3T1DA

The mutant structure of human siderocalin w79a, r81a, y106f bound to enterobactin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
175
structure length
175
Chain Sequence
STSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYAIATFVPGSQPGEFTLGNIKSYPGLTSFLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Parsing the functional specificity of Siderocalin / Lipocalin 2 / NGAL for siderophores and related small-molecule ligands
rcsb
source organism Homo sapiens
total genus 41
structure length 175
sequence length 175
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3t1dA00
1O1VA 4ZH6A 5H9KA 3B2HA 1A2DA 4YCHA 1KOIA 3BS2A 1YUPA 4HPDA 3DTQA 4ORUA 4EXZA 3WBGA 5H9AA 4ORYA 2R74A 1X8NA 2Q2MA 4N7CA 4N7DA 1IFBA 1ICMA 4YGZA 3VG4A 1BJ7A 4QYPA 1Z24A 1CRBA 1OPAA 4BQUA 1KQWA 2LFOA 1AELA 4ZHDA 3NP1A 3G7XA 1NGLA 4GE1A 5EZ2A 1ERXA 4IB7A 1RLBE 1AQBA 4ZFXA 3UEVA 2AH7X 3C78X 1S44A 3APUA 4GRJA 1SXYA 4YGHA 5L8OA 1TW4A 4TKBA 3EM0A 3WVMA 4I9RA 3PH6A 3VG2A 2L67A 3APXA 1O1UA 1ZRYA 1S2PA 2HMBA 1JZUA 1CBSA 4HPCA 3CBCA 1X8PA 1PM1X 2WR6A 2BLGA 4ZHGA 1YWCA 1ICNA 1QFTA 3P6CA 1LIEA 3U9PC 4Y0PA 2CZTA 1LIDA 3KFFA 3VG7A 1QQSA 4YKMA 4BVMA 4QGVA 4I3CA 5HZ8A 1KZXA 3P6HA 1KT7A 1YWAA 3B2IA 3HWEA 5F6BA 2R56A 1A3YA 1TXLA 3IFBA 1UZ2X 1HN2A 1TOUA 1IIUA 2WWPA 3T1DA 3TGAA 5HZQA 4XMDA 2XSTA 3VG5A 1OEEA 4YGGA 1XKIA 1IFCA 1PEEA 1DF3A 2LB6A 1EQDA 2RQ0A 5HTDA 3BLGA 1AVGI 1ERBA 2NNDA 4XMHA 1B56A 1BEBA 2HNXA 4TKHA 1I4UA 2KT4B 4GETA 1T8VA 5DPQA 5HA1A 3ZQ3A 1FE3A 4YBUA 2K62A 3B2KA 5KIDA 1OBPA 1E02A 2QO6A 4NLIA 4QAEA 4GNWA 5KICA 2CBRA 3PH5A 1LIBA 3S26A 3B2LA 5HWZA 2JOZA 1TOWA 3I17A 4AZQA 3O2YA 4YDBA 5EEEA 1E00A 1QABE 2X46A 2Q9SA 5IO5A 2CM4A 3HK1A 2OZQA 2AKQA 3AKNA 3ELZA 3WJFA 3PEDA 4AYHA 4D6AA 1ADLA 2LKKA 1ML7A 2L9CA 1FDQA 1G7NA 1P6PA 3UEUA 3BDRA 1T0VA 3AKMA 4YKOA 3BX7A 3L4RA 3STMX 5KHPA 2QOSC 1NP1A 2ACOA 3EYCA 1D2UA 3FMZA 4OS3A 5D45A 5F58A 2AT8X 2A3FX 4EEJA 1GKAA 5B29A 3FENA 3RSWA 2G79A 2ASNX 1D3SA 3FA6A 5CE4A 5HCCC 1JBHA 3WJCA 2RD7C 3GAQA 3CWKA 3F9DA 1SY0A 3O22A 2HZQA 2NP1A 3BU9A 3VG3A 1OBUA 2W2BA 1OBQA 4A1YA 2AT6X 2MO5A 3VG6A 2QM9A 5HA0A 3P6EA 1YWDA 3HWFA 4XMCA 4XMEA 5HCDC 1CBRA 1ZNDA 1QFVA 3KFIA 4AZPA 1EPAA 2JN3A 2WQAE 3D95A 2W2FA 1B8EA 1BSOA 1MX7A 5LJKA 3TGCA 4NYQA 1DZKA 1LICA 1PBOA 1IKJA 2ANSA 3NADA 1E5PA 2FTBA 1DZMA 1FENA 3MBTA 1VYFA 4IAXA 4ARHA 4ORSA 1DV9A 3FELA 3UEWA 1JJJA 2FR3A 4LZUA 1BBPA 1GT4A 1LF7A 3CBSA 1OPBA 3FEPA 2MJIA 3BX8A 2RCTA 4YFRA 3FR5A 1ZNHA 3B2JA 5L8IA 1OEJA 1GX8A 3TZSA 4XMFA 4IB6A 1GT5A 3F8AA 2DM5A 3O19A 3TF6A 1IKEA 2G78A 2O62A 5D8JA 1VPRA 1U0XA 2G7BA 4AZRA 1SY1A 4IB9A 1MDCA 3UEXA 3ELXA 2WQ9A 4ORWA 3APVA 1SA8A 1HMTA 3STKA 4BOEA 4PSQA 4OMWA 2W2AA 3NQ9A 3P6GA 2PY1A 5HAEA 3IA8A 4OS8A 4RUNA 3SAOA 2AMMX 1MVGA 1BSYA 2HYSA 2GTFX 1B4MA 4O9SA 2POAA 5HTEA 1ZNLA 2KTDA 4QGXA 4ES7A 4Y0SA 2FS6A 2WUTA 2N93A 5LJBA 1ALBA 1CBIA 3KFHA 4MVLA 2FRSA 1KT4A 1EPBA 5BVSA 1G85A 4QZUA 1U18A 2JU3A 4CK4A 1GGLA 1LNMA 2ACPX 1MUPA 2FWVA 2WEXA 2CBSA 2WSJA 4WFUA 5HBSA 5BVTA 3D96A 2OVEA 4ZHFA 3FW5A 1OEKA 4XMGA 1B0OA 2CM9A 1GM6A 3OJYC 3U03A 1A57A 4YMYA 4I3BA 1KZWA 1S7DA 4IAWA 4UU3A 3JSQA 1TVQA 3NX2A 3JS1A 3WJBA 4GKCA 1GT1A 4YFPA 1DFVA 1E06A 3TGBA 5H8TA 1YP6A 1YWBA 4IMOA 1EUOA 1SXXA 1GX9A 4QGWA 4I9SA 2FT9A 5B27A 1GXAA 1DZPA 1DZJA 1QY0A 2FS7A 2GJ5A 3QKGA 1YIVA 3BSZE 4AZOA 4NNTA 3I0AA 2OVAA 4AW8A 3APWA 1HQPA 4LKTA 1KXOA 1ZNEA 3FA8A 1RBPA 4M6SA 5LKFA 2L68A 1EIIA 5C0NA 2ALLX 1YP7A 1X71A 5AQ6A 3WJDA 3CQRA 2L5PA 1X8UA 4HFOA 4ORXA 1XCAA 4YFQA 2OFMX 2FLJA 5D47A 1UREA 4NYRA 2Q4NA 1EIOA 1N0SA 2AT5X 4RUUA 5HZ9A 1KGLA 2X45A 1CJ5A 1IW2A 4NLJA 1R0UA 3D97A 4KIIA 4K19A 4MVIA 1FEMA 2XKLA 2AT3X 5L8NA 5EDCA 5LJCA 3CMPA 1JJXA 3C76X 4WFVA 1ZNGA 1KQXA 1DC9A 1T68X 4LKPA 1LPJA 2GC9A 3WJGA 4YCEA 5LKEA 1JYDA 5EPQA 4ALBA 1X8OA 3PECA 5HZ5A 1LKEA 4QZTA 