3PDFA

Discovery of novel cyanamide-based inhibitors of cathepsin c
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
441
structure length
351
Chain Sequence
DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVFLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl peptidase 1
total genus 98
structure length 351
sequence length 441
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 3pdfA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pdfA02
1ICFA 4N8WA 2R9FA 1X9YA 5EGWA 3C9EA 4YVAA 4MZSA 2FRAA 1NB5A 3PBHA 2E00A 3BWKA 3KWBX 5CVNB 1YALA 1AYVA 2GFOA 3OVXA 1U5IA 4PADA 2JQGR 1EWOA 2R9MA 4XUIA 4CDDA 3O1GA 5K16A 3CBJA 3IEJA 3CH3X 2R9NA 1CV8A 1YT7A 3QT4A 2IBIA 2AYOA 3OISA 2XU4A 2PBHA 1PPDA 2VHSA 1PPPA 3F5VA 2AUZA 1QXPA 2F7DA 1F2AA 2G8EA 2OZ2A 3MHSA 4DMXA 4CDCA 1ME3A 3MHHA 2NQGA 1M6DA 4QRVA 5J94A 1PPOA 2DZZA 4YYQA 1YK8A 3KSEA 1SP4B 3USVA 1Y08A 1CVZA 2FT2A 3V6CA 3K9MA 4W5CA 4HWYA 4CDDB 1MS6A 2XU1A 2O6XA 1DF0A 3OVZA 2HXZA 2YJBA 3IUTA 1AIMA 1U9QX 7PCKA 4CDFA 1AU4A 3BPFA 1QMYA 3O0UA 1GMYA 2AU1A 3P5VA 2AUXA 3NHEA 3P5UA 1GECE 3MTNA 4PP2E 4YYUA 4BS5A 2PADA 3IV2A 4QBBA 4QRXA 2Y5BA 2AIMA 3P5WA 1ATKA 2YJ9A 3KKUA 4N4ZA 2JQFR 1U9XA 3U8EA 2DCAA 4KLBA 1NPZA 2DCBA 1CQDA 4PI3A 1EWMA 1MDWA 3BOWA 4CDFB 4YYRA 1PIPA 4XR7A 1S4VA 2G6DA 1AU3A 1GCBA 2G8JA 2OP3A 1KFXL 2FTDA 2P0RA 1STFE 1AU2A 1PBHA 4AXLA 3P5XA 8PCHA 1IWDA 5CHTA 1GLOA 3IHPA 1AYUA 4RY2A 1KHQA 5JH3A 1PE6A 3BCNA 2FUDA 4I05A 4W4UA 1KHPA 3QJ3A 2DCDA 3E1ZB 1PADA 4FJCA 4N79A 2R9OA 4X6HA 2NQIA 1CJLA 3H8CA 3HWNA 4P6GA 1BGOA 1MIRA 1MEMA 3K24A 2AVWA 1VSNA 1U9WA 3GCBA 1U9VA 4CDCB 3CBKA 5FPWA 4QRGA 3AI8A 3ERVA 3HD3A 1NQCA 5PADA 4CDEB 3RVWA 2F1GA 2HHNA 3H6SA 2BDLA 5EF4A 3RVVA 1VJVA 2DJGA 4QH6A 2VHFA 1PPNA 2IPPB 3H8BA 1QDQA 1A6RA 2FO5A 1EF7A 2BDZA 3WXEA 4BS6A 4ZUXU 1CS8A 1F2BA 1TL9A 1NL6A 3WXFA 4FIPA 1K3BA 3LXSA 3I3TA 4X6JA 2ATOA 3BPMA 4I07A 2ACTA 3WXGA 1BQIA 4X6IA 1PCIA 1TU6A 2R9CA 3S3RA 1CTEA 2PNSA 4OELA 9PAPA 2DJFA 3H7DA 2FRQA 2GHUA 3CH2X 1NB3A 3D6SA 1SNKA 1ITOA 1DEUA 1THEA 1F2CA 4W5BA 3IOQA 2NQDB 1AYWA 3M99A 3PNRA 1Y4HA 5CHVA 4DMYA 1XKGA 2OULA 2NQAA 1QOLA 1AU0A 4P6EA 1YVBA 2E03A 1CSBB 3KX1A 1O0EA 3N3GA 1KXRA 1EWLA 4WA6A 4OEMA 4FK5A 2YJ8A 3HHAA 1F29A 2FQ9A 2DC7A 5CVOB 3DF0A 6PADA 2YJ2A 1Q6KA 4YYSA 3S3QA 3PW3A 1HUCB 3I06A 1MEGA 2AS8A 1ZCMA 3RVXA 3ZUAA 2CB5A 5A24A 1EWPA 4BPVA 2P86A 3V6EA 1YK7A 1BP4A 5CVMA 2H7JA 3KWZA 2B1NA 2P7UA 2DC6A 1POPA 2DJGB 4BQVA 3OF8A 1NLJA 3N3KA 3K8UA 3OF9A 4CDEA 4MZOA 2HD5A 1ME4A 2C0YA 4Q8HA 1AECA 2HH5A 3KFQA 2Y6EA 2R6NA 3MORA 1CB5A 4AXMA 3F75A 3BC3A 1MHWA 2WBFX 3IMAA 3B79A 4BSQA 3KW9A 4YYWA 1ZIVA 2XU5A 3PDFA 1BY8A 2DZYA 2XU3A 4I04A 4YV8A 3TNXA 2PREA 4Q8GA 1K3BB 2AYNA 4MSXA 4K7CA 1CPJA 1FH0A 2E01A 3HHIA 2FYEA 2ARYA 2B1MA 5F02A 3QSDA 2DC8A 2CIOA 2G7YA 2DCCA 2E02A 5JA7A 1JQPA 2DC9A 3H89A 4PP1A 1KFUL 3LFYA 2YJCA 1TLOA 4YYVA 4CZWA 3N4CA 1PXVA 2DJFB 4G54A
chains in the Genus database with same CATH superfamily
4N8WA 2WQAE 5EGWA 1W4TA 4NYQA 3FR4A 2CM4A 2E00A 3BWKA 1H91A 4ZHHA 5CVNB 1YALA 4UU2A 4ZJ0A 2RTAA 3VE2A 4AZQA 2RTOB 2L9CA 5B5FA 3PQUA 2R9MA 3AEHA 4CDDA 2AT8X 1LELA 1Y55X 2OL8O 3CH3X 2FS7A 1YT7A 3QT4A 4LZUA 5FQ8E 4NLJA 1PPPA 1SWKA 2F7DA 1XCAA 4DMXA 2GTLO 1VWPB 3S26A 1ME3A 2FHLA 2NQGA 3NQ9A 4BOSA 1SXYA 3IA8A 4YYQA 3VG5A 3USVA 2GC9A 2OY8A 4TQ2A 4RNAA 4GK9A 2A13A 1EI5A 2ACPX 4W5CA 4HWYA 3B21A 2Q39A 2OFMX 3IUTA 4Z27A 5KO3A 1AIMA 1VWOB 5D4AA 4HPAA 3WJBA 1AU4A 1QMYA 3O0UA 3ZUOA 3JQOA 4OMWA 3P5VA 1YUPA 2AUXA 1X8OA 1I05A 3BB7A 1JMZA 4QZUA 2R74A 4BX5B 2DM5A 3SZHA 3JS1A 1IKJA 2Z4HA 3BX8A 2PADA 1QY0A 2QOMA 3RY1A 3FELA 2I5ZO 1ICMA 4YBPA 4O3YA 1LCVA 1OPAA 2LA7A 2C4IA 4ID2A 1GX9A 1EWMA 3BOWA 5H9LA 1AVDA 2G8JA 3BS2A 1GKAB 4KC8A 1FE3A 1E06A 1PBHA 4Y0QA 4YCEA 5C0NA 3C76X 1BWYA 3BBAA 2VFBA 8PCHA 2QO4A 3CKFA 4CV7A 2OF8A 3CR6A 2FLJA 1IFCA 2RTPB 1QG5A 1SA8A 1KHQA 1SLDB 5HBSA 1MDCA 3APUA 4BX6B 3EBWA 3I0AA 2EU7X 4XMCA 3VHHA 3QJ3A 1PADA 1ICNA 2HWKA 5LJDA 2NQIA 3KFFA 5HA0A 5DG4A 4P6GA 1OEJA 2BT9A 2K62A 2AVWA 2BTWB 2W2AA 3RDQA 4CPHB 1P6PA 5E6JA 1BSYA 1LIFA 3ERVA 4MISA 4ZGUA 5PADA 2ASNX 4CDEB 2ANSA 2FR3A 2BDLA 1VJVA 2DJGA 1QY1A 1TXLA 4QH6A 3PHWA 1ALBA 2ZAGA 4NNSA 1O1VA 2HNXA 1CRBA 1PPNA 1AELA 4YGZA 3TGCA 3O22A 1EF7A 3WJDA 2E4JA 4LKPA 3X00A 2R73A 1CS8A 2A2UA 1SWHA 3PHXA 5EZSA 2XSTA 1XKIA 3NADA 3O2YA 2MO5A 5HZ8A 2RTCB 1DZKA 5HWZA 1KQWA 2LB6A 5IO5A 1VWLB 1ZRYA 4AZOA 1G7NA 5AJCA 4EXZA 3MVFA 3BPMA 4ZH9A 4I3CA 2GTLN 4QGWA 4QZTA 3FW5A 1X8PA 2FT9A 1SXWA 4Y0RA 4BOQA 1ADLA 3RWXA 3CBSA 3ZQ3A 5EZQA 2OVAA 3B2JA 2RTGB 3UEVA 3GAQA 2GHUA 4XMDA 2YMSA 1SLFB 1I78A 2RTDB 1SWNA 4W5BA 2NQDB 3FMZA 1Y4HA 4FGIB 4ZCBA 4B55A 4MEEA 1XKGA 1N4JA 3DTQA 3VHIA 3RDUA 1AU0A 3BRNA 4WHIA 3U9PC 2E03A 1CSBB 3ZNHA 3N3GA 1KXRA 2G8CO 2UZJA 4QGXA 4FK5A 1ML7A 2W2BA 4IBAA 4LQZA 1SRGA 5LJGA 3S5VA 5CVOB 4AZRA 1Q6KA 1BRPA 4WURA 