA 1STSB 4CDEA 3U9PC 3H8BA 9PAPA 3ZUAA 1VWQB 1F2AA 4O49A 2Q4NA 4YYRA 4DQ4A 1SWRA 2GFOA 1YZBA 1VWLB 2Q2PA 4D8BA 4BX5B 4ZTBA 2AUXA 1D2UA 4U9CA 4YCHA 5F6ZA 2CB5A 4N7CA 4QGVA 3FIQA 1RSUB 1EQDA 1YT7A 3CQNA 2QM9A 1HXZA 1OEJA 3FIDA 4N8WA 1SRGA 3K3LA 3PH6A 1AVEA 2ZAGA 4TNNA 5EZ2A 4BX6B 2RTMA 3PECA 3D95A 4EEJA 1SLDB 1ITOA 5EF4A 1JQPA 3RDXA 4OELA 4BX7B 3UEVA 4A8ZA 4PI3A 3C78X 1PEEA 1POPA 4HPAA 3ZW0A 4CSBA 4KLBA 2A0AA 4N4ZA 1EW3A 1ZNLA 5C0NA 3O65A 1TVQA 1VWEB 2RTKA 3O1GA 2JU7A
chains in the Genus database with same CATH topology
2P7UA 2YJCA 1QDQA 2GHUA 3LXSA 3CH2X 2F7DA 2YJ8A 1A6RA 2Y5BA 3BWKA 2AYNA 2BSZA 2XU5A 1VJVA 1W5RA 5F02A 3HHIA 4YYSA 4CZWA 1BQIA 2FTDA 2OP3A 3OF9A 4MSXA 1U9WA 1MEGA 3IOQA 2R9NA 3LFYA 3I06A 4PADA 3P5VA 3TNXA 2VHFA 4P6EA 2DJFB 1KHPA 1PADA 1AU3A 3CBKA 3S3QA 3KWBX 3IEJA 1GCBA 1CJLA 2F1GA 4YVAA 4YYWA 2DC8A 1GMYA 3B79A 2FYEA 1TLOA 1DEUA 2PNSA 1U9QX 3O0UA 3WXFA 5CVOB 3OF8A 3OVXA 3MORA 4X6IA 2E03A 1XKGA 2B1MA 1K3BA 3MHSA 1BGOA 4CDDA 1AIMA 4AXMA 4Q8GA 3IHPA 3MHHA 4XUIA 4QRVA 3KX1A 2OZ2A 3KSEA 4BPVA 4CDFA 4BQVA 2FUDA 1DF0A 3K24A 1KHQA 1PPDA 4P6GA 4CDCA 1CPJA 2R9OA 2G7YA 1NB3A 1EWLA 3P5WA 2P86A 1TU6A 4CDCB 1MEMA 1ZIVA 3NHEA 3RVVA 1NQCA 1NLJA 1ZCMA 4W5CA 3QSDA 3RVXA 4ZUXU 2OULA 4CDFB 2BDLA 4QBBA 2DCCA 1Y08A 2AS8A 3USVA 4GUZA 1ICFA 2DCBA 1AU2A 3OISA 5CVMA 1K3BB 2B1NA 4XR7A 2NQGA 2DC6A 3IMAA 2DZZA 1NL6A 3N3GA 3QT4A 2YJBA 1MS6A 1PBHA 5CHTA 1W4TA 3ERVA 2JQGR 2HD5A 4AXLA 4I04A 4X6HA 2VFBA 3KFQA 2NQDB 1BP4A 3P5UA 3WXGA 3BOWA 1SNKA 1PCIA 4FJCA 1NPZA 3D6SA 5A24A 1KXRA 4FIPA 2XU4A 2AU1A 4HWYA 1YVBA 4OEMA 1FH0A 1CVZA 3BPFA 2VHSA 1KFXL 3C9EA 2YJ2A 2XU1A 3S3RA 4MZSA 2BDZA 1M6DA 1EF7A 2HH5A 3H6SA 3KW9A 3RVWA 2AUZA 1CV8A 1MHWA 1THEA 2P0RA 1QMYA 4PP2E 2HHNA 3QJ3A 2ARYA 1YALA 3AI8A 1MIRA 1EWPA 1EWOA 3HD3A 3PW3A 3H89A 3CBJA 4K7CA 1SP4B 4YYVA 2DCDA 3BCNA 1QXPA 2E00A 3E1ZB 3PNRA 5K16A 2DCAA 2CIOA 4W5BA 1AYVA 4Q8HA 5PADA 2PADA 2E01A 1U5IA 1F2CA 2VFCA 2PREA 3LTWA 1YK8A 2DJGB 1ME3A 2AYOA 1AU0A 2G6DA 1CTEA 4NV8A 1CS8A 3D9WA 2FO5A 3DF0A 1F2BA 1TL9A 4YYQA 4X6JA 5CHVA 2FQ9A 3KWZA 1CB5A 3H7DA 2YJ9A 4QH6A 8PCHA 1PPPA 4N79A 5CVNB 1E2TA 3H8CA 1STFE 3K8UA 3V6EA 2H7JA 2NQIA 1X9YA 2DC7A 1BY8A 1QOLA 3F75A 4W4UA 5JA7A 2FRQA 1IWDA 3U8EA 1GX3A 4CDDB 1GLOA 2XU3A 3I3TA 2DZYA 4RY2A 2NQAA 3MTNA 1VSNA 4DMYA 4CDEB 3N3KA 4MZOA 1AYWA 2G8EA 4YYUA 1NB5A 4QRXA 1AYUA 4I05A 4WA6A 3K9MA 2IPPB 2R9CA 3GCBA 1PIPA 2C0YA 3KKUA 2FRAA 4BS6A 3HWNA 2JQFR 4QRGA 4CDEA 3H8BA 3IV2A 9PAPA 1KFUL 1HUCB 3ZUAA 2R9MA 4DMXA 2DJFA 1U9XA 4YV8A 1F2AA 1PPOA 2ATOA 2R9FA 2AIMA 4YYRA 2PBHA 4PP1A 2FT2A 2R6NA 2GFOA 3CH3X 3WXEA 2AUXA 1S4VA 6PADA 2E02A 2CB5A 2IBIA 3BC3A 4G54A 4BGFA 1YT7A 2Y6EA 1ME4A 5JH3A 3F5VA 5FPWA 4N8WA 3PBHA 1ATKA 1W6FA 2HXZA 4I07A 1EWMA 1MDWA 1U9VA 5EGWA 3P5XA 2G8JA 1AU4A 2WBFX 1PPNA 2DC9A 5J94A 3PDFA 4NV7A 3M99A 3IUTA 2DJGA 1CQDA 7PCKA 4BSQA 3BPMA 1AECA 1PXVA 1ITOA 5EF4A 1JQPA 1Y4HA 4OELA 1Q6KA 4B55A 4FK5A 3N4CA 4PI3A 4C5PA 1POPA 3OVZA 1GECE 4BS5A 1PE6A 2ACTA 4KLBA 4N4ZA 1CSBB 2O6XA 3HHAA 2AVWA 3O1GA 1YK7A 1O0EA 3V6CA 1F29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7U A;  2YJC A;  1QDQ A;  2GHU A;  3LXS A;  3CH2 X;  2F7D A;  2YJ8 A;  1A6R A;  2Y5B A;  3BWK A;  2AYN A;  2XU5 A;  1VJV A;  