1NP4A 1BRQA 4ZR2A 4NP1A 1SXUA 1KT6A 1BSQA 4HPBA 5LJGA 3MVFA 1LFOA 3STNA 3BU1A 4IB8A 4EFGA 1GKAB 3EBKA 4TQ2A 1HMSA 4OS0A 3C77X 4ZJ0A 4M7MA 5FFHA 5K06A 2K23A 2QO4A 5EEDA 3HWDA 3KZAA 1MX8A 2NNQA 2EU7X 4Y0QA 2R73A 3K3LA 3FA7A 5F1EA 1SXWA 3CR6A 1G5WA 1L6MA 5LJEA 3P6DA 3BY0A 2AL0X 2HZRA 4ZHHA 5LJHA 5HCEC 5F6ZA 1SY3A 5D48A 1FTPA 1QG5A 2P8GA 4ODDA 3FA9A 1JV4A 1X8QA 3NX1A 4YDAA 5HZ6A 5IO6A 3FEKA 3EMMA 3Q6LA 5JR8A 1VYGA 4AZNA 4NNSA 5D4AA 1JYJA 1BRPA 2F73A 5LJDA 1HBPA 2RA6A 1ZNKA 3DSZA 4ALOA 3CQNA 1ACDA 4YBPA 3WJEA 1H91A 2E4JA 5F7GA 1QY2A 4AZMA 1KT5A 5H9NA 4DQ3A 1PMPA 4MVKA 4OMXA 4TNNA 1SY2A 1HMRA 4ZH9A 4TKJA 3U0DA 1I06A 1BLRA 1U17A 3HWGA 1EW3A 2A2UA 4ZHCA 2JU8A 5FAZA 2WEWA 4LZVA 2LBVA 3KFGA 4TLJA 3FIQA 3FW4A 1FELA 3RZYA 5H9LA 2QO5A 3PP6A 1CBQA 2FR2A 2CZUA 4ZCBA 3FR2A 4YH0A 3EBWA 4QYNA 1A18A 2IFBA 2Q2PA 4IBAA 1G74A 2JU7A 1HBQA 2RCQA 4GNYA 3NR3A 3FR4A 4IMNA 4WBKA 4ZGUA 4EDEA 2HLVA 1GT3A 1O8VA 2LBAA 2OVDA 1EALA 2A0AA 2AT0X 1LIFA 4Y0RA 4UU2A 1BM5A 5FENA 2A2GA 3ZUIA 4D6BA 2MM3A 1KT3A 3BRNA 5IO7A 4I3DA 4A60A 2A13A 3KQ0A 3WXQA 1EXSA 3FLLA 1AB0A 5BVQA 2Q39A 4R0BA 4GH7A 3ZUOA 4HPAA 1I05A 4DQ4A 5EDBA 4TJZA 5DG4A 3PPTA 4A1HA 4ORRA 3P6FA 1X89A 2NNEA 1I04A 1QWDA 2OFRX 3NQ3A 2YG2A 1BWYA 1QY1A 4A8ZA 3NPOA
chains in the Genus database with same CATH superfamily
1O1VA 3E3CA 4ZH6A 5H9KA 3B2HA 2RTLA 2Z4HA 2C1QA 1A2DA 2UZ2A 4YCHA 1KOIA 3EW2A 3NBXX 3V8UA 3BS2A 3ZW0B 1YUPA 1SWCA 2BS6A 4HPDA 3DTQA 4NV7A 4ORUA 4EXZA 1SWOA 3WBGA 4CSBA 4C5PA 5H9AA 4ORYA 2R74A 1JQPA 1X8NA 2Q2MA 4GGRA 2RTMA 4GZVA 4N7CA 3RE6A 1SWKA 4N7DA 1PBYA 2G8CO 1IFBA 1ICMA 2RTQB 5B5FA 1STPA 4OELA 4Y59A 4Z2OA 4YGZA 3VG4A 3EC5A 1BJ7A 4NW4A 4QYPA 1Z24A 1SLGB 1CRBA 1OPAA 4BQUA 1KQWA 1VWOB 2LFOA 3JQOA 2FKJA 4ZHDA 3NP1A 1AELA 3G7XA 1NGLA 4GE1A 5EZ2A 4GUZA 3ZW2A 5B10O 1ERXA 4I60A 4IB7A 4KC8A 1RLBE 1VWFB 1AQBA 5K68A 3UAQA 3UEVA 4ZFXA 3D9WA 1GX3A 4NV8A 2AH7X 3C78X 1S44A 2GTLM 3APUA 2RTOB 2OF9A 1SXYA 4GRJA 4YGHA 1TW4A 4DCBA 4TKBA 5L8OA 3EM0A 3WVMA 1KFFA 2KW1A 4I9RA 3PH6A 3S5XA 1NC9A 3SZJA 3VG2A 2L67A 5CSEA 3APXA 1WBIA 1O1UA 1SWGA 1ZRYA 2A5CA 1S2PA 2MWHA 4JO6A 3VE2A 3VGWA 1STRB 2HMBA 5IRWA 1JZUA 1SWNA 1CBSA 2DJGA 2MF6A 4HPCA 1N9MA 3CBCA 1X8PA 1PM1X 4CPHB 2WR6A 2BLGA 3FIDA 4ZHGA 1YWCA 1AVEA 1ICNA 1QFTA 3P6CA 1LIEA 2BC3A 2GTLN 4Y0PA 3U9PC 2BHVA 1VWNB 1LIDA 2CZTA 1LELA 3KFFA 3VG7A 1QQSA 4YKMA 4BVMA 4QGVA 4I3CA 1FJ1E 5HZ8A 3T2XA 1KZXA 3P6HA 1SWEA 2RTPB 1KT7A 1YWAA 3B2IA 3HWEA 5F6BA 2R56A 1A3YA 1TXLA 3IFBA 1UZ2X 1HN2A 1TOUA 1IIUA 2IZCB 2WWPA 2QOMA 3T1DA 3TGAA 3HOLA 5HZQA 4XMDA 1Y53X 2C1SA 2XSTA 3VG5A 1OEEA 4YGGA 1XKIA 1IFCA 1PEEA 1DF3A 2LB6A 1STSB 3WZQA 1EQDA 2RQ0A 3N91A 5HTDA 3BLGA 1AVGI 1ERBA 1N4JA 2HKDA 2NNDA 2RTDB 3QQ2A 4XMHA 4FBOA 4O3ZA 5FQ8E 3VHHA 1B56A 1BEBA 4LQZA 2HNXA 2JGSA 1I4UA 2KT4B 3P24A 4GETA 1T8VA 4TKHA 3WZNA 5DPQA 4GU8A 5HA1A 3ZQ3A 1SWJA 1FE3A 4YBUA 2K62A 2FHNX 4KCAA 3B2KA 5KIDA 1OBPA 1E02A 2QO6A 3OBLA 4NLIA 4QAEA 4GNWA 1SWTA 3KVNA 3VPJE 5KICA 5AJBA 2CBRA 3PH5A 1LIBA 3S26A 1NQMA 3B2LA 5CYBA 2JOZA 5HWZA 1TOWA 3I17A 3S5VA 4AZQA 4L1NA 3O2YA 4YDBA 4O3XB 1E00A 5EEEA 3ZZVA 1QABE 2X46A 2Q9SA 5IO5A 2DJFA 1JMZA 1PTSA 2CM4A 3HK1A 3FYFA 2OZQA 2AKQA 2F09A 5B3MO 2OY1O 3AKNA 3ELZA 3WJFA 3PEDA 4AYHA 3LHNA 4D6AA 4INNA 1ADLA 2LKKA 1ML7A 2JMBA 2L9CA 1I78A 3SOTA 1FDQA 1G7NA 2A8GA 1P6PA 1SWAA 3RKGA 3BDRA 3UEUA 1T0VA 2QCBA 3AKMA 4YKOA 4CPIA 3BX7A 3L4RA 4CDFA 3STMX 1RXKA 5KHPA 2QOSC 4ID2A 1NP1A 1VWKB 1JIWI 2ACOA 3WOVA 1SRGA 3EYCA 1D2UA 2Y32A 3FMZA 3MX7A 4OS3A 2AT8X 5D45A 2A3FX 5F58A 1GKAA 4EEJA 5B29A 3FENA 1SWQA 2G79A 2ASNX 2IZEB 3RDXA 2VFCA 1D3SA 3FA6A 3RSWA 4CDCA 5CE4A 4JHQA 5HCCC 3WJCA 1JBHA 2GH7A 2RD7C 2X8SA 3RDUA 3GAQA 3CWKA 3F9DA 1Y52X 1SY0A 2AF5A 3O22A 2HZQA 2NP1A 3ZWEA 3BU9A 3RDMA 1OBUA 3VG3A 2W2BA 1OBQA 2WPUA 4A1YA 2AT6X 2MO5A 3VG6A 1SLEB 2QM9A 2I5VO 