3S3QA 5FQ7E 4KH8A 1HUCB 4ZHFA 4MIRA 3P6CA 1MEGA 2AS8A 2OZQA 1OEKA 3RY2A 1X8UA 5A24A 5LJKA 2P86A 3V6EA 3NBXX 3FR2A 1D2UA 1JYJA 2H7JA 1SWBA 4N7CA 1POPA 1SLGB 5D45A 3OF8A 1KL3A 4NP1A 2OFBA 4NW4A 3N3KA 4FBOA 1Y9TA 2HD5A 3MTVA 4I3BA 2RTFB 2C0YA 4Q8HA 1AECA 2JW1A 4HPCA 2C1SA 1KT6A 4CPIA 5F6ZA 4BVMA 1MVGA 5H8TA 4AXMA 3AKNA 3BC3A 4ARHA 2CBRA 3SLTA 1WBIA 2HZQA 2QMIA 1GX8A 3T2XA 4GUZA 3BY4A 3RDMA 4XZXA 3D9WA 1OEEA 5KHPA 4YYWA 3NQKA 1SRFA 1B0OA 1RBPA 2AKQA 3PDFA 3ZW0A 4D6AA 3VE1A 2A5BA 5BVQA 2DZYA 2G5LA 4OS8A 2WWPA 4YV8A 2AVIA 2F73A 1VWMB 4BX6A 2AYNA 4OKAA 4PJ2A 4ORSA 1HN2A 1HQQA 2OFAA 3ZI8A 5HZ9A 3TZSA 2Q9SA 1KZWA 5EEEA 2CIOA 4HWMA 1E2TA 3IFUA 1STSB 4TKBA 4PP1A 4BOUA 5FFHA 4D8EA 1HXLA 3CMPA 1BSOA 4YYVA 4CZWA 1PXVA 1SWRA 4ORUA 3IFBA 2R9FA 5HTDA 5EDCA 3HK1A 3C9EA 3JSQA 3WJFA 5F2BA 2FRAA 4MZSA 1NB5A 4YFRA 2BU3A 4GNWA 2GFOA 3RKGA 2Q4NA 4O3XB 1S44A 4MVKA 2ALLX 1QFTA 1EWOA 2OVSA 4BX7A 4YGGA 1LKEA 3O1GA 3IEJA 3O65A 3Q34A 1LICA 2IBIA 3PT2A 4U8UM 3CQRA 3F5VA 2AUZA 3MP2A 1ZNLA 2BS5A 2RTHB 2G8EA 3BU1A 2RTIB 4CDCA 2IZKA 1M6DA 1YP6A 1ERXA 4NNTA 3KSEA 1SP4B 1E5PA 1CVZA 2FT2A 3TRKA 3ZW0B 2BLGA 2JMBA 1SWAA 3K9MA 1OBUA 3PH5A 5B11O 1DF0A 3ZZVA 2BC3A 3OVZA 2IZIA 2JU3A 7PCKA 2FTBA 1SWTA 4D8IA 3BPFA 2J7QA 4TLJA 1GMYA 2AU1A 1HMTA 4QYNA 1VWHB 4MM3B 3HOLA 2G78A 2WQ9A 3OJYC 4O3WA 2X4MA 1PBOA 5B3MO 1GECE 1ZNGA 4O4XA 2QCBA 1KL5A 3VG2A 3VPJE 4YYUA 3FR5A 2NNEA 3IV2A 2MM3A 4QRXA 2Y5BA 4TJZA 1SRJA 3NX1A 1S7DA 1GT5A 3FEKA 1LIDA 2DCAA 1VWEB 2DCBA 1A18A 1CQDA 2RTNB 3SLOA 4KIIA 3U0DA 1FELA 4EKVA 3SZJA 3EMMA 3VHMA 4YYRA 2FWVA 1AQBA 2G6DA 1AU3A 1E02A 2AT6X 2FTDA 1AU2A 2FGSA 3O19A 4FBRA 4AXLA 2OYBO 2X8SA 5CHTA 1EUOA 4U9CA 3IHPA 1AYUA 2FRSA 4MVLA 1X8NA 4RY2A 1EXSA 5JH3A 1PE6A 3BCNA 2HKDA 2IZFB 2FUDA 2OL6O 3WOVA 4W4UA 2DCDA 4QNIA 1SWEA 3C77X 1U17A 4FJCA 3WZPA 4X6HA 1CBQA 2ZSCA 4I9SA 4Z6JA 2L5PA 3PK2A 5BVTA 2QOSC 4JO6A 1X71A 3H8CA 3HWNA 3W31A 1BGOA 1MIRA 1MEMA 4IMNA 4ZTBA 1A2DA 2IZEB 1HXZA 1SWCA 1U9WA 3FA7A 4GZVA 2OVEA 3AI8A 3RE5A 3HD3A 4O4UA 1DC9A 1VWIB 3NP1A 4XMHA 5EF4A 2ZAIA 2VHFA 4YVBA 1STPA 2RTLA 1TOWA 4YDBA 3GE2A 3NPOA 4EDEA 5BVSA 4ZFXA 5KIDA 1YWDA 1IIUA 2RTEB 4BS6A 2LBAA 4GKCA 1OBPA 1TL9A 5HCCC 4REZA 1NL6A 4Z2PA 3LXSA 3WZNA 1JZUA 3EW1A 3DSZA 4BQUA 1SWFA 2OY1O 4XMGA 5KICA 1QWDA 2XKLA 4X6IA 5L8OA 2MWHA 2BHVA 3OBLA 1GT4A 2RN4A 4ORYA 2X45A 1LDQA 2RTKA 1RXJA 3H7DA 2BS6A 2RQ0A 1Y9LA 3D6SA 1DKIA 1DEUA 3PRPA 3VG7A 1AYWA 3PNRA 1SMPI 5CHVA 1VWCB 3RZYA 3N91A 1VWDB 4OMXA 4P6EA 3SLJA 4ALBA 1CBSA 4AZMA 3ZW2A 2KT4B 2G79A 1PEEA 4WA6A 4OEMA 2YJ8A 1F29A 1JIWI 4A1HA 1KZXA 2DC7A 3P24A 4ALOA 6PADA 1IJ8A 5IO7A 1MK5A 4YYSA 2RA6A 2O62A 5IXGA 3T6FA 1RAVA 1OPBA 3ZUAA 2CB5A 1EWPA 1EPBA 4U8UN 4TNNA 2WSJA 1SLEB 2B1NA 3OE3A 3CWKA 3K8UA 3OF9A 4GU8A 4MZOA 1MUPA 3RDOA 1PTSA 1HBQA 3AKMA 4ES7A 1CBRA 1HY2A 4NV7A 4GETA 2UYWA 1NP1A 2FE8A 4PT5A 1G74A 1GGLA 2HMBA 4IB9A 1EIOA 5EDBA 1BY8A 1X89A 3T1DA 4DCBA 4QAEA 1MX7A 2MF6A 2PREA 4FBVA 4Q8GA 4MSXA 1N7YA 5F1EA 4BJ8A 3RDSA 3I17A 5L8IA 2RTRB 4IABA 4OS0A 5D8JA 2IZDB 3FA9A 3FW4A 2G7YA 2E02A 5JA7A 1JQPA 4O3ZA 1I9HA 1SWOA 3H89A 2IZAA 1KFUL 3LFYA 2GJ5A 2ACOA 2YJCA 2Q2PA 5BYPA 1NBXA 2DJFB 3PSEA 1I06A 4G54A 3FYFA 3WZQA 3E9SA 3PBHA 1SWLA 1AYVA 3OVXA 1SWPA 1U5IA 5IRAA 4ZHGA 1UYOX 3V8UA 2HYSA 2RTMA 2A5CA 3FA6A 1IW2A 5K16A 3CBJA 2OL7A 3KVNA 2R9NA 1UYNX 1CV8A 1GKAA 1ZNKA 2A2GA 2CBSA 4JHQA 2X8FA 3KFIA 2AYOA 3OISA 2QO5A 4M7MA 1PPDA 2VHSA 1YWBA 4CPHA 5H9NA 4GGRA 2I5VO 1ZNDA 4GDAA 3MHSA 3P6GA 4R3DA 2BTWA 1LFOA 4RUUA 1DF8A 3MHHA 3FIQA 1LCWA 2FR2A 2L68A 2C1QA 1QFVA 4IB8A 3K3LA 4AYHA 4NLIA 2DZZA 3BX7A 1YK8A 4MVIA 1UKFA 3HWGA 2KTSA 5JR8A 3V6CA 2PI3O 4GDZA 4CDDB 1I4UA 3APVA 3ELZA 1MS6A 4O49A 2XU1A 1VWGB 5IRWA 2YJBA 4CK4A 5B27A 1U9QX 3LHNA 1BLRA 3RE6A 3NHEA 2A3FX 1W6FA 3Q6LA 3QQ2A 3WYQA 1NGLA 5L3YA 1S2PA 1RSUB 2VFCA 4I3DA 1AVEA 4PP2E 4D8BA 1B8EA 4HPDA 1O1UA 4P16A 1ATKA 1VWNB 2JU7A 3KKUA 1RXHA 1U9XA 3T6LA 4KLBA 4O9SA 4CPFA 1EALA 1NPZA 3D96A 3L4RA 3HPEA 3U03A 4EFGA 1DF3A 4I6SA 1DZPA 1PIPA 1BSQA 1PMPA 4ZR2A 4AZPA 1LF7A 1LUQA 2AH7X 2IFBA 4RF0A 2WPUA 5F6BA 3FEPA 1O8VA 1STFE 4N7DA 4QRLA 3P5XA 3G7XA 5LJHA 4IUMA 3EM0A 1MOYA 1IWDA 1GLOA 4YDAA 1SWQA 4Y5DA 2WR6A 3NQ3A 1ZNEA 3HOEA 4IB7A 3ZW1B 3CBCA 1KHPA 2M4LA 3E1ZB 2W2FA 1AVGI 3VGWA 3SAOA 4RKXA 1LIBA 3RBYA 3WZOA 1CJLA 4KC7A 1UZ2X 4COTA 4A8ZA 1G5WA 4Z2OA 5EEDA 1GXAA 4BBOA 2R56A 1VSNA 4ML7B 4GUAA 3HWDA 3GCBA 2CZUA 5B29A 3B2LA 1U9VA 3CBKA 4QRGA 3LV4A 3EW2A 2LFOA 3KZAA 4OVZB 3WXQA 4KT5A 3RVWA 3QKGA 3P02A 3RVVA 1SXUA 2RCTA 3RDXA 1LPJA 3VG4A 4BGFA 1KGLA 1FDQA 3H8BA 3BY0A 2JU8A 1QDQA 1RSTB 2FO5A 2BDZA 3WXEA 5K67A 1F2BA 1FJ1E 4TKHA 2NNQA 3P6EA 1NQMA 3MJ5A 4YFQA 3BU9A 4GE1A 3WXFA 1STRB 4YGHA 5B5GA 4L1NA 4FIPA 1K3BA 1KT3A 2CAMA 3PPTA 3APXA 4U46A 4X6JA 2WEWA 3STMX 4I07A 2ACTA 1EIIA 3WXGA 2KTDA 1BQIA 5LKFA 1TU6A 1VYOA 5JZEA 2R9CA 3S3RA 2OY5O 