5F02 A;  3HHI A;  4YYS A;  4CZW A;  1BQI A;  2FTD A;  2OP3 A;  3OF9 A;  4MSX A;  1U9W A;  1MEG A;  3IOQ A;  2R9N A;  3LFY A;  3I06 A;  4PAD A;  3P5V A;  3TNX A;  2VHF A;  4P6E A;  2DJF B;  1KHP A;  1PAD A;  1AU3 A;  3CBK A;  3S3Q A;  3KWB X;  3IEJ A;  1GCB A;  1CJL A;  2F1G A;  4YVA A;  4YYW A;  2DC8 A;  1GMY A;  3B79 A;  2FYE A;  1TLO A;  1DEU A;  2PNS A;  1U9Q X;  3O0U A;  3WXF A;  5CVO B;  3OF8 A;  3OVX A;  3MOR A;  4X6I A;  2E03 A;  1XKG A;  2B1M A;  1K3B A;  3MHS A;  1BGO A;  4CDD A;  1AIM A;  4AXM A;  4Q8G A;  3IHP A;  3MHH A;  4XUI A;  4QRV A;  3KX1 A;  2OZ2 A;  3KSE A;  4BPV A;  4CDF A;  4BQV A;  2FUD A;  1DF0 A;  3K24 A;  1KHQ A;  1PPD A;  4P6G A;  4CDC A;  1CPJ A;  2R9O A;  2G7Y A;  1NB3 A;  1EWL A;  3P5W A;  2P86 A;  1TU6 A;  4CDC B;  1MEM A;  1ZIV A;  3NHE A;  3RVV A;  1NQC A;  1NLJ A;  1ZCM A;  4W5C A;  3QSD A;  3RVX A;  4ZUX U;  2OUL A;  4CDF B;  2BDL A;  4QBB A;  2DCC A;  1Y08 A;  2AS8 A;  3USV A;  1ICF A;  2DCB A;  1AU2 A;  3OIS A;  5CVM A;  1K3B B;  2B1N A;  4XR7 A;  2NQG A;  2DC6 A;  3IMA A;  2DZZ A;  1NL6 A;  3N3G A;  3QT4 A;  2YJB A;  1MS6 A;  1PBH A;  5CHT A;  3ERV A;  2JQG R;  2HD5 A;  4AXL A;  4I04 A;  4X6H A;  3KFQ A;  2NQD B;  1BP4 A;  3P5U A;  3WXG A;  3BOW A;  1SNK A;  1PCI A;  4FJC A;  1NPZ A;  3D6S A;  5A24 A;  1KXR A;  4FIP A;  2XU4 A;  2AU1 A;  4HWY A;  1YVB A;  4OEM A;  1FH0 A;  1CVZ A;  3BPF A;  2VHS A;  1KFX L;  3C9E A;  2YJ2 A;  2XU1 A;  3S3R A;  4MZS A;  2BDZ A;  1M6D A;  1EF7 A;  2HH5 A;  3H6S A;  3KW9 A;  3RVW A;  2AUZ A;  1CV8 A;  1MHW A;  1THE A;  2P0R A;  1QMY A;  4PP2 E;  2HHN A;  3QJ3 A;  2ARY A;  1YAL A;  3AI8 A;  1MIR A;  1EWP A;  1EWO A;  3HD3 A;  3PW3 A;  3H89 A;  3CBJ A;  4K7C A;  1SP4 B;  4YYV A;  2DCD A;  3BCN A;  1QXP A;  2E00 A;  3E1Z B;  3PNR A;  5K16 A;  2DCA A;  2CIO A;  4W5B A;  1AYV A;  4Q8H A;  5PAD A;  2PAD A;  2E01 A;  1U5I A;  1F2C A;  2PRE A;  1YK8 A;  2DJG B;  1ME3 A;  2AYO A;  1AU0 A;  2G6D A;  1CTE A;  1CS8 A;  2FO5 A;  3DF0 A;  1F2B A;  1TL9 A;  4YYQ A;  4X6J A;  5CHV A;  2FQ9 A;  3KWZ A;  1CB5 A;  3H7D A;  2YJ9 A;  4QH6 A;  8PCH A;  1PPP A;  4N79 A;  5CVN B;  3H8C A;  1STF E;  3K8U A;  3V6E A;  2H7J A;  2NQI A;  1X9Y A;  2DC7 A;  1BY8 A;  1QOL A;  3F75 A;  4W4U A;  5JA7 A;  2FRQ A;  1IWD A;  3U8E A;  4CDD B;  1GLO A;  2XU3 A;  3I3T A;  2DZY A;  4RY2 A;  2NQA A;  3MTN A;  1VSN A;  4DMY A;  4CDE B;  3N3K A;  4MZO A;  1AYW A;  2G8E A;  4YYU A;  1NB5 A;  4QRX A;  1AYU A;  4I05 A;  4WA6 A;  3K9M A;  2IPP B;  2R9C A;  3GCB A;  1PIP A;  2C0Y A;  3KKU A;  2FRA A;  4BS6 A;  3HWN A;  2JQF R;  4QRG A;  4CDE A;  3H8B A;  3IV2 A;  9PAP A;  1KFU L;  1HUC B;  3ZUA A;  2R9M A;  4DMX A;  2DJF A;  1U9X A;  4YV8 A;  1F2A A;  1PPO A;  2ATO A;  2R9F A;  2AIM A;  4YYR A;  2PBH A;  4PP1 A;  2FT2 A;  2R6N A;  2GFO A;  3CH3 X;  3WXE A;  2AUX A;  1S4V A;  6PAD A;  2E02 A;  2CB5 A;  2IBI A;  3BC3 A;  4G54 A;  1YT7 A;  2Y6E A;  1ME4 A;  5JH3 A;  3F5V A;  5FPW A;  4N8W A;  3PBH A;  1ATK A;  2HXZ A;  4I07 A;  1EWM A;  1MDW A;  1U9V A;  5EGW A;  3P5X A;  2G8J A;  1AU4 A;  2WBF X;  1PPN A;  2DC9 A;  5J94 A;  3PDF A;  3M99 A;  3IUT A;  2DJG A;  1CQD A;  7PCK A;  4BSQ A;  3BPM A;  1AEC A;  1PXV A;  1ITO A;  5EF4 A;  1JQP A;  1Y4H A;  4OEL A;  1Q6K A;  4FK5 A;  3N4C A;  4PI3 A;  1POP A;  3OVZ A;  1GEC E;  4BS5 A;  1PE6 A;  2ACT A;  4KLB A;  4N4Z A;  1CSB B;  2O6X A;  3HHA A;  2AVW A;  3O1G A;  1YK7 A;  1O0E A;  3V6C A;  1F29 A; 