2UYWA 5HA0A 5IRUA 3P6EA 4U8UM 3MM0A 3WZOA 1YWDA 3HWFA 4XMCA 4XMEA 5HCDC 1CBRA 1ZNDA 2JW1A 1SRJA 1QFVA 1VWHB 3KFIA 4I6SA 1Y55X 3RY2A 3VHMA 4FQBB 2KD2A 4AZPA 1EPAA 3X00A 2IZJA 4EKVA 2JN3A 2WQAE 2X32A 2W2FA 2X4MA 3D95A 2OY7A 1B8EA 1SRHA 1BSOA 1MX7A 1W6FA 2RTRB 3WYQA 4YVBA 5LJKA 3TGCA 3RBYA 4CV7A 4U8UN 1LCWA 4NYQA 4CPEA 1DZKA 1LICA 1PBOA 1IKJA 2ANSA 3NADA 4HWMA 2RTFB 4U46A 1E5PA 2FTBA 1DZMA 1VWDB 3MG5A 1FENA 1VWGB 4CDDA 3MBTA 3SLOA 1VYFA 4IAXA 4ARHA 4ORSA 1DV9A 3LV4A 1LUQA 3FELA 2Y3EA 1JJUA 3UEWA 1JJJA 2FR3A 2RTHB 4FGIB 4BX6A 4LZUA 1LCZA 3ZI8A 1BBPA 1GT4A 2IZAA 1LF7A 3CBSA 4ML7B 1OPBA 1SREA 3FEPA 2MJIA 1VYOA 3BX8A 2RCTA 1Y9LA 1UYOX 2IZGB 4YFRA 3FR5A 1ZNHA 3B2JA 5L8IA 1OEJA 3AEHA 2IZHB 1GX8A 3TZSA 4XMFA 4IB6A 1GT5A 3F8AA 2MHDA 2DM5A 2OY8A 3O19A 4GJSA 3TF6A 2YMSA 1IKEA 3SLJA 2G78A 2RTJA 1HXZA 2O62A 2G5LA 1VPRA 4KH8A 5D8JA 1U0XA 4MVEA 2G7BA 1VWIB 1SY1A 4IB9A 1MDCA 5B5GA 3ELXA 3UEXA 4AZRA 2WQ9A 4ORWA 3APVA 1RAVA 1SA8A 3LTWA 1HMTA 3STKA 4BOEA 2OF8A 1SWSA 1VWMB 3OD9A 4PSQA 3T6FA 4OMWA 4JGLA 4OKAA 3HTYA 2W2AA 3NQ9A 2RTBB 2FKGA 3P6GA 2PY1A 2QMIA 5HAEA 1K24A 1N9YA 3IA8A 4OS8A 4WHIA 4RUNA 3SAOA 2AMMX 1MVGA 4O3WA 1BSYA 2HYSA 2GTFX 1B4MA 3HPEA 4GJVA 4O9SA 1I9HA 2POAA 2RTGB 5FQ7E 2VDFA 5HTEA 3EW1A 1ZNLA 5AEOA 1HXLA 2KTDA 4QGXA 3VHIA 4ES7A 4Y0SA 1MK5A 3RDQA 2FS6A 2WUTA 3T2WA 2N93A 5LJBA 3RY1A 1ALBA 1CBIA 3D4RA 3KFHA 4MVLA 2FRSA 2RTNB 1KT4A 1SRFA 1EPBA 4FBRA 1VWJB 4CDEA 1NDJA 5BVSA 4JNJA 1G85A 4QZUA 1U18A 2JU3A 4CK4A 1GGLA 1LNMA 2ACPX 1MUPA 2FWVA 2WEXA 2CBSA 2WSJA 3CKGA 4WFUA 5HBSA 5BVTA 2OL7A 2OVEA 3D96A 4ZHFA 3FW5A 1OEKA 4XMGA 1B0OA 2CM9A 3PDFA 1GM6A 3SLTA 4Z6JA 4BX6B 3OJYC 3U03A 2ZSCA 1A57A 3PK2A 4YMYA 2OL8O 4I3BA 2Z4IA 4U9CA 1W4TA 1KZWA 1RXJA 1S7DA 4IAWA 1SWFA 3JSQA 4UU3A 1TVQA 3NX2A 3JS1A 3WJBA 1KL3A 4GKCA 5AJCA 1GT1A 4YFPA 1DFVA 1E06A 3TGBA 5H8TA 3NQKA 1YP6A 1YWBA 4IMOA 1EUOA 3T6LA 1SXXA 1GX9A 4QGWA 1EI5A 3GE2A 5L3YA 4I9SA 1VWQB 2FT9A 5B27A 1GXAA 4KC7A 2CAMA 1DZPA 1DZJA 2I5ZO 2RTAA 1QY0A 2FS7A 2GJ5A 3HOEA 1YIVA 3BSZE 3QKGA 4NNTA 3I0AA 1RXHA 1MOYA 2OVAA 3APWA 4AW8A 4COTA 4EQAC 2GTLO 4MEEA 1HQPA 4BX7A 4LKTA 1KXOA 1ZNEA 3FA8A 4KT5A 1SLDB 2ZAIA 2RTEB 1AVDA 3F6ZB 1RBPA 4M6SA 5LKFA 2L68A 1EIIA 2IZIA 5C0NA 2ALLX 1YP7A 1X71A 5AQ6A 4QNIA 5B2AO 3CQRA 3WJDA 2L5PA 1X8UA 4GDZA 4HFOA 4ORXA 1XCAA 4YFQA 2OFMX 2FLJA 5D47A 1UREA 5F2BA 2OY5O 4NYRA 2Q4NA 4MISA 1N0SA 2AT5X 1EIOA 4RUUA 5HZ9A 1KGLA 2X45A 1CJ5A 4Z27A 1IW2A 1VWCB 4NLJA 4Z2PA 2BT9A 1VWRB 1SRIA 1R0UA 1NBXA 3D97A 4KIIA 3PQUA 4K19A 4MVIA 4PJ2A 1FEMA 1KL4A 2XKLA 2AT3X 5L8NA 5EDCA 5LJCA 2OFAA 3CMPA 1HQQA 1JJXA 3C76X 1LDQA 2X8TA 4O4XA 4WFVA 1ZNGA 1KQXA 1DC9A 1T68X 4LKPA 2IZDB 1LPJA 2GC9A 3WJGA 4YCEA 5LKEA 1JYDA 1Y9TA 5EPQA 1X8OA 3PECA 4ALBA 1VWPB 1MEPA 5HZ5A 1LKEA 4QZTA 1NP4A 1BRQA 4ZR2A 1SWPA 4GD9A 4NP1A 3S60A 1SXUA 2OYBO 1KT6A 1BSQA 3VE1A 4BJ8A 4HPBA 5LJGA 3MVFA 4Z2VA 1UYNX 1LFOA 1KL5A 2Y3FA 3STNA 1SWDA 2ZAGA 3BU1A 4IB8A 1GKAB 4EFGA 3EBKA 4TQ2A 1HMSA 4OS0A 4BX7B 3C77X 4ZJ0A 4QRLA 3SZIA 3FDCA 4M7MA 5FFHA 5K06A 2F01A 2K23A 1HY2A 2QO4A 5EEDA 3HWDA 3KZAA 1MX8A 2NNQA 5K67A 2EU7X 2OFBA 2R73A 3K3LA 4Y0QA 3FA7A 5F1EA 3ZW1A 1SXWA 2IZLB 3OE3A 3CR6A 1G5WA 3SZHA 1L6MA 4I95A 4ZGFA 2LA7A 5LJEA 3P6DA 1LDOA 1NQNA 3BY0A 4BBOA 2PI3O 1SWLA 2AL0X 2HZRA 2X55A 2FHLA 4O4OA 5HCEC 4BX5A 4ZHHA 5LJHA 2RTKA 1SY3A 5D48A 5CHKA 5F6ZA 4AZOA 2BS5A 1FTPA 1QG5A 2P8GA 4ODDA 5BYPA 2X56A 3FA9A 1JV4A 1X8QA 3NX1A 4L3RA 4YDAA 5HZ6A 5IO6A 3FEKA 3EMMA 3RDOA 3Q6LA 5JR8A 1VYGA 2FGSA 4AZNA 4NNSA 5D4AA 1RSUB 4O4UA 1JYJA 1BRPA 2F73A 4O3YA 4CPFA 5LJDA 1SWHA 1HBPA 2RA6A 1ZNKA 1N7YA 4U8UO 3DSZA 4ALOA 3CQNA 4Z28A 1ACDA 3WZPA 4YBPA 3WYPA 4FBVA 3WJEA 1H91A 2RN4A 2E4JA 3CKFA 5F7GA 3VU1A 1QY2A 2RTIB 1KT5A 2VFBA 4MIRA 4Y5DA 5H9NA 1VWAB 1PMPA 5IRAA 4AZMA 4DQ3A 4MVKA 5JD2A 2IZBA 4OMXA 4TNNA 1SY2A 1K3BA 