1JJXA 1VYGA 3T2WA 1CBIA 1CTEA 4JNJA 1JMXA 4OELA 5AQ6A 3STNA 2FRQA 3CH2X 1NB3A 5AEOA 1SRHA 1ITOA 3ELXA 1THEA 3PQSA 2FKJA 1F2CA 3IOQA 4IP3A 3M99A 1JBHA 4GGZA 4GJSA 4ORWA 4DMYA 1KT5A 2OULA 1OBQA 4PSQA 1SY1A 1SY3A 1QOLA 2IZGB 1YVBA 2HLVA 2MHDA 3KX1A 1HQPA 1EWLA 5IO6A 2X56A 3PP6A 2KD2A 3HHAA 3LTWA 2FQ9A 1VWRB 4IMOA 1MM9A 3KFHA 4XMEA 2YJ2A 4BOEA 3PW3A 3KFGA 1KFFA 5L8NA 3ZUIA 2J7QC 3PHUA 1ZCMA 3RVXA 2FS6A 4DQ3A 1PBYA 5CVMA 3KWZA 4BCSA 1LNMA 2DC6A 2P7UA 2CM9A 1GT3A 2DJGB 4BQVA 1NLJA 5HZQA 4A5UA 5JD2A 1VWKB 3C78X 3B2HA 3P6FA 4CDEA 2IZLB 1ME4A 1SWGA 3KFQA 4EEJA 4IAWA 4WFVA 3UAQA 1SWJA 4LZVA 3MORA 2YG2A 3WVMA 1T68X 1RXKA 5B10O 1BEBA 2K23A 3EYCA 2Y32A 1VYFA 2WBFX 1SREA 1GM6A 4M6SA 3B79A 2HZRA 1D3SA 4CSBA 3WYPA 3RNVA 1ZIVA 4HXDB 3BSZE 1QABE 4U8UO 1VWAB 3F8AA 2KW1A 5CHKA 4Y59A 4K7CA 1PVJA 1FH0A 1L6MA 3VU1A 3HHIA 4ZGFA 1FEMA 3EC5A 3WJGA 2B1MA 1N0SA 5F02A 3QSDA 1R0UA 3TMPA 2A0AA 4O4SA 4O4OA 2AT3X 4INNA 1GT1A 2FHNX 2DC9A 3OD9A 3D4RA 4QQ1A 3EBKA 1RLBE 4M0WA 4I95A 5B2AO 3N4CA 3WBGA 1MX8A 1QY2A 1UREA 4FQBB 5EZ2A 1ICFA 1X9YA 1TVQA 4YVAA 4OW0A 3KWBX 3BLGA 4CPEA 4PADA 4YBUA 4U3QA 2JQGR 2DOSA 4XUIA 4NYRA 1FTPA 2OFRX 4ODDA 5LJCA 4I60A 3W30A 3UEWA 1LDOA 2NP1A 5F7GA 1BJ7A 4UU3A 2XU4A 5LKEA 2PBHA 2RCQA 3MX7A 1QXPA 1F2AA 1KQXA 4BX5A 2OZ2A 4XMFA 5K68A 2BSZA 2RTBB 1N9YA 4ORXA 4QRVA 5J94A 1KL4A 1PPOA 2WUTA 1Y08A 2PY1A 4DNEA 3D95A 1DZMA 1Y53X 1YZBA 3AUMO 2F09A 2JOZA 3WJEA 1IKEA 2O6XA 1KT4A 2HXZA 1YIVA 1QQSA 1HMSA 2IZHB 4L3RA 4YCHA 5FENA 4Y0PA 4CDFA 2JRIA 1FENA 1IFBA 1K24A 2AT5X 1CJ5A 1YP7A 3P5UA 3CKGA 2Q2MA 3MTNA 1JV4A 2CZTA 3PRMA 1N43A 3HWFA 2X34A 2X55A 5HCEC 4BS5A 2AL0X 4GH7A 4QBBA 2AIMA 3P5WA 3KQ0A 2YJ9A 3WJCA 4LKTA 4N4ZA 2JQFR 3UEXA 3U8EA 3B2KA 3HTYA 3S60A 4AZNA 1AB0A 5K06A 4BOZA 1MEPA 4YMYA 4PI3A 2JTCA 2AMMX 2P8GA 1MDWA 5FAZA 4CDFB 4XR7A 1NP4A 4GGTA 1S4VA 4MI7A 1GCBA 2OP3A 1KFXL 2P0RA 4Y0SA 4WBKA 4Z2VA 5HA1A 1SY2A 4ON1A 4EQAC 4RF1A 1JJJA 1SXXA 3FIDA 2QM9A 1BBPA 3TF6A 1TOUA 2AGAA 2MJIA 3HWEA 2G7BA 4ZHDA 4I05A 1ZNHA 2IZJA 3C0RA 4MVEA 1VPRA 3D97A 1E00A 4IAXA 4N79A 2R9OA 1A57A 3FA8A 1NQNA 1KXOA 3PEDA 2POAA 4OS3A 3RSWA 4ZH6A 4YFPA 4TKJA 4GNYA 1W5RA 5H9KA 3K24A 1WUBA 4GJVA 5HCDC 5HZ6A 2L67A 4CDCB 1YWAA 1DV9A 3NX2A 1NDJA 5FPWA 2IZBA 1VWFB 3MM0A 3PECA 2OVDA 1NQCA 2Y3EA 4ZHCA 2F1GA 2HHNA 3H6SA 2WEXA 4YH0A 2Z84A 1BRQA 3FENA 3P6HA 2N93A 1EQDA 3B2IA 2IPPB 3F9DA 4NV8A 4A60A 3FLLA 1A6RA 1Z24A 5AJBA 4ZUXU 4GRJA 1HMRA 1PM1X 1LCZA 2GTFX 4Z28A 4K19A 4OVZA 2X8TA 4HFOA 1GX3A 5CYBA 3I3TA 3S5XA 2QO6A 5F58A 2ATOA 1ERBA 5D48A 3PH6A 2AT0X 1VWQB 2X46A 1PCIA 1JYDA 3H3IA 2FKGA 1KT7A 3TGBA 4BOPA 4YKMA 2RTJA 4R0BA 1VWJB 5DPQA 1G85A 2PNSA 4WFUA 4QGVA 1Y0GA 9PAPA 2DJFA 1SRIA 1N9MA 5HTEA 4C5PA 1SNKA 1TW4A 1SWDA 1B56A 5LJEA 4RUNA 3STKA 3BDRA 1SWUA 3MG5A 4JGLA 1KOIA 4QYPA 1U18A 4DQ4A 5HZ5A 3SOTA 1YWCA 2NQAA 1A3YA 2LKKA 1Y52X 2RD7C 1LIEA 2JN3A 1U0XA 1O0EA 5H9AA 3MBTA 1HBPA 4YKOA 2VDFA 3DF0A 2NNDA 3I06A 4BX7B 4A1YA 1SY0A 3FDCA 4BPVA 1YK7A 1BP4A 1EW3A 3CQNA 5IRUA 1EPAA 5LJBA 2OF9A 3P6DA 2LBVA 4I9RA 1T8VA 3ZW1A 3ZWEA 5HAEA 1I04A 2HH5A 1B4MA 2Y6EA 3NR3A 3TGAA 4IRWA 3SZIA 2UZ2A 2R6NA 4KCAA 4D6BA 1CB5A 2AF5A 1DZJA 5D47A 1BM5A 3F75A 1X8QA 2X32A 2F01A 1MHWA 4HPBA 3F6ZB 3UEUA 2GTLM 1NC9A 1T0VA 3IMAA 4BSQA 2JGSA 4IB6A 2Z4IA 3KW9A 3OQCA 2XU5A 2IZCB 2Y3FA 1JJUA 2RTQB 5EPQA 2XU3A 4I04A 3TNXA 3VG3A 1VWBB 1K3BB 3VG6A 1CPJA 3APWA 2E01A 1OSPO 2A8GA 2FYEA 5CSEA 3E3CA 2ARYA 1ACDA 2DC8A 4AW8A 2DCCA 5FQ6E 4GD9A 1SWSA 2GH7A 1DFVA 4ORRA 1TLOA 5CE4A 2OY7A
chains in the Genus database with same CATH topology
1ICFA 4N8WA 2R9FA 1X9YA 5EGWA 3C9EA 1W4TA 4YVAA 4MZSA 2FRAA 1NB5A 3PBHA 2E00A 3BWKA 3KWBX 5CVNB 1YALA 1AYVA 2GFOA 3OVXA 1U5IA 4PADA 2JQGR 1EWOA 2R9MA 4XUIA 4CDDA 3O1GA 5K16A 3CBJA 3IEJA 3CH3X 2R9NA 1CV8A 1YT7A 3QT4A 2IBIA 2AYOA 3OISA 2XU4A 2PBHA 1PPDA 2VHSA 1PPPA 3F5VA 2AUZA 1QXPA 2F7DA 1F2AA 2G8EA 2OZ2A 3MHSA 4DMXA 4CDCA 1ME3A 3MHHA 2NQGA 2BSZA 1M6DA 4QRVA 5J94A 1PPOA 2DZZA 4YYQA 1YK8A 3KSEA 1SP4B 3USVA 1Y08A 1CVZA 2FT2A 3V6CA 3K9MA 4W5CA 4HWYA 4CDDB 1MS6A 2XU1A 2O6XA 1DF0A 3OVZA 2HXZA 2YJBA 3IUTA 1AIMA 1U9QX 7PCKA 4CDFA 1AU4A 3BPFA 1QMYA 3O0UA 1GMYA 2AU1A 3P5VA 2AUXA 3NHEA 1W6FA 3P5UA 1GECE 3MTNA 2VFCA 4PP2E 4YYUA 4BS5A 2PADA 3IV2A 4QBBA 4QRXA 2Y5BA 2AIMA 3P5WA 1ATKA 2YJ9A 3KKUA 4N4ZA 2JQFR 1U9XA 3U8EA 2DCAA 4KLBA 1NPZA 2DCBA 1CQDA 4PI3A 1EWMA 1MDWA 3BOWA 4CDFB 4YYRA 1PIPA 4XR7A 1S4VA 2G6DA 1AU3A 1GCBA 2G8JA 2OP3A 1KFXL 2FTDA 2P0RA 1STFE 1AU2A 1PBHA 4AXLA 3P5XA 2VFBA 8PCHA 1IWDA 5CHTA 1GLOA 3IHPA 1AYUA 4RY2A 1KHQA 5JH3A 1PE6A 3BCNA 2FUDA 4I05A 4W4UA 1KHPA 3QJ3A 2DCDA 3E1ZB 1PADA 4FJCA 4N79A 2R9OA 4X6HA 2NQIA 1CJLA 3H8CA 3HWNA 4P6GA 1BGOA 1W5RA 1MIRA 1MEMA 3K24A 2AVWA 1VSNA 1U9WA 3GCBA 1U9VA 4CDCB 3CBKA 5FPWA 4QRGA 3AI8A 3ERVA 3HD3A 1NQCA 5PADA 4CDEB 3RVWA 2F1GA 2HHNA 3H6SA 2BDLA 5EF4A 3RVVA 1VJVA 