#chains in the Genus database with same CATH topology
 3F6Z B;  1DV9 A;  2GHU A;  3U03 A;  4IMN A;  3GAQ A;  4Y0P A;  2BSZ A;  2K62 A;  3O19 A;  2AYN A;  1LIB A;  2GTF X;  2XU5 A;  3HHI A;  5F02 A;  2CBR A;  4QNI A;  5B11 O;  4GUA A;  4A1Y A;  1SWN A;  3OF9 A;  1SWG A;  4M0W A;  2L67 A;  1KT7 A;  3I06 A;  2POA A;  4PAD A;  3P5V A;  3PPT A;  3KFF A;  2Y3E A;  1QWD A;  3WOV A;  2AT5 X;  5IO6 A;  3BX7 A;  2L68 A;  5IRA A;  1KGL A;  4LQZ A;  4DNE A;  1AU3 A;  2HKD A;  2OVS A;  1UYO X;  4LKP A;  4ZHH A;  3KWB X;  3IEJ A;  1SWP A;  5FEN A;  2FYE A;  3ZWE A;  5LJC A;  2PNS A;  1KT5 A;  4I6S A;  3KZA A;  4QAE A;  4EDE A;  2QOM A;  1FEL A;  1BGO A;  1K24 A;  3KQ0 A;  1H91 A;  5B5G A;  4CDD A;  1KL4 A;  2LB6 A;  3BX8 A;  1UKF A;  4AXM A;  1S2P A;  1HMR A;  1ALB A;  2OVD A;  3HOE A;  1QFV A;  4ES7 A;  4KII A;  4IAW A;  4CDF A;  3Q6L A;  1X8P A;  2FUD A;  5EDC A;  5HZ9 A;  1U18 A;  4P6G A;  2BT9 A;  3PQU A;  2F01 A;  2X8S A;  1NB3 A;  1SRI A;  3P5W A;  1SMP I;  3APX A;  1MEM A;  3NHE A;  1FE3 A;  3AUM O;  4Z2P A;  1O8V A;  1SA8 A;  4CDF B;  4FQB B;  1VWI B;  2Q39 A;  2NNE A;  1YP7 A;  1SRF A;  2C4I A;  4QBB A;  4JHQ A;  5BVQ A;  4TLJ A;  4GU8 A;  4D8I A;  2OL7 A;  2CBS A;  2DCC A;  3USV A;  4GUZ A;  1JYD A;  2UZ2 A;  3TGC A;  3CKF A;  3RDM A;  2NQG A;  2DC6 A;  2JMB A;  2BS5 A;  1MS6 A;  1HMS A;  1QY0 A;  3EC5 A;  3MM0 A;  1NQN A;  1PBH A;  5CHT A;  1W4T A;  3BU9 A;  3ERV A;  2X32 A;  3TGB A;  1KT4 A;  2J7Q A;  3VGW A;  1VWP B;  4X6H A;  1VWH B;  5L3Y A;  2NQD B;  1BP4 A;  1VWA B;  2AMM X;  2X8T A;  1G5W A;  4MIS A;  1MVG A;  1PCI A;  4TJZ A;  4FJC A;  2FR3 A;  5EDB A;  2X56 A;  1SWQ A;  2AU1 A;  4HWY A;  1SXX A;  1FH0 A;  2A2U A;  3BPF A;  4HXD B;  1KFX L;  1RLB E;  4QYP A;  1JBH A;  3S3R A;  1KXO A;  3WJC A;  2A5C A;  3UEW A;  4R3D A;  1LNM A;  1HQP A;  2FE8 A;  3PHW A;  3KW9 A;  2P0R A;  2LFO A;  3STK A;  2HHN A;  1G74 A;  1QFT A;  1EWP A;  4IRW A;  4PT5 A;  2C1S A;  1SWH A;  4GJS A;  5K16 A;  2KT4 B;  5EZQ A;  2JOZ A;  3FLL A;  5LJH A;  3ZW0 B;  1AYV A;  1PMP A;  3ZZV A;  1AVD A;  4BX7 A;  1VWO B;  1STP A;  2HZQ A;  1ME3 A;  1AU0 A;  4CK4 A;  3FR5 A;  1EII A;  4ZGU A;  1A3Y A;  4NLJ A;  1KZW A;  1TL9 A;  3HWD A;  2CAM A;  4ORS A;  3KWZ A;  2IZH B;  5BYP A;  3H3I A;  4QH6 A;  8PCH A;  2C1Q A;  5EPQ A;  4I9S A;  2RCT A;  4HWM A;  5FAZ A;  5CVN B;  4U3Q A;  5B27 A;  1E2T A;  2CM9 A;  3CBC A;  4A1H A;  2K23 A;  2RTP B;  2NQI A;  1X9Y A;  4ZHC A;  4MVK A;  4BX5 A;  1SWD A;  5HA0 A;  2CZT A;  3U8E A;  4CDD B;  3HWF A;  1GLO A;  5HA1 A;  2GTL M;  3NAD A;  3VHM A;  3FA9 A;  3IFU A;  3P6F A;  4BOE A;  4BCS A;  4RF1 A;  1NC9 A;  1VSN A;  2RTO B;  3EMM A;  2P8G A;  1TOW A;  1ACD A;  4TKH A;  4QRL A;  4CDE B;  3N3K A;  2Y3F A;  4MZO A;  3IFB A;  2JW1 A;  1AYU A;  1GKA A;  1OBP A;  4GZV A;  1Y9T A;  4WBK A;  1SXY A;  3RE6 A;  1KL3 A;  3T2W A;  2IPP B;  4ALO A;  1YWB A;  1IKE A;  1QG5 A;  2HWK A;  3O2Y A;  3G7X A;  3KKU A;  4MVL