1HMRA 2KTSA 4ZH9A 2X34A 4TKJA 4U3QA 1I06A 3U0DA 1BLRA 4OEMA 1U17A 3HWGA 1EW3A 2A2UA 3RDSA 4ZHCA 2JU8A 5FAZA 3ZW0A 2WEWA 4LZVA 2OVSA 3Q34A 1Y0GA 3KFGA 2LBVA 3RWXA 4TLJA 5IXGA 3FIQA 3FW4A 4O49A 1FELA 3RZYA 1E2TA 1VWEB 5H9LA 2QO5A 3PP6A 4IRWA 1CBQA 2FR2A 2CZUA 4ZCBA 2IZKA 3FR2A 4YH0A 3EBWA 2C4IA 4IABA 1A18A 2IFBA 2Q2PA 4IBAA 4QYNA 4BGFA 3ZW1B 1G74A 4ON1A 2JU7A 1SWRA 1HBQA 1SWUA 2RCQA 4GNYA 4DNEA 3NR3A 3FR4A 1MM9A 4IMNA 4WBKA 4ZGUA 4EDEA 1JMXA 2HLVA 2M4LA 4BX5B 1SLFB 1GT3A 2BSZA 1O8VA 2LBAA 2OVDA 1DF8A 2RTCB 4GGZA 2A0AA 5B11O 1EALA 3AUMO 2AT0X 1LCVA 1LIFA 1WUBA 4Y0RA 4UU2A 4B55A 1BM5A 4O4SA 3RE5A 3H3IA 5FENA 5FQ6E 1SMPI 3P02A 2IZFB 2A2GA 3ZUIA 4D6BA 2MM3A 1KT3A 1SWBA 3BRNA 4GGTA 5IO7A 4BCSA 4I3DA 4A60A 1W5RA 2A13A 1RSTB 3KQ0A 3WXQA 1EXSA 4GDAA 3FLLA 1AB0A 2OL6O 5BVQA 1VWBB 2Q39A 4CPHA 4GK9A 4R0BA 4GH7A 3ZUOA 1VWLB 2A5BA 4QQ1A 4HPAA 1I05A 2AVIA 5EDBA 4DQ4A 4TJZA 1OSPO 5DG4A 3PPTA 4A1HA 3PQSA 3P6FA 1X89A 2NNEA 4ORRA 1I04A 1QWDA 2OFRX 3NQ3A 2YG2A 1N43A 1BWYA 1QY1A 1IJ8A 4A8ZA 2X8FA 3NPOA
chains in the Genus database with same CATH topology
1O1VA 3E3CA 4ZH6A 5H9KA 3B2HA 2Z4HA 1A2DA 4YCHA 1KOIA 3NBXX 3V8UA 3BS2A 3ZW0B 1YUPA 2BS6A 4HPDA 3DTQA 4ORUA 4EXZA 3WBGA 4CSBA 5H9AA 4ORYA 2R74A 1X8NA 2Q2MA 4GZVA 4N7CA 4N7DA 1IFBA 1ICMA 4YGZA 3VG4A 1BJ7A 4NW4A 4QYPA 1Z24A 1CRBA 1OPAA 4BQUA 1KQWA 2LFOA 3JQOA 1AELA 4ZHDA 3NP1A 3G7XA 1NGLA 4GE1A 5EZ2A 3ZW2A 1ERXA 4IB7A 4KC8A 1RLBE 1AQBA 3UAQA 3UEVA 4ZFXA 2AH7X 3C78X 1S44A 2GTLM 3APUA 4GRJA 1SXYA 4YGHA 5L8OA 1TW4A 4TKBA 3EM0A 3WVMA 2KW1A 4I9RA 3PH6A 3S5XA 3VG2A 2L67A 3APXA 1O1UA 1ZRYA 1S2PA 2MWHA 3VE2A 2HMBA 1JZUA 1CBSA 4HPCA 3CBCA 1X8PA 1PM1X 2WR6A 2BLGA 4ZHGA 1YWCA 1ICNA 1QFTA 3P6CA 1LIEA 3U9PC 2GTLN 4Y0PA 2BHVA 2CZTA 1LIDA 3KFFA 3VG7A 1QQSA 4YKMA 4BVMA 4QGVA 4I3CA 5HZ8A 1KZXA 3P6HA 1KT7A 1YWAA 3B2IA 3HWEA 5F6BA 2R56A 1A3YA 1TXLA 3IFBA 1UZ2X 1HN2A 1TOUA 1IIUA 2WWPA 3T1DA 3TGAA 3HOLA 5HZQA 4XMDA 2XSTA 3VG5A 1OEEA 4YGGA 1XKIA 1IFCA 1PEEA 1DF3A 2LB6A 1EQDA 2RQ0A 3N91A 5HTDA 3BLGA 1AVGI 1ERBA 5FQ8E 2NNDA 4XMHA 4FBOA 4O3ZA 1B56A 1BEBA 4LQZA 2HNXA 4TKHA 1I4UA 2KT4B 3P24A 4GETA 1T8VA 5DPQA 4GU8A 5HA1A 3ZQ3A 1FE3A 4YBUA 2K62A 4KCAA 3B2KA 5KIDA 1OBPA 1E02A 2QO6A 3OBLA 4NLIA 4QAEA 4GNWA 5KICA 3VPJE 5AJBA 2CBRA 3PH5A 1LIBA 3S26A 3B2LA 5CYBA 2JOZA 5HWZA 1TOWA 3I17A 3S5VA 4AZQA 4L1NA 3O2YA 4YDBA 4O3XB 1E00A 5EEEA 3ZZVA 1QABE 2X46A 2Q9SA 5IO5A 2CM4A 3HK1A 3FYFA 2OZQA 2AKQA 2F09A 3AKNA 3ELZA 3WJFA 3PEDA 4AYHA 3LHNA 4D6AA 4INNA 1ADLA 2LKKA 2JMBA 1ML7A 2L9CA 3SOTA 1FDQA 1G7NA 1P6PA 3RKGA 3BDRA 3UEUA 1T0VA 3AKMA 4YKOA 3BX7A 3L4RA 3STMX 5KHPA 2QOSC 4ID2A 1NP1A 2ACOA 1JIWI 3WOVA 3EYCA 1D2UA 3FMZA 3MX7A 4OS3A 5D45A 2AT8X 5F58A 2A3FX 4EEJA 1GKAA 5B29A 3FENA 3RSWA 2G79A 2ASNX 1D3SA 3FA6A 5CE4A 5HCCC 1JBHA 3WJCA 2RD7C 2X8SA 3GAQA 3CWKA 3F9DA 1SY0A 3O22A 2HZQA 2NP1A 3ZWEA 3BU9A 3VG3A 1OBUA 2W2BA 1OBQA 4A1YA 2AT6X 2MO5A 3VG6A 2QM9A 5HA0A 3P6EA 4U8UM 1YWDA 3HWFA 4XMCA 4XMEA 5HCDC 1CBRA 1ZNDA 2JW1A 1QFVA 3KFIA 4I6SA 4FQBB 2KD2A 4AZPA 1EPAA 2JN3A 2WQAE 3D95A 2W2FA 1B8EA 1BSOA 1MX7A 5LJKA 3TGCA 3RBYA 4CV7A 4U8UN 4NYQA 1DZKA 1LICA 1PBOA 1IKJA 2ANSA 3NADA 4HWMA 1E5PA 2FTBA 1DZMA 1FENA 3MBTA 1VYFA 4IAXA 4ARHA 4ORSA 1DV9A 3LV4A 3FELA 3UEWA 1JJJA 2FR3A 4FGIB 4LZUA 3ZI8A 1BBPA 1GT4A 1LF7A 3CBSA 4ML7B 1OPBA 3FEPA 2MJIA 3BX8A 2RCTA 1Y9LA 4YFRA 3FR5A 1ZNHA 3B2JA 5L8IA 1OEJA 1GX8A 3TZSA 4XMFA 4IB6A 1GT5A 3F8AA 2MHDA 2DM5A 3O19A 3TF6A 2YMSA 1IKEA 2G78A 2O62A 5D8JA 1VPRA 4KH8A 1U0XA 4MVEA 2G7BA 4AZRA 1SY1A 4IB9A 1MDCA 3UEXA 3ELXA 2WQ9A 4ORWA 3APVA 1SA8A 1HMTA 3STKA 4BOEA 4PSQA 3OD9A 4OMWA 4JGLA 3HTYA 2W2AA 3NQ9A 3P6GA 2PY1A 2QMIA 5HAEA 3IA8A 4OS8A 4WHIA 4RUNA 3SAOA 2AMMX 1MVGA 4O3WA 1BSYA 2HYSA 2GTFX 1B4MA 4O9SA 2POAA 5FQ7E 5HTEA 1ZNLA 5AEOA 2KTDA 4QGXA 4ES7A 4Y0SA 2FS6A 2WUTA 2N93A 5LJBA 1ALBA 1CBIA 3D4RA 3KFHA 4MVLA 2FRSA 1KT4A 1EPBA 4FBRA 5BVSA 1G85A 4QZUA 1U18A 2JU3A 4CK4A 1GGLA 1LNMA 2ACPX 1MUPA 2FWVA 2WEXA 2CBSA 2WSJA 4WFUA 5HBSA 5BVTA 3D96A 2OVEA 4ZHFA 3FW5A 1OEKA 4XMGA 1B0OA 2CM9A 1GM6A 3OJYC 3U03A 1A57A 4YMYA 4I3BA 2Z4IA 4U9CA 1KZWA 1S7DA 4IAWA 4UU3A 3JSQA 1TVQA 3NX2A 3JS1A 3WJBA 4GKCA 5AJCA 1GT1A 4YFPA 1DFVA 1E06A 3TGBA 5H8TA 3NQKA 1YP6A 1YWBA 4IMOA 1EUOA 1SXXA 1GX9A 4QGWA 1EI5A 3GE2A 4I9SA 2FT9A 5B27A 1GXAA 4KC7A 1DZPA 1DZJA 1QY0A 2FS7A 2GJ5A 3HOEA 1YIVA 3BSZE 3QKGA 4NNTA 3I0AA 2OVAA 4AZOA 4AW8A 3APWA 4EQAC 4COTA 2GTLO 1HQPA 4LKTA 1KXOA 1ZNEA 3FA8A 4KT5A 2ZAIA 3F6ZB 1RBPA 4M6SA 5LKFA 2L68A 1EIIA 5C0NA 2ALLX 1YP7A 1X71A 5AQ6A 4QNIA 3WJDA 3CQRA 2L5PA 1X8UA 4GDZA 4HFOA 4ORXA 1XCAA 4YFQA 2OFMX 2FLJA 5D47A 1UREA 4NYRA 2Q4NA 4MISA 1N0SA 2AT5X 1EIOA 4RUUA 5HZ9A 1KGLA 2X45A 1CJ5A 1IW2A 4NLJA 2BT9A 1R0UA 3D97A 4KIIA 3PQUA 4K19A 4MVIA 4PJ2A 1FEMA 2XKLA 2AT3X 5L8NA 5EDCA 5LJCA 3CMPA 1JJXA 3C76X 4O4XA 2X8TA 4WFVA 1ZNGA 1KQXA 1DC9A 1T68X 4LKPA 1LPJA 2GC9A 3WJGA 4YCEA 5LKEA 1JYDA 1Y9TA 5EPQA 1X8OA 3PECA 4ALBA 5HZ5A 1LKEA 4QZTA 1NP4A 1BRQA 4ZR2A 4NP1A 3S60A 1SXUA 1KT6A 1BSQA 3VE1A 4HPBA 5LJGA 3MVFA 1LFOA 3STNA 2ZAGA 3BU1A 4IB8A 1GKAB 4EFGA 3EBKA 4TQ2A 1HMSA 4OS0A 3C77X 4ZJ0A 4QRLA 4M7MA 5FFHA 5K06A 2K23A 2QO4A 5EEDA 3HWDA 3KZAA 1MX8A 2NNQA 2EU7X 4Y0QA 2R73A 3K3LA 3FA7A 5F1EA 3ZW1A 1SXWA 3OE3A 3CR6A 1G5WA 1L6MA 4I95A 4ZGFA 2LA7A 5LJEA 3P6DA 3BY0A 2AL0X 2HZRA 4ZHHA 4O4OA 5HCEC 5LJHA 5F6ZA 1SY3A 5D48A 2BS5A 1FTPA 1QG5A 2P8GA 4ODDA 5BYPA 3FA9A 1JV4A 1X8QA 3NX1A 4L3RA 4YDAA 5HZ6A 5IO6A 3FEKA 3EMMA 3Q6LA 5JR8A 1VYGA 4AZNA 4NNSA 5D4AA 4O4UA 1JYJA 1BRPA 2F73A 4O3YA 5LJDA 1HBPA 2RA6A 1ZNKA 4U8UO 3DSZA 4ALOA 3CQNA 1ACDA 4YBPA 4FBVA 3WJEA 1H91A 2RN4A 2E4JA 5F7GA 3VU1A 1QY2A 4AZMA 1KT5A 4MIRA 5H9NA 4DQ3A 1PMPA 4MVKA 4OMXA 4TNNA 1SY2A 1HMRA 2KTSA 4ZH9A 4TKJA 4U3QA 1I06A 3U0DA 1BLRA 1U17A 3HWGA 1EW3A 2A2UA 4ZHCA 2JU8A 5FAZA 3ZW0A 2WEWA 4LZVA 2OVSA 2LBVA 3KFGA 3RWXA 4TLJA 3FIQA 3FW4A 4O49A 1FELA 3RZYA 5H9LA 2QO5A 3PP6A 1CBQA 2FR2A 2CZUA 4ZCBA 3FR2A 4YH0A 3EBWA 4IABA 4QYNA 1A18A 2IFBA 2Q2PA 4IBAA 3ZW1B 1G74A 4ON1A 2JU7A 1HBQA 2RCQA 4GNYA 3NR3A 3FR4A 4IMNA 4WBKA 4ZGUA 4EDEA 2M4LA 2HLVA 1GT3A 1O8VA 2LBAA 2OVDA 1EALA 2A0AA 2AT0X 1LIFA 4Y0RA 4UU2A 1BM5A 4O4SA 3H3IA 5FENA 5FQ6E 1SMPI 3P02A 2A2GA 3ZUIA 4D6BA 2MM3A 1KT3A 3BRNA 5IO7A 4I3DA 4A60A 2A13A 3KQ0A 3WXQA 1EXSA 3FLLA 1AB0A 5BVQA 2Q39A 4GK9A 4R0BA 4GH7A 3ZUOA 4QQ1A 4HPAA 1I05A 4DQ4A 5EDBA 4TJZA 5DG4A 3PPTA 4A1HA 3PQSA 3P6FA 1X89A 2NNEA 4ORRA 1I04A 1QWDA 2OFRX 3NQ3A 2YG2A 1BWYA 1QY1A 4A8ZA 2X8FA 3NPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1V A;  4ZH6 A;  5H9K A;  3B2H A;  1A2D A;  4YCH A;  1KOI A;  3BS2 A;  1YUP A;  4HPD A;  3DTQ A;  4ORU A;  4EXZ A;  3WBG A;  5H9A A;  4ORY A;  2R74 A;  1X8N A;  2Q2M A;  4N7C A;  4N7D A;  1IFB A;  1ICM A;  4YGZ A;  3VG4 A;  1BJ7 A;  4QYP A;  1Z24 A;  1CRB A;  1OPA A;  4BQU A;  1KQW A;  2LFO A;  1AEL A;  4ZHD A;  3NP1 A;  3G7X A;  1NGL A;  4GE1 A;  5EZ2 A;  1ERX A;  4IB7 A;  1RLB E;  1AQB A;  4ZFX A;  3UEV A;  2AH7 X;  3C78 X;  1S44 A;  3APU A;  4GRJ A;  1SXY A;  4YGH A;  5L8O A;  1TW4 A;  4TKB A;  3EM0 A;  3WVM A;  4I9R A;  3PH6 A;  3VG2 A;  2L67 A;  3APX A;  1O1U A;  1ZRY A;  1S2P A;  2HMB A;  1JZU A;  1CBS A;  4HPC A;  3CBC A;  1X8P A;  1PM1 X;  2WR6 A;  2BLG A;  4ZHG A;  1YWC A;  1ICN A;  1QFT A;  3P6C A;  1LIE A;  3U9P C;  4Y0P A;  2CZT A;  1LID A;  3KFF A;  3VG7 A;  1QQS A;  4YKM A;  4BVM A;  4QGV A;  4I3C A;  5HZ8 A;  1KZX A;  3P6H A;  1KT7 A;  1YWA A;  3B2I A;  3HWE A;  5F6B A;  2R56 A;  1A3Y A;  1TXL A;  3IFB A;  1UZ2 X;  1HN2 A;  1TOU A;  1IIU A;  2WWP A;  3T1D A;  3TGA A;  5HZQ A;  4XMD A;  2XST A;  3VG5 A;  1OEE A;  4YGG A;  1XKI A;  1IFC A;  1PEE A;  1DF3 A;  2LB6 