2DJGA 4QH6A 2VHFA 4BGFA 1PPNA 2IPPB 3H8BA 1QDQA 4NV8A 1A6RA 2FO5A 1EF7A 2BDZA 3WXEA 4BS6A 4ZUXU 1CS8A 1F2BA 1TL9A 1NL6A 3WXFA 4FIPA 1K3BA 3LXSA 1GX3A 3I3TA 4X6JA 2ATOA 3BPMA 4I07A 2ACTA 3WXGA 1BQIA 4X6IA 1PCIA 1TU6A 2R9CA 3S3RA 1CTEA 2PNSA 4OELA 9PAPA 2DJFA 3H7DA 2FRQA 2GHUA 3CH2X 1NB3A 4C5PA 3D6SA 1SNKA 1ITOA 1DEUA 1THEA 1F2CA 4W5BA 3IOQA 2NQDB 1AYWA 3M99A 3PNRA 1Y4HA 5CHVA 4DMYA 4B55A 1XKGA 2OULA 2NQAA 1QOLA 1AU0A 4P6EA 1YVBA 2E03A 1CSBB 3KX1A 1O0EA 3N3GA 1KXRA 1EWLA 4WA6A 4OEMA 4FK5A 2YJ8A 3HHAA 1F29A 3LTWA 2FQ9A 2DC7A 5CVOB 3DF0A 6PADA 2YJ2A 1Q6KA 4YYSA 3S3QA 3PW3A 1HUCB 3I06A 1MEGA 2AS8A 1ZCMA 3RVXA 3ZUAA 2CB5A 5A24A 1EWPA 4BPVA 2P86A 3V6EA 1YK7A 1BP4A 5CVMA 2H7JA 3KWZA 2B1NA 2P7UA 2DC6A 1POPA 2DJGB 4BQVA 3OF8A 1NLJA 3N3KA 3K8UA 3OF9A 4CDEA 4MZOA 2HD5A 1ME4A 2C0YA 4Q8HA 1AECA 2HH5A 3KFQA 2Y6EA 2R6NA 3MORA 1CB5A 4AXMA 4NV7A 3F75A 3BC3A 1MHWA 2WBFX 3IMAA 3B79A 4GUZA 4BSQA 3D9WA 3KW9A 4YYWA 1ZIVA 2XU5A 3PDFA 1BY8A 2DZYA 2XU3A 4I04A 4YV8A 3TNXA 2PREA 4Q8GA 1K3BB 2AYNA 4MSXA 4K7CA 1CPJA 1FH0A 2E01A 3HHIA 2FYEA 2ARYA 2B1MA 5F02A 3QSDA 2DC8A 2CIOA 2G7YA 2DCCA 2E02A 5JA7A 1JQPA 2DC9A 1E2TA 3H89A 4PP1A 1KFUL 3LFYA 2YJCA 1TLOA 4YYVA 4CZWA 3N4CA 1PXVA 2DJFB 4G54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF A;  4N8W A;  2R9F A;  1X9Y A;  5EGW A;  3C9E A;  4YVA A;  4MZS A;  2FRA A;  1NB5 A;  3PBH A;  2E00 A;  3BWK A;  3KWB X;  5CVN B;  1YAL A;  1AYV A;  2GFO A;  3OVX A;  1U5I A;  4PAD A;  2JQG R;  1EWO A;  2R9M A;  4XUI A;  4CDD A;  3O1G A;  5K16 A;  3CBJ A;  3IEJ A;  3CH3 X;  2R9N A;  1CV8 A;  1YT7 A;  3QT4 A;  2IBI A;  2AYO A;  3OIS A;  2XU4 A;  2PBH A;  1PPD A;  2VHS A;  1PPP A;  3F5V A;  2AUZ A;  1QXP A;  2F7D A;  1F2A A;  2G8E A;  2OZ2 A;  3MHS A;  4DMX A;  4CDC A;  1ME3 A;  3MHH A;  2NQG A;  1M6D A;  4QRV A;  5J94 A;  1PPO A;  2DZZ A;  4YYQ A;  1YK8 A;  3KSE A;  1SP4 B;  3USV A;  1Y08 A;  1CVZ A;  2FT2 A;  3V6C A;  3K9M A;  4W5C A;  4HWY A;  4CDD B;  1MS6 A;  2XU1 A;  2O6X A;  1DF0 A;  3OVZ A;  2HXZ A;  2YJB A;  3IUT A;  1AIM A;  1U9Q X;  7PCK A;  4CDF A;  1AU4 A;  3BPF A;  1QMY A;  3O0U A;  1GMY A;  2AU1 A;  3P5V A;  2AUX A;  3NHE A;  3P5U A;  1GEC E;  3MTN A;  4PP2 E;  4YYU A;  4BS5 A;  2PAD A;  3IV2 A;  4QBB A;  4QRX A;  2Y5B A;  2AIM A;  3P5W A;  1ATK A;  2YJ9 A;  3KKU A;  4N4Z A;  2JQF R;  1U9X A;  3U8E A;  2DCA A;  4KLB A;  1NPZ A;  2DCB A;  1CQD A;  4PI3 A;  1EWM A;  1MDW A;  3BOW A;  4CDF B;  4YYR A;  1PIP A;  4XR7 A;  1S4V A;  2G6D A;  1AU3 A;  1GCB A;  2G8J A;  2OP3 A;  1KFX L;  2FTD A;  2P0R A;  1STF E;  1AU2 A;  1PBH A;  4AXL A;  3P5X A;  8PCH A;  1IWD A;  5CHT A;  1GLO A;  3IHP A;  1AYU A;  4RY2 A;  1KHQ A;  5JH3 A;  1PE6 A;  3BCN A;  2FUD A;  4I05 A;  4W4U A;  1KHP A;  3QJ3 A;  2DCD A;  3E1Z B;  1PAD A;  4FJC A;  4N79 A;  2R9O A;  4X6H A;  2NQI A;  1CJL A;  3H8C A;  3HWN A;  4P6G A;  1BGO A;  1MIR A;  1MEM A;  3K24 A;  2AVW A;  1VSN A;  1U9W A;  3GCB A;  1U9V A;  4CDC B;  3CBK A;  5FPW A;  4QRG A;  3AI8 A;  3ERV A;  3HD3 A;  1NQC A;  5PAD A;  4CDE B;  3RVW A;  2F1G A;  2HHN A;  3H6S A;  2BDL A;  5EF4 A;  3RVV A;  1VJV A;  2DJG A;  4QH6 A;  2VHF A;  1PPN A;  2IPP B;  3H8B A;  1QDQ A;  1A6R A;  2FO5 A;  1EF7 A;  2BDZ A;  3WXE A;  4BS6 A;  4ZUX U;  1CS8 A;  1F2B A;  1TL9 A;  1NL6 A;  3WXF A;  4FIP A;  1K3B A;  3LXS A;  3I3T A;  4X6J A;  2ATO A;  3BPM A;  4I07 A;  2ACT A;  3WXG A;  1BQI A;  4X6I A;  1PCI A;  1TU6 A;  2R9C A;  3S3R A;  1CTE A;  2PNS A;  4OEL A;  9PAP A;  2DJF A;  3H7D A;  2FRQ A;  2GHU A;  3CH2 X;  1NB3 A;  3D6S A;  1SNK A;  1ITO A;  1DEU A;  1THE A;  1F2C A;  4W5B A;  3IOQ A;  2NQD B;  1AYW A;  3M99 A;  3PNR A;  1Y4H A;  5CHV A;  4DMY A;  1XKG A;  2OUL A;  2NQA A;  1QOL A;  1AU0 A;  4P6E A;  1YVB A;  2E03 A;  1CSB B;  3KX1 A;  1O0E A;  3N3G A;  1KXR A;  1EWL A;  4WA6 A;  4OEM A;  4FK5 A;  2YJ8 A;  3HHA A;  1F29 A;  2FQ9 A;  2DC7 A;  5CVO B;  3DF0 A;  6PAD A;  2YJ2 A;  1Q6K A;  4YYS A;  3S3Q A;  3PW3 A;  1HUC B;  3I06 A;  1MEG A;  2AS8 A;  1ZCM A;  3RVX A;  3ZUA A;  2CB5 A;  5A24 A;  1EWP A;  4BPV A;  2P86 A;  3V6E A;  1YK7 A;  1BP4 A;  5CVM A;  2H7J A;  3KWZ A;  2B1N A;  2P7U A;  2DC6 A;  1POP A;  2DJG B;  4BQV A;  3OF8 A;  1NLJ A;  3N3K A;  3K8U A;  3OF9 A;  4CDE A;  4MZO A;  2HD5 A;  1ME4 A;  2C0Y A;  4Q8H A;  1AEC A;  2HH5 A;  3KFQ A;  2Y6E A;  2R6N A;  3MOR A;  1CB5 A;  4AXM A;  3F75 A;  3BC3 A;  1MHW A;  2WBF X;  3IMA A;  3B79 A;  4BSQ A;  3KW9 A;  4YYW A;  1ZIV A;  2XU5 A;  3PDF A;  1BY8 A;  2DZY A;  2XU3 A;  4I04 A;  4YV8 A;  3TNX A;  2PRE A;  4Q8G A;  1K3B B;  2AYN A;  4MSX A;  4K7C A;  1CPJ A;  1FH0 A;  2E01 A;  3HHI A;  2FYE A;  2ARY A;  2B1M A;  5F02 A;  3QSD A;  2DC8 A;  2CIO A;  2G7Y A;  2DCC A;  2E02 A;  5JA7 A;  1JQP A;  2DC9 A;  3H89 A;  4PP1 A;  1KFU L;  3LFY A;  2YJC A;  1TLO A;  4YYV A;  4CZW A;  3N4C A;  1PXV A;  2DJF B;  4G54 A; 