A;  3VPJ E;  2LBV A;  1BEB A;  5IO5 A;  1HUC B;  5B29 A;  2IZE B;  1U9X A;  4ZHD A;  3HTY A;  5H8T A;  2AIM A;  2FKJ A;  3ELZ A;  4KT5 A;  4PP1 A;  2QO4 A;  3MP2 A;  2R6N A;  4TKB A;  3EW1 A;  2WWP A;  4QZU A;  3FMZ A;  5H9N A;  3CH3 X;  3W30 A;  1E06 A;  2JN3 A;  4YVB A;  1S4V A;  2IBI A;  3BC3 A;  2YMS A;  1VPR A;  4BGF A;  1SY3 A;  4GH7 A;  2MF6 A;  1D3S A;  3S26 A;  2Y6E A;  3BLG A;  3P6E A;  3RDU A;  1JJX A;  3UEX A;  1I06 A;  3PBH A;  2PI3 O;  1W6F A;  2HXZ A;  1BBP A;  4I07 A;  4WFV A;  1MDW A;  1U9V A;  2OYB O;  2RTJ A;  1AU4 A;  2DC9 A;  2FGS A;  1R0U A;  4NV7 A;  3M99 A;  1CQD A;  1DZK A;  3E9S A;  1MX8 A;  4ZCB A;  2FWV A;  1IJ8 A;  2JU3 A;  3I0A A;  1LIC A;  1DF3 A;  2O62 A;  1Q6K A;  3JSQ A;  4B55 A;  3RY1 A;  2IZG B;  4FK5 A;  3N4C A;  2AT3 X;  2OVE A;  4C5P A;  4BX6 A;  2ANS A;  5HTE A;  4QYN A;  1GGL A;  4JGL A;  3TRK A;  2AVW A;  3FYF A;  5HTD A;  1BLR A;  4ZGF A;  4RKX A;  1YK7 A;  5FQ7 E;  2IZC B;  3V6C A;  4BBO A;  3CQR A;  1OBQ A;  2L9C A;  3VHH A;  3U0D A;  3FEL A;  1Y53 X;  3EBK A;  3FR4 A;  1KQX A;  1QDQ A;  3LXS A;  1I78 A;  4FBV A;  2F7D A;  2BLG A;  1JMZ A;  3PK2 A;  1W5R A;  5EED A;  4KH8 A;  3T6F A;  1MK5 A;  3PHX A;  1ADL A;  4MSX A;  3WJE A;  2X46 A;  2R9N A;  3LFY A;  4LZU A;  3HWE A;  1FDQ A;  5BVS A;  2VHF A;  4P6E A;  3LHN A;  3O22 A;  1KHP A;  1SXW A;  3B2L A;  4CPF A;  5LJK A;  4U8U N;  1MX7 A;  1SWL A;  3S3Q A;  4ORX A;  1SLG B;  2Q9S A;  1N0S A;  3RKG A;  1LCV A;  4YCE A;  2PY1 A;  3ZQ3 A;  2DC8 A;  4AYH A;  1DC9 A;  2G8C O;  1DEU A;  3O0U A;  3PHU A;  2NND A;  5CVO B;  3OF8 A;  4ODD A;  4NP1 A;  2E03 A;  1VWF B;  2BTW A;  2B1M A;  2IZL B;  2WSJ A;  4Q8G A;  2OZQ A;  4DCB A;  4YGG A;  4QRV A;  3T6L A;  1S44 A;  3KX1 A;  3KSE A;  4XMC A;  4BQV A;  2AT8 X;  1DF0 A;  3RBY A;  1ERX A;  1VYO A;  3P6H A;  2G7Y A;  3RDS A;  5K06 A;  1EWL A;  3OBL A;  4Y0Q A;  3VE2 A;  5E6J A;  1TU6 A;  2X8F A;  1ZIV A;  1NQC A;  1KZX A;  4U8U O;  1ZCM A;  3RVX A;  3QSD A;  4ZUX U;  3B2K A;  1X89 A;  1SWA A;  5L8O A;  2BDL A;  3Q34 A;  4NNS A;  4EKV A;  4MIR A;  1NDJ A;  1U0X A;  4XMG A;  4O3Z A;  2I5Z O;  4AZM A;  4O3X B;  5CVM A;  4YBP A;  1UZ2 X;  4WHI A;  1K3B B;  4XR7 A;  4MI7 A;  1GM6 A;  2WEW A;  3STM X;  1SLF B;  4UU2 A;  1NL6 A;  3N3G A;  3C76 X;  4L3R A;  3P24 A;  1FEN A;  1A18 A;  2FT9 A;  4OVZ A;  3HWG A;  3OD9 A;  4KC8 A;  4O3W A;  1IKJ A;  2VFB A;  3KFQ A;  4ORY A;  2A2G A;  3BOW A;  5B3M O;  1IFC A;  1LCZ A;  3NP1 A;  3NPO A;  3WVM A;  1DZP A;  3P6D A;  2KW1 A;  4OMW A;  4Z27 A;  2JTC A;  3MJ5 A;  5EEE A;  2R56 A;  1YVB A;  4OEM A;  1JJJ A;  4LKT A;  3NX1 A;  2BS6 A;  4O4X A;  3CKG A;  4ZH6 A;  4ORR A;  1YP6 A;  3AEH A;  2YJ2 A;  2CM4 A;  4ZHG A;  1EPA A;  2OF8 A;  2HH5 A;  2RA6 A;  2RD7 C;  2IZK A;  2ZAI A;  5HZ8 A;  1S7D A;  1GT3 A;  1SWU A;  1Z24 A;  4FBO A;  1X8N A;  3WZN A;  4QGX A;  3ZW1 B;  2RQ0 A;  5CE4 A;  1QMY A;  4MM3 B;  1DKI A;  2KTS A;  3BSZ E;  1SWB A;  3QJ3 A;  2ARY A;  1YAL A;  3AI8 A;  4U8U M;  3SLO A;  2OFA A;  4ZFX A;  3CBJ A;  1E00 A;  3BCN A;  2E00 A;  3E3C A;  3HK1 A;  5HBS A;  4YMY A;  4EXZ A;  1YUP A;  1WUB A;  1STR B;  2JU8 A;  4Q8H A;  2PAD A;  2E01 A;  4BJ8 A;  5FQ8 E;  1LDO A;  