A;  1EQD A;  2RQ0 A;  5HTD A;  3BLG A;  1AVG I;  1ERB A;  2NND A;  4XMH A;  1B56 A;  1BEB A;  2HNX A;  4TKH A;  1I4U A;  2KT4 B;  4GET A;  1T8V A;  5DPQ A;  5HA1 A;  3ZQ3 A;  1FE3 A;  4YBU A;  2K62 A;  3B2K A;  5KID A;  1OBP A;  1E02 A;  2QO6 A;  4NLI A;  4QAE A;  4GNW A;  5KIC A;  2CBR A;  3PH5 A;  1LIB A;  3S26 A;  3B2L A;  5HWZ A;  2JOZ A;  1TOW A;  3I17 A;  4AZQ A;  3O2Y A;  4YDB A;  5EEE A;  1E00 A;  1QAB E;  2X46 A;  2Q9S A;  5IO5 A;  2CM4 A;  3HK1 A;  2OZQ A;  2AKQ A;  3AKN A;  3ELZ A;  3WJF A;  3PED A;  4AYH A;  4D6A A;  1ADL A;  2LKK A;  1ML7 A;  2L9C A;  1FDQ A;  1G7N A;  1P6P A;  3UEU A;  3BDR A;  1T0V A;  3AKM A;  4YKO A;  3BX7 A;  3L4R A;  3STM X;  5KHP A;  2QOS C;  1NP1 A;  2ACO A;  3EYC A;  1D2U A;  3FMZ A;  4OS3 A;  5D45 A;  5F58 A;  2AT8 X;  2A3F X;  4EEJ A;  1GKA A;  5B29 A;  3FEN A;  3RSW A;  2G79 A;  2ASN X;  1D3S A;  3FA6 A;  5CE4 A;  5HCC C;  1JBH A;  3WJC A;  2RD7 C;  3GAQ A;  3CWK A;  3F9D A;  1SY0 A;  3O22 A;  2HZQ A;  2NP1 A;  3BU9 A;  3VG3 A;  1OBU A;  2W2B A;  1OBQ A;  4A1Y A;  2AT6 X;  2MO5 A;  3VG6 A;  2QM9 A;  5HA0 A;  3P6E A;  1YWD A;  3HWF A;  4XMC A;  4XME A;  5HCD C;  1CBR A;  1ZND A;  1QFV A;  3KFI A;  4AZP A;  1EPA A;  2JN3 A;  2WQA E;  3D95 A;  2W2F A;  1B8E A;  1BSO A;  1MX7 A;  5LJK A;  3TGC A;  4NYQ A;  1DZK A;  1LIC A;  1PBO A;  1IKJ A;  2ANS A;  3NAD A;  1E5P A;  2FTB A;  1DZM A;  1FEN A;  3MBT A;  1VYF A;  4IAX A;  4ARH A;  4ORS A;  1DV9 A;  3FEL A;  3UEW A;  1JJJ A;  2FR3 A;  4LZU A;  1BBP A;  1GT4 A;  1LF7 A;  3CBS A;  1OPB A;  3FEP A;  2MJI A;  3BX8 A;  2RCT A;  4YFR A;  3FR5 A;  1ZNH A;  3B2J A;  5L8I A;  1OEJ A;  1GX8 A;  3TZS A;  4XMF A;  4IB6 A;  1GT5 A;  3F8A A;  2DM5 A;  3O19 A;  3TF6 A;  1IKE A;  2G78 A;  2O62 A;  5D8J A;  1VPR A;  1U0X A;  2G7B A;  4AZR A;  1SY1 A;  4IB9 A;  1MDC A;  3UEX A;  3ELX A;  2WQ9 A;  4ORW A;  3APV A;  1SA8 A;  1HMT A;  3STK A;  4BOE A;  4PSQ A;  4OMW A;  2W2A A;  3NQ9 A;  3P6G A;  2PY1 A;  5HAE A;  3IA8 A;  4OS8 A;  4RUN A;  3SAO A;  2AMM X;  1MVG A;  1BSY A;  2HYS A;  2GTF X;  1B4M A;  4O9S A;  2POA A;  5HTE A;  1ZNL A;  2KTD A;  4QGX A;  4ES7 A;  4Y0S A;  2FS6 A;  2WUT A;  2N93 A;  5LJB A;  1ALB A;  1CBI A;  3KFH A;  4MVL A;  2FRS A;  1KT4 A;  1EPB A;  5BVS A;  1G85 A;  4QZU A;  1U18 A;  2JU3 A;  4CK4 A;  1GGL A;  1LNM A;  2ACP X;  1MUP A;  2FWV A;  2WEX A;  2CBS A;  2WSJ A;  4WFU A;  5HBS A;  5BVT A;  3D96 A;  2OVE A;  4ZHF A;  3FW5 A;  1OEK A;  4XMG A;  1B0O A;  2CM9 A;  1GM6 A;  3OJY C;  3U03 A;  1A57 A;  4YMY A;  4I3B A;  1KZW A;  1S7D A;  4IAW A;  4UU3 A;  3JSQ A;  1TVQ A;  3NX2 A;  3JS1 A;  3WJB A;  4GKC A;  1GT1 A;  4YFP A;  1DFV A;  1E06 A;  3TGB A;  5H8T A;  1YP6 A;  1YWB A;  4IMO A;  1EUO A;  1SXX A;  1GX9 A;  4QGW A;  4I9S A;  2FT9 A;  5B27 A;  1GXA A;  1DZP A;  1DZJ A;  1QY0 A;  2FS7 A;  2GJ5 A;  3QKG A;  1YIV A;  3BSZ E;  4AZO A;  4NNT A;  3I0A A;  2OVA A;  4AW8 A;  3APW A;  1HQP A;  4LKT A;  1KXO A;  1ZNE A;  3FA8 A;  1RBP A;  4M6S A;  5LKF A;  2L68 A;  1EII A;  5C0N A;  2ALL X;  1YP7 A;  1X71 A;  5AQ6 A;  3WJD A;  3CQR A;  2L5P A;  1X8U A;  4HFO A;  4ORX A;  1XCA A;  4YFQ A;  2OFM X;  2FLJ A;  5D47 A;  1URE A;  4NYR A;  2Q4N A;  1EIO A;  1N0S A;  2AT5 X;  4RUU A;  5HZ9 A;  1KGL A;  2X45 A;  1CJ5 A;  1IW2 A;  4NLJ A;  1R0U A;  3D97 A;  4KII A;  4K19 A;  4MVI A;  1FEM A;  2XKL A;  2AT3 X;  5L8N A;  5EDC A;  5LJC A;  3CMP A;  1JJX A;  3C76 X;  4WFV A;  1ZNG A;  1KQX A;  1DC9 A;  1T68 X;  4LKP A;  1LPJ A;  2GC9 A;  3WJG A;  4YCE A;  5LKE A;  1JYD A;  5EPQ A;  4ALB A;  1X8O A;  3PEC A;  5HZ5 A;  1LKE A;  4QZT A;  1NP4 A;  1BRQ A;  4ZR2 A;  4NP1 A;  1SXU A;  1KT6 A;  1BSQ A;  4HPB A;  5LJG A;  3MVF A;  1LFO A;  3STN A;  3BU1 A;  4IB8 A;  4EFG A;  1GKA B;  3EBK A;  4TQ2 A;  1HMS