#chains in the Genus database with same CATH topology
 4N8W A;  2WQA E;  5EGW A;  1W4T A;  4NYQ A;  3FR4 A;  2CM4 A;  2E00 A;  3BWK A;  1H91 A;  4ZHH A;  5CVN B;  1YAL A;  4UU2 A;  4ZJ0 A;  2RTA A;  3VE2 A;  4AZQ A;  2RTO B;  2L9C A;  5B5F A;  3PQU A;  2R9M A;  3AEH A;  4CDD A;  2AT8 X;  1LEL A;  1Y55 X;  2OL8 O;  3CH3 X;  2FS7 A;  1YT7 A;  3QT4 A;  4LZU A;  5FQ8 E;  4NLJ A;  1PPP A;  1SWK A;  2F7D A;  1XCA A;  4DMX A;  2GTL O;  1VWP B;  3S26 A;  1ME3 A;  2FHL A;  2NQG A;  3NQ9 A;  4BOS A;  1SXY A;  3IA8 A;  4YYQ A;  3VG5 A;  3USV A;  2GC9 A;  2OY8 A;  4TQ2 A;  4RNA A;  4GK9 A;  2A13 A;  1EI5 A;  2ACP X;  4W5C A;  4HWY A;  3B21 A;  2Q39 A;  2OFM X;  3IUT A;  4Z27 A;  5KO3 A;  1AIM A;  1VWO B;  5D4A A;  4HPA A;  3WJB A;  1AU4 A;  1QMY A;  3O0U A;  3ZUO A;  3JQO A;  4OMW A;  3P5V A;  1YUP A;  2AUX A;  1X8O A;  1I05 A;  3BB7 A;  1JMZ A;  4QZU A;  2R74 A;  4BX5 B;  2DM5 A;  3SZH A;  3JS1 A;  1IKJ A;  2Z4H A;  3BX8 A;  2PAD A;  1QY0 A;  2QOM A;  3RY1 A;  3FEL A;  2I5Z O;  1ICM A;  4YBP A;  4O3Y A;  1LCV A;  1OPA A;  2LA7 A;  2C4I A;  4ID2 A;  1GX9 A;  1EWM A;  3BOW A;  5H9L A;  1AVD A;  2G8J A;  3BS2 A;  1GKA B;  4KC8 A;  1FE3 A;  1E06 A;  1PBH A;  4Y0Q A;  4YCE A;  5C0N A;  3C76 X;  1BWY A;  3BBA A;  2VFB A;  8PCH A;  2QO4 A;  3CKF A;  4CV7 A;  2OF8 A;  3CR6 A;  2FLJ A;  1IFC A;  2RTP B;  1QG5 A;  1SA8 A;  1KHQ A;  1SLD B;  5HBS A;  1MDC A;  3APU A;  4BX6 B;  3EBW A;  3I0A A;  2EU7 X;  4XMC A;  3VHH A;  3QJ3 A;  1PAD A;  1ICN A;  2HWK A;  5LJD A;  2NQI A;  3KFF A;  5HA0 A;  5DG4 A;  4P6G A;  1OEJ A;  2BT9 A;  2K62 A;  2AVW A;  2BTW B;  2W2A A;  3RDQ A;  4CPH B;  1P6P A;  5E6J A;  1BSY A;  1LIF A;  3ERV A;  4MIS A;  4ZGU A;  5PAD A;  2ASN X;  4CDE B;  2ANS A;  2FR3 A;  2BDL A;  1VJV A;  2DJG A;  1QY1 A;  1TXL A;  4QH6 A;  3PHW A;  1ALB A;  2ZAG A;  4NNS A;  1O1V A;  2HNX A;  1CRB A;  1PPN A;  1AEL A;  4YGZ A;  3TGC A;  3O22 A;  1EF7 A;  3WJD A;  2E4J A;  4LKP A;  3X00 A;  2R73 A;  1CS8 A;  2A2U A;  1SWH A;  3PHX A;  5EZS A;  2XST A;  1XKI A;  3NAD A;  3O2Y A;  2MO5 A;  5HZ8 A;  2RTC B;  1DZK A;  5HWZ A;  1KQW A;  2LB6 A;  5IO5 A;  1VWL B;  1ZRY A;  4AZO A;  1G7N A;  5AJC A;  4EXZ A;  3MVF A;  3BPM A;  4ZH9 A;  4I3C A;  2GTL N;  4QGW A;  4QZT A;  3FW5 A;  1X8P A;  2FT9 A;  1SXW A;  4Y0R A;  4BOQ A;  1ADL A;  3RWX A;  3CBS A;  3ZQ3 A;  5EZQ A;  2OVA A;  3B2J A;  2RTG B;  3UEV A;  3GAQ A;  2GHU A;  4XMD A;  2YMS A;  1SLF B;  1I78 A;  2RTD B;  1SWN A;  4W5B A;  2NQD B;  3FMZ A;  1Y4H A;  4FGI B;  4ZCB A;  4B55 A;  4MEE A;  1XKG A;  1N4J A;  3DTQ A;  3VHI A;  3RDU A;  1AU0 A;  3BRN A;  4WHI A;  3U9P C;  2E03 A;  1CSB B;  3ZNH A;  3N3G A;  1KXR A;  2G8C O;  2UZJ A;  4QGX A;  4FK5 A;  1ML7 A;  2W2B A;  4IBA A;  4LQZ A;  1SRG A;  5LJG A;  3S5V A;  5CVO B;  4AZR A;  1Q6K A;  1BRP A;  4WUR A;  3S3Q A;  5FQ7 E;  4KH8 A;  1HUC B;  4ZHF A;  4MIR A;  3P6C A;  1MEG A;  2AS8 A;  2OZQ A;  1OEK A;  3RY2 A;  1X8U A;  5A24 A;  5LJK A;  2P86 A;  3V6E A;  3NBX X;  3FR2 A;  1D2U A;  1JYJ A;  2H7J A;  1SWB A;  4N7C A;  1POP A;  1SLG B;  5D45 A;  3OF8 A;  1KL3 A;  4NP1 A;  2OFB A;  4NW4 A;  3N3K A;  4FBO A;  1Y9T A;  2HD5 A;  3MTV A;  4I3B A;  2RTF B;  2C0Y A;  4Q8H A;  1AEC A;  2JW1 A;  4HPC A;  2C1S A;  1KT6 A;  4CPI A;  5F6Z A;  4BVM A;  1MVG A;  5H8T A;  4AXM A;  3AKN A;  3BC3 A;  4ARH A;  2CBR A;  3SLT A;  1WBI A;  2HZQ A;  2QMI A;  1GX8 A;  3T2X A;  4GUZ A;  3BY4 A;  3RDM A;  4XZX A;  3D9W A;  1OEE A;  5KHP A;  4YYW A;  3NQK A;  1SRF A;  1B0O A;  1RBP A;  2AKQ A;  3PDF A;  3ZW0 A;  4D6A A;  3VE1 A;  2A5B A;  5BVQ A;  2DZY A;  2G5L A;  4OS8 A;  2WWP A;  4YV8 A;  2AVI A;  2F73 A;  1VWM B;  4BX6 A;  2AYN A;  4OKA A;  4PJ2 A;  4ORS A;  1HN2 A;  1HQQ A;  2OFA A;  3ZI8 A;  5HZ9 A;  3TZS A;  2Q9S A;  1KZW A;  5EEE A;  2CIO A;  4HWM A;  1E2T A;  3IFU A;  1STS B;  4TKB A;  4PP1 A;  4BOU A;  5FFH A;  4D8E A;  1HXL A;  3CMP A;  1BSO A;  4YYV A;  4CZW A;  1PXV A;  1SWR A;  4ORU A;  3IFB A;  2R9F A;  5HTD A;  5EDC A;  3HK1 A;  3C9E A;  3JSQ A;  3WJF A;  5F2B A;  2FRA A;  4MZS A;  1NB5 A;  4YFR A;  2BU3 A;  4GNW A;  2GFO A;  3RKG A;  2Q4N A;  4O3X B;  1S44 A;  4MVK A;  2ALL X;  1QFT A;  1EWO A;  2OVS A;  4BX7 A;  4YGG A;  1LKE A;  3O1G A;  3IEJ A;  3O65 A;  3Q34 A;  1LIC A;  2IBI A;  3PT2 A;  4U8U M;  3CQR A;  3F5V A;  2AUZ A;  3MP2 A;  1ZNL A;  2BS5 A;  2RTH B;  2G8E A;  3BU1 A;  2RTI B;  4CDC A;  2IZK A;  1M6D A;  1YP6 A;  1ERX A;  4NNT A;  3KSE A;  1SP4 B;  1E5P A;  1CVZ A;  2FT2 A;  3TRK A;  3ZW0 B;  2BLG A;  2JMB A;  1SWA A;  3K9M A;  1OBU A;  3PH5 A;  5B11 O;  1DF0 A;  3ZZV A;  2BC3 A;  3OVZ A;  2IZI A;  2JU3 A;  7PCK A;  2FTB A;  1SWT A;  4D8I A;  3BPF A;  2J7Q A;  4TLJ A;  1GMY A;  2AU1 A;  1HMT A;  4QYN A;  1VWH B;  4MM3 B;  3HOL A;  2G78 A;  2WQ9 A;  3OJY C;  4O3W A;  2X4M A;  1PBO A;  5B3M O;  1GEC E;  1ZNG A;  4O4X A;  2QCB A;  1KL5 A;  3VG2 A;  3VPJ E;  4YYU A;  3FR5 A;  2NNE A;  3IV2 A;  2MM3 A;  4QRX A;  2Y5B A;  4TJZ A;  1SRJ A;  3NX1 A;  1S7D A;  1GT5 A;  3FEK A;  1LID A;  2DCA A;  1VWE B;  2DCB A;  1A18 A;  1CQD A;  2RTN B;  3SLO A;  4KII A;  3U0D A;  1FEL A;  4EKV A;  3SZJ A;  3EMM A;  3VHM A;  4YYR A;  2FWV A;  1AQB A;  2G6D A;  1AU3 A;  1E02 A;  2AT6 X;  2FTD A;  1AU2 A;  2FGS A;  3O19 A;  4FBR A;  4AXL A;  2OYB O;  2X8S A;  5CHT A;  1EUO A;  4U9C A;  3IHP A;  1AYU A;  2FRS A;  4MVL A;  1X8N A;  4RY2 A;  1EXS A;  5JH3 A;  1PE6 A;  3BCN A;  2HKD A;  2IZF B;  2FUD A;  2OL6 O;  3WOV A;  4W4U A;  2DCD A;  4QNI A;  1SWE A;  3C77 X;  1U17 A;  4FJC A;  3WZP A;  4X6H A;  1CBQ A;  2ZSC A;  4I9S A;  4Z6J A;  2L5P A;  3PK2 A;  5BVT A;  2QOS C;  4JO6 A;  1X71 A;  3H8C A;  3HWN A;  3W31 A;  1BGO A;  1MIR A;  1MEM A;  4IMN A;  4ZTB A;  1A2D A;  2IZE B;  1HXZ A;  1SWC A;  1U9W A;  3FA7 A;  4GZV A;  2OVE A;  3AI8 A;  3RE5 A;  3HD3 A;  4O4U A;  1DC9 A;  1VWI B;  3NP1 A;  4XMH A;  5EF4 A;  2ZAI A;  2VHF A;  4YVB A;  1STP A;  2RTL A;  1TOW A;  4YDB A;  3GE2 A;  3NPO A;  4EDE A;  5BVS A;  4ZFX A;  5KID A;  1YWD A;  1IIU A;  2RTE B;  4BS6 A;  2LBA A;  4GKC A;  1OBP A;  1TL9 A;  5HCC C;  4REZ A;  1NL6 A;  4Z2P A;  3LXS A;  3WZN A;  1JZU A;  3EW1 A;  3DSZ A;  4BQU A;  1SWF A;  2OY1 O;  4XMG A;  5KIC A;  1QWD A;  2XKL A;  4X6I A;  5L8O A;  2MWH A;  2BHV A;  3OBL A;  1GT4 A;  2RN4 A;  4ORY A;  2X45 A;  1LDQ A;  2RTK A;  1RXJ A;  3H7D A;  2BS6 A;  2RQ0 A;  1Y9L A;  3D6S A;  1DKI A;  1DEU A;  3PRP A;  3VG7 A;  1AYW A;  3PNR A;  1SMP I;  5CHV A;  1VWC B;  3RZY A;  3N91 A;  1VWD B;  4OMX A;  4P6E A;  3SLJ A;  4ALB A;  1CBS A;  4AZM A;  3ZW2 A;  2KT4 B;  2G79 A;  1PEE A;  4WA6 A;  4OEM A;  2YJ8 A;  1F29 A;  1JIW I;  4A1H A;  1KZX A;  2DC7 A;  3P24 A;  4ALO A;  6PAD A;  1IJ8 A;  5IO7 A;  1MK5 A;  4YYS A;  2RA6 A;  2O62 A;  5IXG A;  3T6F A;  1RAV A;  1OPB A;  3ZUA A;  2CB5 A;  1EWP A;  1EPB A;  4U8U N;  4TNN A;  2WSJ A;  1SLE B;  2B1N A;  3OE3 A;  3CWK A;  3K8U A;  3OF9 A;  4GU8 A;  4MZO A;  1MUP A;  3RDO A;  1PTS A;  1HBQ A;  3AKM A;  4ES7 A;  1CBR A;  1HY2 A;  4NV7 A;  4GET A;  2UYW A;  1NP1 A;  2FE8 A;  4PT5 A;  1G74 A;  1GGL A;  2HMB A;  4IB9 A;  1EIO A;  5EDB A;  1BY8 A;  1X89 A;  3T1D A;  4DCB A;  4QAE A;  1MX7 A;  2MF6 A;  2PRE A;  4FBV A;  4Q8G A;  4MSX A;  1N7Y A;  5F1E A;  4BJ8 A;  3RDS A;  3I17 A;  5L8I A;  2RTR B;  4IAB A;  4OS0 A;  5D8J A;  2IZD B;  3FA9 A;  3FW4 A;  2G7Y A;  2E02 A;  5JA7 A;  1JQP A;  4O3Z A;  1I9H A;  1SWO A;  3H89 A;  2IZA A;  1KFU L;  3LFY A;  2GJ5 A;  2ACO A;  2YJC A;  2Q2P A;  5BYP A;  1NBX A;  2DJF B;  3PSE A;  1I06 A;  4G54 A;  3FYF A;  3WZQ A;  3E9S A;  3PBH A;  1SWL A;  1AYV A;  3OVX A;  1SWP A;  1U5I A;  5IRA A;  4ZHG A;  1UYO X;  3V8U A;  2HYS A;  2RTM A;  2A5C A;  3FA6 A;  1IW2 A;  5K16 A;  3CBJ A;  2OL7 A;  3KVN A;  2R9N A;  1UYN X;  1CV8 A;  1GKA A;  1ZNK A;  2A2G A;  2CBS A;  4JHQ A;  2X8F A;  3KFI A;  2AYO A;  3OIS A;  2QO5 A;  4M7M A;  1PPD A;  2VHS A;  1YWB A;  4CPH A;  5H9N A;  4GGR A;  2I5V O;  1ZND A;  4GDA A;  3MHS A;  3P6G A;  4R3D A;  2BTW A;  1LFO A;  4RUU A;  1DF8 A;  3MHH A;  3FIQ A;  1LCW A;  2FR2 A;  2L68 A;  2C1Q A;  1QFV A;  4IB8 A;  3K3L A;  4AYH A;  4NLI A;  2DZZ A;  3BX7 A;  1YK8 A;  4MVI A;  1UKF A;  3HWG A;  2KTS A;  5JR8 A;  3V6C A;  2PI3 O;  4GDZ A;  4CDD B;  1I4U A;  3APV A;  3ELZ A;  1MS6 A;  4O49 A;  2XU1 A;  1VWG B;  5IRW A;  2YJB A;  4CK4 A;  5B27 A;  1U9Q X;  3LHN A;  1BLR A;  3RE6 A;  3NHE A;  2A3F X;  1W6F A;  3Q6L A;  3QQ2 A;  3WYQ A;  1NGL A;  5L3Y A;  1S2P A;  1RSU B;  2VFC A;  4I3D A;  1AVE A;  4PP2 E;  4D8B A;  1B8E A;  4HPD A;  1O1U A;  4P16 A;  1ATK A;  1VWN B;  2JU7 A;  3KKU A;  1RXH A;  1U9X A;  3T6L A;  4KLB A;  4O9S A;  4CPF A;  1EAL A;  1NPZ A;  3D96 A;  3L4R A;  3HPE A;  3U03 A;  4EFG A;  1DF3 A;  4I6S A;  1DZP A;  1PIP A;  1BSQ A;  1PMP A;  4ZR2 A;  4AZP A;  1LF7 A;  1LUQ A;  2AH7 X;  2IFB A;  4RF0 A;  2WPU A;  5F6B A;  3FEP A;  1O8V A;  1STF E;  4N7D A;  4QRL A;  3P5X A;  3G7X A;  5LJH A;  4IUM A;  3EM0 A;  1MOY A;  1IWD A;  1GLO A;  4YDA A;  1SWQ A;  4Y5D A;  2WR6 A;  3NQ3 A;  1ZNE A;  3HOE A;  4IB7 A;  3ZW1 B;  3CBC A;  1KHP A;  2M4L A;  3E1Z B;  2W2F A;  1AVG I;  3VGW A;  3SAO A;  4RKX A;  1LIB A;  3RBY A;  3WZO A;  1CJL A;  4KC7 A;  1UZ2 X;  4COT A;  4A8Z A;  1G5W A;  4Z2O A;  5EED A;  1GXA A;  4BBO A;  2R56 A;  1VSN A;  4ML7 B;  4GUA A;  3HWD A;  3GCB A;  2CZU A;  5B29 A;  3B2L A;  1U9V A;  3CBK A;  4QRG A;  3LV4 A;  3EW2 A;  2LFO A;  3KZA A;  4OVZ B;  3WXQ A;  4KT5 A;  3RVW A;  3QKG A;  3P02 A;  