2FS7 A;  1I4U A;  1LFO A;  3MVF A;  1BRQ A;  1TXL A;  5AJC A;  1IW2 A;  4OMX A;  2FKG A;  3LTW A;  1YK8 A;  3D97 A;  2G6D A;  5HZ5 A;  4RNA A;  4NV8 A;  5FFH A;  5K67 A;  3CWK A;  1OSP O;  4GDA A;  5EZS A;  4D6A A;  2Y32 A;  4X6J A;  2ZSC A;  3ZUI A;  3APV A;  3KFG A;  3PRM A;  2CZU A;  5CHV A;  3ZNH A;  3WZO A;  3B2H A;  3NQ9 A;  4Y5D A;  4XMF A;  2JRI A;  3B2J A;  2NNQ A;  1B8E A;  1LIE A;  2GJ5 A;  4N79 A;  3FR2 A;  1P6P A;  1STF E;  2BU3 A;  2H7J A;  2W2A A;  1SWC A;  1I9H A;  1VYG A;  3BBA A;  5AEO A;  1QOL A;  3F75 A;  4W4U A;  5JA7 A;  4CPH A;  4Z28 A;  1GX3 A;  1PM1 X;  4KC7 A;  4ON1 A;  3RWX A;  4GD9 A;  2XU3 A;  5F7G A;  4GK9 A;  2DZY A;  2OFB A;  5F1E A;  2NQA A;  5H9L A;  1L6M A;  2RTE B;  1ZNG A;  5D48 A;  3WBG A;  1AVG I;  4DMY A;  3OQC A;  3TZS A;  2X45 A;  2HYS A;  5B5F A;  4YYU A;  1NB5 A;  4QRX A;  4I05 A;  5D47 A;  3K9M A;  2OL8 O;  1BRP A;  4PJ2 A;  3B21 A;  2R9C A;  5FQ6 E;  1X8U A;  4ZHF A;  3GCB A;  2NP1 A;  2HLV A;  5F58 A;  2C0Y A;  4DQ3 A;  4QRG A;  1T0V A;  5CHK A;  3IV2 A;  1KFU L;  4YV8 A;  1PPO A;  2ATO A;  1BM5 A;  3SOT A;  2R9F A;  1QQS A;  4GKC A;  1YWA A;  2A5B A;  4GNY A;  2HNX A;  4D6B A;  2FT2 A;  4AZN A;  4AW8 A;  1RXK A;  4GNW A;  3MBT A;  4OS3 A;  1BWY A;  1LCW A;  2X55 A;  4GGR A;  3WXE A;  2GTL O;  3RZY A;  2E02 A;  3ZI8 A;  1N9Y A;  1DZJ A;  4D8E A;  1ME4 A;  1HBP A;  2FHN X;  3F5V A;  1Y55 X;  3AKM A;  5FPW A;  2FR2 A;  3FDC A;  3MG5 A;  3KVN A;  2G78 A;  1LUQ A;  3L4R A;  5KO3 A;  4KCA A;  1ZRY A;  3HPE A;  2WBF X;  4PSQ A;  3FEN A;  1KQW A;  1JMX A;  3IUT A;  2DJG A;  7PCK A;  4O4S A;  4BSQ A;  3BPM A;  1PXV A;  5IRW A;  2UYW A;  3SLJ A;  3VE1 A;  4GGZ A;  4RUN A;  1LIF A;  4YFQ A;  3OVZ A;  1GEC E;  4YKO A;  4BS5 A;  2ACT A;  1N7Y A;  4Z6J A;  2OVA A;  1CSB B;  3UEU A;  4ORU A;  2O6X A;  4Z2V A;  1ZNK A;  1NBX A;  2HMB A;  1O0E A;  1SWF A;  4ARH A;  1CBR A;  4BOS A;  2L5P A;  3FA8 A;  2QOS C;  1VWM B;  3EM0 A;  2YJC A;  1DZM A;  1KFF A;  2OY1 O;  3FEK A;  1A6R A;  3WJG A;  4R0B A;  2RTC B;  2AT6 X;  4YYS A;  4CZW A;  2FTD A;  2Z4I A;  2OY8 A;  1Y0G A;  4BOQ A;  4NYR A;  1MEG A;  5BVT A;  4HPD A;  2M4L A;  3DTQ A;  3BB7 A;  1T68 X;  2DJF B;  4NYQ A;  1N43 A;  2KD2 A;  1PAD A;  1G7N A;  4BOU A;  3CBK A;  2Z84 A;  3RY2 A;  5HZ6 A;  4CPE A;  2WQ9 A;  2R74 A;  3F8A A;  5DPQ A;  5LKE A;  3IA8 A;  1GCB A;  2RTI B;  3PED A;  5H9A A;  2F1G A;  2IZF B;  2X34 A;  4YVA A;  4YYW A;  5F6B A;  3WJD A;  4I60 A;  1GMY A;  3B79 A;  1QAB E;  1U9Q X;  5D4A A;  5HCD C;  3WXF A;  4Z2O A;  2MJI A;  1SRJ A;  3OVX A;  3MOR A;  2BHV A;  2G5L A;  2RTN B;  2IFB A;  1ZND A;  3X00 A;  3ELX A;  4QZT A;  2MO5 A;  2RTF B;  2FTB A;  2AH7 X;  1MOY A;  1AIM A;  4XUI A;  3C77 X;  1AEL A;  1SLE B;  3BS2 A;  3FA7 A;  1VWK B;  1VWR B;  2FRS A;  1LKE A;  5B2A O;  2OL6 O;  4YFP A;  1SRH A;  1A2D A;  3NQ3 A;  1URE A;  3K24 A;  2XKL A;  2EU7 X;  1GX8 A;  4CDC A;  4YDA A;  1CPJ A;  3VG2 A;  4UU3 A;  4EFG A;  3W31 A;  2P86 A;  2IZB A;  1ZNE A;  4CDC B;  4I95 A;  3SZH A;  4O4U A;  4ORW A;  1AQB A;  3WJB A;  2IZA A;  4FBR A;  4W5C A;  3P6G A;  1CRB A;  1T8V A;  2FHL A;  2OF9 A;  3FA6 A;  1PTS A;  1HY2 A;  3D4R A;  3STN A;  3HOL A;  1HN2 