A;  4OS0 A;  3C77 X;  4ZJ0 A;  4M7M A;  5FFH A;  5K06 A;  2K23 A;  2QO4 A;  5EED A;  3HWD A;  3KZA A;  1MX8 A;  2NNQ A;  2EU7 X;  4Y0Q A;  2R73 A;  3K3L A;  3FA7 A;  5F1E A;  1SXW A;  3CR6 A;  1G5W A;  1L6M A;  5LJE A;  3P6D A;  3BY0 A;  2AL0 X;  2HZR A;  4ZHH A;  5LJH A;  5HCE C;  5F6Z A;  1SY3 A;  5D48 A;  1FTP A;  1QG5 A;  2P8G A;  4ODD A;  3FA9 A;  1JV4 A;  1X8Q A;  3NX1 A;  4YDA A;  5HZ6 A;  5IO6 A;  3FEK A;  3EMM A;  3Q6L A;  5JR8 A;  1VYG A;  4AZN A;  4NNS A;  5D4A A;  1JYJ A;  1BRP A;  2F73 A;  5LJD A;  1HBP A;  2RA6 A;  1ZNK A;  3DSZ A;  4ALO A;  3CQN A;  1ACD A;  4YBP A;  3WJE A;  1H91 A;  2E4J A;  5F7G A;  1QY2 A;  4AZM A;  1KT5 A;  5H9N A;  4DQ3 A;  1PMP A;  4MVK A;  4OMX A;  4TNN A;  1SY2 A;  1HMR A;  4ZH9 A;  4TKJ A;  3U0D A;  1I06 A;  1BLR A;  1U17 A;  3HWG A;  1EW3 A;  2A2U A;  4ZHC A;  2JU8 A;  5FAZ A;  2WEW A;  4LZV A;  2LBV A;  3KFG A;  4TLJ A;  3FIQ A;  3FW4 A;  1FEL A;  3RZY A;  5H9L A;  2QO5 A;  3PP6 A;  1CBQ A;  2FR2 A;  2CZU A;  4ZCB A;  3FR2 A;  4YH0 A;  3EBW A;  4QYN A;  1A18 A;  2IFB A;  2Q2P A;  4IBA A;  1G74 A;  2JU7 A;  1HBQ A;  2RCQ A;  4GNY A;  3NR3 A;  3FR4 A;  4IMN A;  4WBK A;  4ZGU A;  4EDE A;  2HLV A;  1GT3 A;  1O8V A;  2LBA A;  2OVD A;  1EAL A;  2A0A A;  2AT0 X;  1LIF A;  4Y0R A;  4UU2 A;  1BM5 A;  5FEN A;  2A2G A;  3ZUI A;  4D6B A;  2MM3 A;  1KT3 A;  3BRN A;  5IO7 A;  4I3D A;  4A60 A;  2A13 A;  3KQ0 A;  3WXQ A;  1EXS A;  3FLL A;  1AB0 A;  5BVQ A;  2Q39 A;  4R0B A;  4GH7 A;  3ZUO A;  4HPA A;  1I05 A;  4DQ4 A;  5EDB A;  4TJZ A;  5DG4 A;  3PPT A;  4A1H A;  4ORR A;  3P6F A;  1X89 A;  2NNE A;  1I04 A;  1QWD A;  2OFR X;  3NQ3 A;  2YG2 A;  1BWY A;  1QY1 A;  4A8Z A;  3NPO A; 
#chains in the Genus database with same CATH topology
 1O1V A;  3E3C A;  4ZH6 A;  5H9K A;  3B2H A;  2RTL A;  2Z4H A;  2C1Q A;  1A2D A;  2UZ2 A;  4YCH A;  1KOI A;  3EW2 A;  3NBX X;  3V8U A;  3BS2 A;  3ZW0 B;  1YUP A;  1SWC A;  2BS6 A;  4HPD A;  3DTQ A;  4NV7 A;  4ORU A;  4EXZ A;  1SWO A;  3WBG A;  4CSB A;  4C5P A;  5H9A A;  4ORY A;  2R74 A;  1JQP A;  1X8N A;  2Q2M A;  4GGR A;  2RTM A;  4GZV A;  4N7C A;  3RE6 A;  1SWK A;  4N7D A;  1PBY A;  2G8C O;  1IFB A;  1ICM A;  2RTQ B;  5B5F A;  1STP A;  4OEL A;  4Y59 A;  4Z2O A;  4YGZ A;  3VG4 A;  3EC5 A;  1BJ7 A;  4NW4 A;  4QYP A;  1Z24 A;  1SLG B;  1CRB A;  1OPA A;  4BQU A;  1KQW A;  1VWO B;  2LFO A;  3JQO A;  2FKJ A;  4ZHD A;  3NP1 A;  1AEL A;  3G7X A;  1NGL A;  4GE1 A;  5EZ2 A;  4GUZ A;  3ZW2 A;  5B10 O;  1ERX A;  4I60 A;  4IB7 A;  4KC8 A;  1RLB E;  1VWF B;  1AQB A;  5K68 A;  3UAQ A;  3UEV A;  4ZFX A;  3D9W A;  1GX3 A;  4NV8 A;  2AH7 X;  3C78 X;  1S44 A;  2GTL M;  3APU A;  2RTO B;  2OF9 A;  1SXY A;  4GRJ A;  4YGH A;  1TW4 A;  4DCB A;  4TKB A;  5L8O A;  3EM0 A;  3WVM A;  1KFF A;  2KW1 A;  4I9R A;  3PH6 A;  3S5X A;  1NC9 A;  3SZJ A;  3VG2 A;  2L67 A;  5CSE A;  3APX A;  1WBI A;  1O1U A;  1SWG A;  1ZRY A;  2A5C A;  1S2P A;  2MWH A;  4JO6 A;  3VE2 A;  3VGW A;  1STR B;  2HMB A;  5IRW A;  1JZU A;  1SWN A;  1CBS A;  2DJG A;  2MF6 A;  4HPC A;  1N9M A;  3CBC A;  1X8P A;  1PM1 X;  4CPH B;  2WR6 A;  2BLG A;  3FID A;  4ZHG A;  1YWC A;  1AVE A;  1ICN A;  1QFT A;  3P6C A;  1LIE A;  2BC3 A;  2GTL N;  4Y0P A;  3U9P C;  2BHV A;  1VWN B;  1LID A;  2CZT A;  1LEL A;  3KFF A;  3VG7 A;  1QQS A;  4YKM A;  4BVM A;  4QGV A;  4I3C A;  1FJ1 E;  5HZ8 A;  3T2X A;  1KZX A;  3P6H A;  1SWE A;  2RTP B;  1KT7 A;  1YWA A;  3B2I A;  3HWE A;  5F6B A;  2R56 A;  1A3Y A;  1TXL A;  3IFB A;  1UZ2 X;  1HN2 A;  1TOU A;  1IIU A;  2IZC B;  2WWP A;  2QOM A;  3T1D A;  3TGA A;  3HOL A;  5HZQ A;  4XMD A;  1Y53 X;  2C1S A;  2XST A;  3VG5 A;  1OEE A;  4YGG A;  1XKI A;  1IFC A;  1PEE A;  1DF3 A;  2LB6 A;  1STS B;  3WZQ A;  1EQD A;  2RQ0 A;  3N91 A;  5HTD A;  3BLG A;  1AVG I;  1ERB