3RVV A;  1SXU A;  2RCT A;  3RDX A;  1LPJ A;  3VG4 A;  4BGF A;  1KGL A;  1FDQ A;  3H8B A;  3BY0 A;  2JU8 A;  1QDQ A;  1RST B;  2FO5 A;  2BDZ A;  3WXE A;  5K67 A;  1F2B A;  1FJ1 E;  4TKH A;  2NNQ A;  3P6E A;  1NQM A;  3MJ5 A;  4YFQ A;  3BU9 A;  4GE1 A;  3WXF A;  1STR B;  4YGH A;  5B5G A;  4L1N A;  4FIP A;  1K3B A;  1KT3 A;  2CAM A;  3PPT A;  3APX A;  4U46 A;  4X6J A;  2WEW A;  3STM X;  4I07 A;  2ACT A;  1EII A;  3WXG A;  2KTD A;  1BQI A;  5LKF A;  1TU6 A;  1VYO A;  5JZE A;  2R9C A;  3S3R A;  2OY5 O;  1JJX A;  1VYG A;  3T2W A;  1CBI A;  1CTE A;  4JNJ A;  1JMX A;  4OEL A;  5AQ6 A;  3STN A;  2FRQ A;  3CH2 X;  1NB3 A;  5AEO A;  1SRH A;  1ITO A;  3ELX A;  1THE A;  3PQS A;  2FKJ A;  1F2C A;  3IOQ A;  4IP3 A;  3M99 A;  1JBH A;  4GGZ A;  4GJS A;  4ORW A;  4DMY A;  1KT5 A;  2OUL A;  1OBQ A;  4PSQ A;  1SY1 A;  1SY3 A;  1QOL A;  2IZG B;  1YVB A;  2HLV A;  2MHD A;  3KX1 A;  1HQP A;  1EWL A;  5IO6 A;  2X56 A;  3PP6 A;  2KD2 A;  3HHA A;  3LTW A;  2FQ9 A;  1VWR B;  4IMO A;  1MM9 A;  3KFH A;  4XME A;  2YJ2 A;  4BOE A;  3PW3 A;  3KFG A;  1KFF A;  5L8N A;  3ZUI A;  2J7Q C;  3PHU A;  1ZCM A;  3RVX A;  2FS6 A;  4DQ3 A;  1PBY A;  5CVM A;  3KWZ A;  4BCS A;  1LNM A;  2DC6 A;  2P7U A;  2CM9 A;  1GT3 A;  2DJG B;  4BQV A;  1NLJ A;  5HZQ A;  4A5U A;  5JD2 A;  1VWK B;  3C78 X;  3B2H A;  3P6F A;  4CDE A;  2IZL B;  1ME4 A;  1SWG A;  3KFQ A;  4EEJ A;  4IAW A;  4WFV A;  3UAQ A;  1SWJ A;  4LZV A;  3MOR A;  2YG2 A;  3WVM A;  1T68 X;  1RXK A;  5B10 O;  1BEB A;  2K23 A;  3EYC A;  2Y32 A;  1VYF A;  2WBF X;  1SRE A;  1GM6 A;  4M6S A;  3B79 A;  2HZR A;  1D3S A;  4CSB A;  3WYP A;  3RNV A;  1ZIV A;  4HXD B;  3BSZ E;  1QAB E;  4U8U O;  1VWA B;  3F8A A;  2KW1 A;  5CHK A;  4Y59 A;  4K7C A;  1PVJ A;  1FH0 A;  1L6M A;  3VU1 A;  3HHI A;  4ZGF A;  1FEM A;  3EC5 A;  3WJG A;  2B1M A;  1N0S A;  5F02 A;  3QSD A;  1R0U A;  3TMP A;  2A0A A;  4O4S A;  4O4O A;  2AT3 X;  4INN A;  1GT1 A;  2FHN X;  2DC9 A;  3OD9 A;  3D4R A;  4QQ1 A;  3EBK A;  1RLB E;  4M0W A;  4I95 A;  5B2A O;  3N4C A;  3WBG A;  1MX8 A;  1QY2 A;  1URE A;  4FQB B;  5EZ2 A;  1ICF A;  1X9Y A;  1TVQ A;  4YVA A;  4OW0 A;  3KWB X;  3BLG A;  4CPE A;  4PAD A;  4YBU A;  4U3Q A;  2JQG R;  2DOS A;  4XUI A;  4NYR A;  1FTP A;  2OFR X;  4ODD A;  5LJC A;  4I60 A;  3W30 A;  3UEW A;  1LDO A;  2NP1 A;  5F7G A;  1BJ7 A;  4UU3 A;  2XU4 A;  5LKE A;  2PBH A;  2RCQ A;  3MX7 A;  1QXP A;  1F2A A;  1KQX A;  4BX5 A;  2OZ2 A;  4XMF A;  5K68 A;  2BSZ A;  2RTB B;  1N9Y A;  4ORX A;  4QRV A;  5J94 A;  1KL4 A;  1PPO A;  2WUT A;  1Y08 A;  2PY1 A;  4DNE A;  3D95 A;  1DZM A;  1Y53 X;  1YZB A;  3AUM O;  2F09 A;  2JOZ A;  3WJE A;  1IKE A;  2O6X A;  1KT4 A;  2HXZ A;  1YIV A;  1QQS A;  1HMS A;  2IZH B;  4L3R A;  4YCH A;  5FEN A;  4Y0P A;  4CDF A;  2JRI A;  1FEN A;  1IFB A;  1K24 A;  2AT5 X;  1CJ5 A;  1YP7 A;  3P5U A;  3CKG A;  2Q2M A;  3MTN A;  1JV4 A;  2CZT A;  3PRM A;  1N43 A;  3HWF A;  2X34 A;  2X55 A;  5HCE C;  4BS5 A;  2AL0 X;  4GH7 A;  4QBB A;  2AIM A;  3P5W A;  3KQ0 A;  2YJ9 A;  3WJC A;  4LKT A;  4N4Z A;  2JQF R;  3UEX A;  3U8E A;  3B2K A;  3HTY A;  3S60 A;  4AZN A;  1AB0 A;  5K06 A;  4BOZ A;  1MEP A;  4YMY A;  4PI3 A;  2JTC A;  2AMM X;  2P8G A;  1MDW A;  5FAZ A;  4CDF B;  4XR7 A;  1NP4 A;  4GGT A;  1S4V A;  4MI7 A;  1GCB A;  2OP3 A;  1KFX L;  2P0R A;  4Y0S A;  4WBK A;  4Z2V A;  5HA1 A;  1SY2 A;  4ON1 A;  4EQA C;  4RF1 A;  1JJJ A;  1SXX A;  3FID A;  2QM9 A;  1BBP A;  3TF6 A;  1TOU A;  2AGA A;  2MJI A;  3HWE A;  2G7B A;  4ZHD A;  4I05 A;  1ZNH A;  2IZJ A;  3C0R A;  4MVE A;  1VPR A;  3D97 A;  1E00 A;  4IAX A;  4N79 A;  2R9O A;  1A57 A;  3FA8 A;  1NQN A;  1KXO A;  3PED A;  2POA A;  4OS3 A;  3RSW A;  4ZH6 A;  4YFP A;  4TKJ A;  4GNY A;  1W5R A;  5H9K A;  3K24 A;  1WUB A;  4GJV A;  5HCD C;  5HZ6 A;  2L67 A;  4CDC B;  1YWA A;  1DV9 A;  3NX2 A;  1NDJ A;  5FPW A;  2IZB A;  1VWF B;  3MM0 A;  3PEC A;  2OVD A;  1NQC A;  2Y3E A;  4ZHC A;  2F1G A;  2HHN A;  3H6S A;  2WEX A;  4YH0 A;  2Z84 A;  1BRQ A;  3FEN A;  3P6H A;  2N93 A;  1EQD A;  3B2I A;  2IPP B;  3F9D A;  4NV8 A;  4A60 A;  3FLL A;  1A6R A;  1Z24 A;  5AJB A;  4ZUX U;  4GRJ A;  1HMR A;  1PM1 X;  1LCZ A;  2GTF X;  4Z28 A;  4K19 A;  4OVZ A;  2X8T A;  4HFO A;  1GX3 A;  5CYB A;  3I3T A;  3S5X A;  2QO6 A;  5F58 A;  2ATO A;  1ERB A;  5D48 A;  3PH6 A;  2AT0 X;  1VWQ B;  2X46 A;  1PCI A;  1JYD A;  3H3I A;  2FKG A;  1KT7 A;  3TGB A;  4BOP A;  4YKM A;  2RTJ A;  4R0B A;  1VWJ B;  5DPQ A;  1G85 A;  2PNS A;  4WFU A;  4QGV A;  1Y0G A;  9PAP A;  2DJF A;  1SRI A;  1N9M A;  5HTE A;  4C5P A;  1SNK A;  1TW4 A;  1SWD A;  1B56 A;  5LJE A;  4RUN A;  3STK A;  3BDR A;  1SWU A;  3MG5 A;  4JGL A;  1KOI A;  4QYP A;  1U18 A;  4DQ4 A;  5HZ5 A;  3SOT A;  1YWC A;  2NQA A;  1A3Y A;  2LKK A;  1Y52 X;  2RD7 C;  1LIE A;  2JN3 A;  