A;  4IUM A;  1IIU A;  1ICF A;  4XMD A;  1Y52 X;  1HBQ A;  2RTA A;  4I3D A;  4AZR A;  3IMA A;  3BDR A;  4TQ2 A;  1NP4 A;  2YJB A;  1ICN A;  1VWD B;  4GJV A;  3B2I A;  4IMO A;  4AXL A;  4AZO A;  3RE5 A;  3P5U A;  2W2F A;  3WXG A;  4HPC A;  1ML7 A;  1XCA A;  2ASN X;  4N7D A;  1AB0 A;  5A24 A;  1KXR A;  4FIP A;  3KFH A;  4YBU A;  2BC3 A;  1OEE A;  1YIV A;  4JO6 A;  4ML7 B;  3VG3 A;  3C9E A;  2XU1 A;  1GT4 A;  4MZS A;  3NQK A;  2BDZ A;  1M6D A;  1EF7 A;  4GRJ A;  1GXA A;  3BY0 A;  1XKI A;  4XMH A;  4L1N A;  4LZV A;  3RVW A;  2ACP X;  1PVJ A;  1RAV A;  1N9M A;  5IO7 A;  1LDQ A;  4TKJ A;  1VWG B;  3HD3 A;  3RDO A;  5L8N A;  3VHI A;  1QXP A;  1OPB A;  3E1Z B;  1QY1 A;  3PNR A;  3PT2 A;  2R73 A;  1SWE A;  4W5B A;  2RTR B;  4HFO A;  1VWJ B;  1F2C A;  4WUR A;  2VFC A;  1TOU A;  2I5V O;  3RNV A;  1MM9 A;  1KOI A;  3ZW2 A;  4MEE A;  2DJG B;  1U17 A;  3P02 A;  4IB8 A;  1EIO A;  1UYN X;  1CTE A;  2MWH A;  1CS8 A;  5HWZ A;  4Y0R A;  5CSE A;  3DF0 A;  4YYQ A;  2FQ9 A;  3H7D A;  2JGS A;  3BRN A;  5LKF A;  5DG4 A;  3LV4 A;  1BJ7 A;  2WPU A;  3NX2 A;  1JV4 A;  3V6E A;  1X8O A;  1B4M A;  1GX9 A;  2E4J A;  4RF0 A;  3WXQ A;  1IWD A;  4YDB A;  4YFR A;  2W2B A;  2RTH B;  5JR8 A;  4RY2 A;  2RTD B;  3MTN A;  4Y0S A;  1VWN B;  2RTB B;  2FS6 A;  5KIC A;  5HCE C;  2IZI A;  3TGA A;  2G8E A;  3EYC A;  4IAX A;  3VU1 A;  3T2X A;  1NP1 A;  1PIP A;  2FRA A;  4RUU A;  4IBA A;  1LF7 A;  3HWN A;  3P6C A;  3EW2 A;  2R9M A;  1YWD A;  4DMX A;  2DJF A;  1LPJ A;  2WQA E;  3PH5 A;  4A60 A;  2PBH A;  2QO5 A;  1E02 A;  4EQA C;  1JYJ A;  6PAD A;  4G54 A;  4YGZ A;  4O3Y A;  3S60 A;  2Z4H A;  1FEM A;  5JH3 A;  4O9S A;  5HCC C;  1GT1 A;  1IFB A;  3ZUO A;  5IXG A;  1EPB A;  4CPI A;  3AKN A;  4U46 A;  1HMT A;  4IB6 A;  1ATK A;  3GE2 A;  1EWM A;  1RBP A;  5EGW A;  3P5X A;  2G8J A;  3TF6 A;  1PPN A;  1N4J A;  5J94 A;  3PDF A;  2OY7 A;  1VWB B;  3SLT A;  1FTP A;  1SXU A;  1AEC A;  5KID A;  1Y4H A;  3BY4 A;  4ALB A;  2J7Q C;  1SWS A;  1PE6 A;  1SY2 A;  3HHA A;  5L8I A;  2UZJ A;  2MHD A;  2OFM X;  1NQM A;  4Y59 A;  1F29 A;  3PSE A;  2YG2 A;  2P7U A;  4MVI A;  2N93 A;  3CH2 X;  3ZW1 A;  3SZI A;  2YJ8 A;  3SAO A;  2Y5B A;  3BWK A;  3TMP A;  1VJV A;  2AT0 X;  1BQI A;  2IZD B;  1X8Q A;  4HPB A;  2WR6 A;  4FGI B;  2OP3 A;  1NGL A;  1U9W A;  3WJF A;  2G79 A;  3IOQ A;  1JZU A;  4OKA A;  3WZP A;  3PRP A;  3TNX A;  4XZX A;  4IB9 A;  1SRE A;  3NBX X;  2GC9 A;  4XME A;  5KHP A;  2LBA A;  5AQ6 A;  5AJB A;  1BSQ A;  3S5X A;  4A5U A;  4QGW A;  4QQ1 A;  1SWO A;  2LA7 A;  4YKM A;  1CJL A;  5LJD A;  1RXH A;  4GET A;  3QKG A;  4ZH9 A;  5HAE A;  1SWJ A;  1SWT A;  3I17 A;  1TLO A;  1SWK A;  1BSY A;  1E5P A;  4OVZ B;  5H9K A;  3FEP A;  3SZJ A;  3UAQ A;  4OW0 A;  3PQS A;  4X6I A;  4NNT A;  2HZR A;  1XKG A;  1I04 A;  1SY0 A;  1K3B A;  4O4O A;  2A8G A;  3MHS A;  3APW A;  3KFI A;  4CPH B;  5B10 O;  4OS0 A;  1CBI A;  3IHP A;  3MHH A;  2OZ2 A;  4BPV A;  4GE1 A;  4BQU A;  4CV7 A;  3JQO A;  2QO6 A;  3RDQ A;  4I3C A;  1KHQ A;  4IB7 A;  2DM5 A;  1PPD A;  4M6S A;  5JD2 A;  2R9O A;  1A57 A;  5LJG A;  1KT3 A;  3CBS A;  4I3B A;  3RVV A;  4MVE A;  1NLJ A;  2OUL A;  1EXS A;  2AF5 A;  3VG6 A;  4WFU A;  1HQQ A;  1TW4 A;  1ICM A;  