1U0X A;  1O0E A;  5H9A A;  3MBT A;  1HBP A;  4YKO A;  2VDF A;  3DF0 A;  2NND A;  3I06 A;  4BX7 B;  4A1Y A;  1SY0 A;  3FDC A;  4BPV A;  1YK7 A;  1BP4 A;  1EW3 A;  3CQN A;  5IRU A;  1EPA A;  5LJB A;  2OF9 A;  3P6D A;  2LBV A;  4I9R A;  1T8V A;  3ZW1 A;  3ZWE A;  5HAE A;  1I04 A;  2HH5 A;  1B4M A;  2Y6E A;  3NR3 A;  3TGA A;  4IRW A;  3SZI A;  2UZ2 A;  2R6N A;  4KCA A;  4D6B A;  1CB5 A;  2AF5 A;  1DZJ A;  5D47 A;  1BM5 A;  3F75 A;  1X8Q A;  2X32 A;  2F01 A;  1MHW A;  4HPB A;  3F6Z B;  3UEU A;  2GTL M;  1NC9 A;  1T0V A;  3IMA A;  4BSQ A;  2JGS A;  4IB6 A;  2Z4I A;  3KW9 A;  3OQC A;  2XU5 A;  2IZC B;  2Y3F A;  1JJU A;  2RTQ B;  5EPQ A;  2XU3 A;  4I04 A;  3TNX A;  3VG3 A;  1VWB B;  1K3B B;  3VG6 A;  1CPJ A;  3APW A;  2E01 A;  1OSP O;  2A8G A;  2FYE A;  5CSE A;  3E3C A;  2ARY A;  1ACD A;  2DC8 A;  4AW8 A;  2DCC A;  5FQ6 E;  4GD9 A;  1SWS A;  2GH7 A;  1DFV A;  4ORR A;  1TLO A;  5CE4 A;  2OY7 A; 
#chains in the Genus database with same CATH homology
 1ICF A;  4N8W A;  2R9F A;  1X9Y A;  5EGW A;  3C9E A;  1W4T A;  4YVA A;  4MZS A;  2FRA A;  1NB5 A;  3PBH A;  2E00 A;  3BWK A;  3KWB X;  5CVN B;  1YAL A;  1AYV A;  2GFO A;  3OVX A;  1U5I A;  4PAD A;  2JQG R;  1EWO A;  2R9M A;  4XUI A;  4CDD A;  3O1G A;  5K16 A;  3CBJ A;  3IEJ A;  3CH3 X;  2R9N A;  1CV8 A;  1YT7 A;  3QT4 A;  2IBI A;  2AYO A;  3OIS A;  2XU4 A;  2PBH A;  1PPD A;  2VHS A;  1PPP A;  3F5V A;  2AUZ A;  1QXP A;  2F7D A;  1F2A A;  2G8E A;  2OZ2 A;  3MHS A;  4DMX A;  4CDC A;  1ME3 A;  3MHH A;  2NQG A;  2BSZ A;  1M6D A;  4QRV A;  5J94 A;  1PPO A;  2DZZ A;  4YYQ A;  1YK8 A;  3KSE A;  1SP4 B;  3USV A;  1Y08 A;  1CVZ A;  2FT2 A;  3V6C A;  3K9M A;  4W5C A;  4HWY A;  4CDD B;  1MS6 A;  2XU1 A;  2O6X A;  1DF0 A;  3OVZ A;  2HXZ A;  2YJB A;  3IUT A;  1AIM A;  1U9Q X;  7PCK A;  4CDF A;  1AU4 A;  3BPF A;  1QMY A;  3O0U A;  1GMY A;  2AU1 A;  3P5V A;  2AUX A;  3NHE A;  1W6F A;  3P5U A;  1GEC E;  3MTN A;  2VFC A;  4PP2 E;  4YYU A;  4BS5 A;  2PAD A;  3IV2 A;  4QBB A;  4QRX A;  2Y5B A;  2AIM A;  3P5W A;  1ATK A;  2YJ9 A;  3KKU A;  4N4Z A;  2JQF R;  1U9X A;  3U8E A;  2DCA A;  4KLB A;  1NPZ A;  2DCB A;  1CQD A;  4PI3 A;  1EWM A;  1MDW A;  3BOW A;  4CDF B;  4YYR A;  1PIP A;  4XR7 A;  1S4V A;  2G6D A;  1AU3 A;  1GCB A;  2G8J A;  2OP3 A;  1KFX L;  2FTD A;  2P0R A;  1STF E;  1AU2 A;  1PBH A;  4AXL A;  3P5X A;  2VFB A;  8PCH A;  1IWD A;  5CHT A;  1GLO A;  3IHP A;  1AYU A;  4RY2 A;  1KHQ A;  5JH3 A;  1PE6 A;  3BCN A;  2FUD A;  4I05 A;  4W4U A;  1KHP A;  3QJ3 A;  2DCD A;  3E1Z B;  1PAD A;  4FJC A;  4N79 A;  2R9O A;  4X6H A;  2NQI A;  1CJL A;  3H8C A;  3HWN A;  4P6G A;  1BGO A;  1W5R A;  1MIR A;  1MEM A;  3K24 A;  2AVW A;  1VSN A;  1U9W A;  3GCB A;  1U9V A;  4CDC B;  3CBK A;  5FPW A;  4QRG A;  3AI8 A;  3ERV A;  3HD3 A;  1NQC A;  5PAD A;  4CDE B;  3RVW A;  2F1G A;  2HHN A;  3H6S A;  2BDL A;  5EF4 A;  3RVV A;  1VJV A;  2DJG A;  4QH6 A;  2VHF A;  4BGF A;  1PPN A;  2IPP B;  3H8B A;  1QDQ A;  4NV8 A;  1A6R A;  2FO5 A;  1EF7 A;  2BDZ A;  3WXE A;  4BS6 A;  4ZUX U;  1CS8 A;  1F2B A;  1TL9 A;  1NL6 A;  3WXF A;  4FIP A;  1K3B A;  3LXS A;  1GX3 A;  3I3T A;  4X6J A;  2ATO A;  3BPM A;  4I07 A;  2ACT A;  3WXG A;  1BQI A;  4X6I A;  1PCI A;  1TU6 A;  2R9C A;  3S3R A;  1CTE A;  2PNS A;  4OEL A;  9PAP A;  2DJF A;  3H7D A;  2FRQ A;  2GHU A;  3CH2 X;  1NB3 A;  4C5P A;  3D6S A;  1SNK A;  1ITO A;  1DEU A;  1THE A;  1F2C A;  4W5B A;  3IOQ A;  2NQD B;  1AYW A;  3M99 A;  3PNR A;  1Y4H A;  5CHV A;  4DMY A;  4B55 A;  1XKG A;  2OUL A;  2NQA A;  1QOL A;  1AU0 A;  4P6E A;  1YVB A;  2E03 A;  1CSB B;  3KX1 A;  1O0E A;  3N3G A;  1KXR A;  1EWL A;  4WA6 A;  4OEM A;  4FK5 A;  2YJ8 A;  3HHA A;  1F29 A;  3LTW A;  2FQ9 A;  2DC7 A;  5CVO B;  3DF0 A;  6PAD A;  2YJ2 A;  1Q6K A;  4YYS A;  3S3Q A;  3PW3 A;  1HUC B;  3I06 A;  1MEG A;  2AS8 A;  1ZCM A;  3RVX A;  3ZUA A;  2CB5 A;  5A24 A;  1EWP A;  4BPV A;  2P86 A;  3V6E A;  1YK7 A;  1BP4 A;  5CVM A;  2H7J A;  3KWZ A;  2B1N A;  2P7U A;  2DC6 A;  1POP A;  2DJG B;  4BQV A;  3OF8 A;  1NLJ A;  3N3K A;  3K8U A;  3OF9 A;  4CDE A;  4MZO A;  2HD5 A;  1ME4 A;  2C0Y A;  4Q8H A;  1AEC A;  2HH5 A;  3KFQ A;  2Y6E A;  2R6N A;  3MOR A;  1CB5 A;  4AXM A;  4NV7 A;  3F75 A;  3BC3 A;  1MHW A;  2WBF X;  3IMA A;  3B79 A;  4GUZ A;  4BSQ A;  3D9W A;  3KW9 A;  4YYW A;  1ZIV A;  2XU5 A;  3PDF A;  1BY8 A;  2DZY A;  2XU3 A;  4I04 A;  4YV8 A;  3TNX A;  2PRE A;  4Q8G A;  1K3B B;  2AYN A;  4MSX A;  4K7C A;  1CPJ A;  1FH0 A;  2E01 A;  3HHI A;  2FYE A;  2ARY A;  2B1M A;  5F02 A;  3QSD A;  2DC8 A;  2CIO A;  2G7Y A;  2DCC A;  2E02 A;  5JA7 A;  1JQP A;  2DC9 A;  1E2T A;  3H89 A;  4PP1 A;  1KFU L;  3LFY A;  2YJC A;  1TLO A;  4YYV A;  4CZW A;  3N4C A;  1PXV A;  2DJF B;  4G54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...