1KT6 A;  1Y08 A;  2AS8 A;  2DCB A;  1AU2 A;  1I05 A;  3OIS A;  2B1N A;  1KL5 A;  1OBU A;  3C0R A;  2A3F X;  2DZZ A;  3QT4 A;  1PBY A;  3DSZ A;  5K68 A;  2DOS A;  3JS1 A;  2JQG R;  1OEK A;  2HD5 A;  5D8J A;  4I04 A;  3NR3 A;  1RXJ A;  4ID2 A;  5JZE A;  2VDF A;  1MUP A;  1SNK A;  5HZQ A;  1NPZ A;  3D6S A;  2QMI A;  1JIW I;  2XU4 A;  1SY1 A;  1O1V A;  1CVZ A;  1ZNH A;  2X4M A;  5LJB A;  2WEX A;  2VHS A;  2WUT A;  4ZR2 A;  3VG7 A;  4NW4 A;  1MEP A;  3WYP A;  2RTQ B;  3CR6 A;  3H6S A;  1BSO A;  1EUO A;  3RSW A;  4COT A;  1CBS A;  3V8U A;  4GGT A;  3MTV A;  1CBQ A;  2AUZ A;  3CMP A;  1CV8 A;  1RST B;  2F09 A;  1O1U A;  1MHW A;  1THE A;  4OS8 A;  1QY2 A;  1DFV A;  4PP2 E;  2RTL A;  4P16 A;  1MIR A;  1WBI A;  3D96 A;  1EWO A;  2IZJ A;  4AZQ A;  3WYQ A;  3MX7 A;  3PW3 A;  3H89 A;  1B56 A;  2OY5 O;  3BU1 A;  4K7C A;  3N91 A;  1SP4 B;  4YYV A;  2DCD A;  3FW4 A;  2LKK A;  2ALL X;  2DCA A;  5LJE A;  3APU A;  2GTL N;  2CIO A;  1G85 A;  1MDC A;  5PAD A;  4M7M A;  1VYF A;  2ACO A;  1U5I A;  4GDZ A;  2RTG B;  1B0O A;  1PBO A;  2PRE A;  1OPA A;  3F9D A;  3QQ2 A;  4BVM A;  2AYO A;  4IAB A;  4INN A;  2AL0 X;  2XST A;  3D9W A;  3VG4 A;  2GH7 A;  2FO5 A;  1F2B A;  2Q2M A;  4I9R A;  1Y9L A;  4JNJ A;  1CB5 A;  2FLJ A;  4BOP A;  3OJY C;  2YJ9 A;  2A13 A;  1CJ5 A;  1PPP A;  4NLI A;  4ZJ0 A;  4IP3 A;  1ERB A;  3H8C A;  3K8U A;  4REZ A;  2OFR X;  1FJ1 E;  1EI5 A;  2DC7 A;  1GT5 A;  1BY8 A;  2AVI A;  1HXL A;  5IRU A;  4YH0 A;  2G7B A;  4YGH A;  3VG5 A;  1LEL A;  2FRQ A;  5D45 A;  3T1D A;  3WZQ A;  2MM3 A;  3I3T A;  3OE3 A;  2AKQ A;  2BTW B;  1VWC B;  2RN4 A;  1JJU A;  1YWC A;  4K19 A;  4BOZ A;  2F73 A;  3S5V A;  3FW5 A;  2QCB A;  3PP6 A;  5F2B A;  1AYW A;  2AGA A;  4WA6 A;  3EBW A;  1EAL A;  1X71 A;  1LID A;  2RCQ A;  1GKA B;  5CYB A;  1DF8 A;  4BS6 A;  2JQF R;  2KTD A;  4AZP A;  1STS B;  4CDE A;  3U9P C;  3H8B A;  9PAP A;  3ZUA A;  1VWQ B;  1F2A A;  4O49 A;  2Q4N A;  4YYR A;  4DQ4 A;  1SWR A;  2GFO A;  1YZB A;  1VWL B;  2Q2P A;  4D8B A;  4BX5 B;  4ZTB A;  2AUX A;  1D2U A;  4U9C A;  4YCH A;  5F6Z A;  2CB5 A;  4N7C A;  4QGV A;  3FIQ A;  1RSU B;  1EQD A;  1YT7 A;  3CQN A;  2QM9 A;  1HXZ A;  1OEJ A;  3FID A;  4N8W A;  1SRG A;  3K3L A;  3PH6 A;  1AVE A;  2ZAG A;  4TNN A;  5EZ2 A;  4BX6 B;  2RTM A;  3PEC A;  3D95 A;  4EEJ A;  1SLD B;  1ITO A;  5EF4 A;  1JQP A;  3RDX A;  4OEL A;  4BX7 B;  3UEV A;  4A8Z A;  4PI3 A;  3C78 X;  1PEE A;  1POP A;  4HPA A;  3ZW0 A;  4CSB A;  4KLB A;  2A0A A;  4N4Z A;  1EW3 A;  1ZNL A;  5C0N A;  3O65 A;  1TVQ A;  1VWE B;  2RTK A;  3O1G A;  2JU7 A; 
#chains in the Genus database with same CATH homology
 2P7U A;  2YJC A;  1QDQ A;  2GHU A;  3LXS A;  3CH2 X;  2F7D A;  2YJ8 A;  1A6R A;  2Y5B A;  3BWK A;  2AYN A;  2BSZ A;  2XU5 A;  1VJV A;  1W5R A;  5F02 A;  3HHI A;  4YYS A;  4CZW A;  1BQI A;  2FTD A;  2OP3 A;  3OF9 A;  4MSX A;  1U9W A;  1MEG A;  3IOQ A;  2R9N A;  3LFY A;  3I06 A;  4PAD A;  3P5V A;  3TNX A;  2VHF A;  4P6E A;  2DJF B;  1KHP A;  1PAD A;  1AU3 A;  3CBK A;  3S3Q A;  3KWB X;  3IEJ A;  1GCB A;  1CJL A;  2F1G A;  4YVA A;  4YYW A;  2DC8 A;  1GMY A;  3B79 A;  2FYE A;  1TLO A;  1DEU A;  2PNS A;  1U9Q X;  3O0U A;  3WXF A;  5CVO B;  3OF8 A;  3OVX A;  3MOR A;  4X6I A;  2E03 A;  1XKG A;  2B1M A;  1K3B A;  3MHS A;  1BGO A;  4CDD A;  1AIM A;  4AXM A;  4Q8G A;  3IHP A;  3MHH A;  4XUI A;  4QRV A;  3KX1 A;  2OZ2 A;  3KSE A;  4BPV A;  4CDF A;  4BQV A;  2FUD A;  1DF0 A;  3K24 A;  1KHQ A;  1PPD A;  4P6G A;  4CDC A;  1CPJ A;  2R9O A;  2G7Y A;  1NB3 A;  1EWL A;  3P5W A;  2P86 A;  1TU6 A;  4CDC B;  1MEM A;  1ZIV A;  3NHE A;  3RVV A;  1NQC A;  1NLJ A;  1ZCM A;  4W5C A;  3QSD A;  3RVX A;  4ZUX U;  2OUL A;  4CDF B;  2BDL A;  4QBB A;  2DCC A;  1Y08 A;  2AS8 A;  3USV A;  4GUZ A;  1ICF A;  2DCB A;  1AU2 A;  3OIS A;  5CVM A;  1K3B B;  2B1N A;  4XR7 A;  2NQG A;  2DC6 A;  3IMA A;  2DZZ A;  1NL6 A;  3N3G A;  3QT4 A;  2YJB A;  1MS6 A;  1PBH A;  5CHT A;  1W4T A;  3ERV A;  2JQG R;  2HD5 A;  4AXL A;  4I04 A;  4X6H A;  2VFB A;  3KFQ A;  2NQD B;  1BP4 A;  3P5U A;  3WXG A;  3BOW A;  1SNK A;  1PCI A;  4FJC A;  1NPZ A;  3D6S A;  5A24 A;  1KXR A;  4FIP A;  2XU4 A;  2AU1 A;  4HWY A;  1YVB A;  4OEM A;  1FH0 A;  1CVZ A;  3BPF A;  2VHS A;  1KFX L;  3C9E A;  2YJ2 A;  2XU1 A;  3S3R A;  4MZS A;  2BDZ A;  1M6D A;  1EF7 A;  2HH5 A;  3H6S A;  3KW9 A;  3RVW A;  2AUZ A;  1CV8 A;  1MHW A;  1THE A;  2P0R A;  1QMY A;  4PP2 E;  2HHN A;  3QJ3 A;  2ARY A;  1YAL A;  3AI8 A;  1MIR A;  1EWP A;  1EWO A;  3HD3 A;  3PW3 A;  3H89 A;  3CBJ A;  4K7C A;  1SP4 B;  4YYV A;  2DCD A;  3BCN A;  1QXP A;  2E00 A;  3E1Z B;  3PNR A;  5K16 A;  2DCA A;  2CIO A;  4W5B A;  1AYV A;  4Q8H A;  5PAD A;  2PAD A;  2E01 A;  1U5I A;  1F2C A;  2VFC A;  2PRE A;  3LTW A;  1YK8 A;  2DJG B;  1ME3 A;  2AYO A;  1AU0 A;  2G6D A;  1CTE A;  4NV8 A;  1CS8 A;  3D9W A;  2FO5 A;  3DF0 A;  1F2B A;  1TL9 A;  4YYQ A;  4X6J A;  5CHV A;  2FQ9 A;  3KWZ A;  1CB5 A;  3H7D A;  2YJ9 A;  4QH6 A;  8PCH A;  1PPP A;  4N79 A;  5CVN B;  1E2T A;  3H8C A;  1STF E;  3K8U A;  3V6E A;  2H7J A;  2NQI A;  1X9Y A;  2DC7 A;  1BY8 A;  1QOL A;  3F75 A;  4W4U A;  5JA7 A;  2FRQ A;  1IWD A;  3U8E A;  1GX3 A;  4CDD B;  1GLO A;  2XU3 A;  3I3T A;  2DZY A;  4RY2 A;  2NQA A;  3MTN A;  1VSN A;  4DMY A;  4CDE B;  3N3K A;  4MZO A;  1AYW A;  2G8E A;  4YYU A;  1NB5 A;  4QRX A;  1AYU A;  4I05 A;  4WA6 A;  3K9M A;  2IPP B;  2R9C A;  3GCB A;  1PIP A;  2C0Y A;  3KKU A;  2FRA A;  4BS6 A;  3HWN A;  2JQF R;  4QRG A;  4CDE A;  3H8B A;  3IV2 A;  9PAP A;  1KFU L;  1HUC B;  3ZUA A;  2R9M A;  4DMX A;  2DJF A;  1U9X A;  4YV8 A;  1F2A A;  1PPO A;  2ATO A;  2R9F A;  2AIM A;  4YYR A;  2PBH A;  4PP1 A;  2FT2 A;  2R6N A;  2GFO A;  3CH3 X;  3WXE A;  2AUX A;  1S4V A;  6PAD A;  2E02 A;  2CB5 A;  2IBI A;  3BC3 A;  4G54 A;  4BGF A;  1YT7 A;  2Y6E A;  1ME4 A;  5JH3 A;  3F5V A;  5FPW A;  4N8W A;  3PBH A;  1ATK A;  1W6F A;  2HXZ A;  4I07 A;  1EWM A;  1MDW A;  1U9V A;  5EGW A;  3P5X A;  2G8J A;  1AU4 A;  2WBF X;  1PPN A;  2DC9 A;  5J94 A;  3PDF A;  4NV7 A;  3M99 A;  3IUT A;  2DJG A;  1CQD A;  7PCK A;  4BSQ A;  3BPM A;  1AEC A;  1PXV A;  1ITO A;  5EF4 A;  1JQP A;  1Y4H A;  4OEL A;  1Q6K A;  4B55 A;  4FK5 A;  3N4C A;  4PI3 A;  4C5P A;  1POP A;  3OVZ A;  1GEC E;  4BS5 A;  1PE6 A;  2ACT A;  4KLB A;  4N4Z A;  1CSB B;  2O6X A;  3HHA A;  2AVW A;  3O1G A;  1YK7 A;  1O0E A;  3V6C A;  1F29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...