A;  1N4J A;  2HKD A;  2NND A;  2RTD B;  3QQ2 A;  4XMH A;  4FBO A;  4O3Z A;  5FQ8 E;  3VHH A;  1B56 A;  1BEB A;  4LQZ A;  2HNX A;  2JGS A;  1I4U A;  2KT4 B;  3P24 A;  4GET A;  1T8V A;  4TKH A;  3WZN A;  5DPQ A;  4GU8 A;  5HA1 A;  3ZQ3 A;  1SWJ A;  1FE3 A;  4YBU A;  2K62 A;  2FHN X;  4KCA A;  3B2K A;  5KID A;  1OBP A;  1E02 A;  2QO6 A;  3OBL A;  4NLI A;  4QAE A;  4GNW A;  1SWT A;  3KVN A;  3VPJ E;  5KIC A;  5AJB A;  2CBR A;  3PH5 A;  1LIB A;  3S26 A;  1NQM A;  3B2L A;  5CYB A;  2JOZ A;  5HWZ A;  1TOW A;  3I17 A;  3S5V A;  4AZQ A;  4L1N A;  3O2Y A;  4YDB A;  4O3X B;  1E00 A;  5EEE A;  3ZZV A;  1QAB E;  2X46 A;  2Q9S A;  5IO5 A;  2DJF A;  1JMZ A;  1PTS A;  2CM4 A;  3HK1 A;  3FYF A;  2OZQ A;  2AKQ A;  2F09 A;  5B3M O;  2OY1 O;  3AKN A;  3ELZ A;  3WJF A;  3PED A;  4AYH A;  3LHN A;  4D6A A;  4INN A;  1ADL A;  2LKK A;  1ML7 A;  2JMB A;  2L9C A;  1I78 A;  3SOT A;  1FDQ A;  1G7N A;  2A8G A;  1P6P A;  1SWA A;  3RKG A;  3BDR A;  3UEU A;  1T0V A;  2QCB A;  3AKM A;  4YKO A;  4CPI A;  3BX7 A;  3L4R A;  4CDF A;  3STM X;  1RXK A;  5KHP A;  2QOS C;  4ID2 A;  1NP1 A;  1VWK B;  1JIW I;  2ACO A;  3WOV A;  1SRG A;  3EYC A;  1D2U A;  2Y32 A;  3FMZ A;  3MX7 A;  4OS3 A;  2AT8 X;  5D45 A;  2A3F X;  5F58 A;  1GKA A;  4EEJ A;  5B29 A;  3FEN A;  1SWQ A;  2G79 A;  2ASN X;  2IZE B;  3RDX A;  2VFC A;  1D3S A;  3FA6 A;  3RSW A;  4CDC A;  5CE4 A;  4JHQ A;  5HCC C;  3WJC A;  1JBH A;  2GH7 A;  2RD7 C;  2X8S A;  3RDU A;  3GAQ A;  3CWK A;  3F9D A;  1Y52 X;  1SY0 A;  2AF5 A;  3O22 A;  2HZQ A;  2NP1 A;  3ZWE A;  3BU9 A;  3RDM A;  1OBU A;  3VG3 A;  2W2B A;  1OBQ A;  2WPU A;  4A1Y A;  2AT6 X;  2MO5 A;  3VG6 A;  1SLE B;  2QM9 A;  2I5V O;  2UYW A;  5HA0 A;  5IRU A;  3P6E A;  4U8U M;  3MM0 A;  3WZO A;  1YWD A;  3HWF A;  4XMC A;  4XME A;  5HCD C;  1CBR A;  1ZND A;  2JW1 A;  1SRJ A;  1QFV A;  1VWH B;  3KFI A;  4I6S A;  1Y55 X;  3RY2 A;  3VHM A;  4FQB B;  2KD2 A;  4AZP A;  1EPA A;  3X00 A;  2IZJ A;  4EKV A;  2JN3 A;  2WQA E;  2X32 A;  2W2F A;  2X4M A;  3D95 A;  2OY7 A;  1B8E A;  1SRH A;  1BSO A;  1MX7 A;  1W6F A;  2RTR B;  3WYQ A;  4YVB A;  5LJK A;  3TGC A;  3RBY A;  4CV7 A;  4U8U N;  1LCW A;  4NYQ A;  4CPE A;  1DZK A;  1LIC A;  1PBO A;  1IKJ A;  2ANS A;  3NAD A;  4HWM A;  2RTF B;  4U46 A;  1E5P A;  2FTB A;  1DZM A;  1VWD B;  3MG5 A;  1FEN A;  1VWG B;  4CDD A;  3MBT A;  3SLO A;  1VYF A;  4IAX A;  4ARH A;  4ORS A;  1DV9 A;  3LV4 A;  1LUQ A;  3FEL A;  2Y3E A;  1JJU A;  3UEW A;  1JJJ A;  2FR3 A;  2RTH B;  4FGI B;  4BX6 A;  4LZU A;  1LCZ A;  3ZI8 A;  1BBP A;  1GT4 A;  2IZA A;  1LF7 A;  3CBS A;  4ML7 B;  1OPB A;  1SRE A;  3FEP A;  2MJI A;  1VYO A;  3BX8 A;  2RCT A;  1Y9L A;  1UYO X;  2IZG B;  4YFR A;  3FR5 A;  1ZNH A;  3B2J A;  5L8I A;  1OEJ A;  3AEH A;  2IZH B;  1GX8 A;  3TZS A;  4XMF A;  4IB6 A;  1GT5 A;  3F8A A;  2MHD A;  2DM5 A;  2OY8 A;  3O19 A;  4GJS A;  3TF6 A;  2YMS A;  1IKE A;  3SLJ A;  2G78 A;  2RTJ A;  1HXZ A;  2O62 A;  2G5L A;  1VPR A;  4KH8 A;  5D8J A;  1U0X A;  4MVE A;  2G7B A;  1VWI B;  1SY1 A;  4IB9 A;  1MDC A;  5B5G A;  3ELX A;  3UEX A;  4AZR A;  2WQ9 A;  4ORW A;  3APV A;  1RAV A;  1SA8 A;  3LTW A;  1HMT A;  3STK A;  4BOE A;  2OF8 A;  1SWS A;  1VWM B;  3OD9 A;  4PSQ A;  3T6F A;  4OMW A;  4JGL A;  4OKA A;  3HTY A;  2W2A A;  3NQ9 A;  2RTB B;  2FKG A;  3P6G A;  2PY1 A;  2QMI A;  5HAE A;  1K24 A;  1N9Y A;  3IA8 A;  4OS8 A;  4WHI A;  4RUN A;  3SAO A;  2AMM X;  1MVG A;  4O3W A;  1BSY A;  2HYS A;  2GTF X;  1B4M A;  3HPE A;  4GJV A;  4O9S A;  1I9H A;  2POA A;  2RTG B;  5FQ7 E;  2VDF A;  5HTE A;  3EW1 A;  1ZNL A;  5AEO A;  1HXL A;  2KTD A;  4QGX A;  3VHI A;  4ES7 A;  4Y0S A;  1MK5 A;  3RDQ A;  2FS6 A;  2WUT A;  3T2W A;  2N93 A;  5LJB A;  3RY1 A;  1ALB A;  1CBI A;  3D4R A;  3KFH A;  4MVL A;  2FRS A;  2RTN B;  1KT4 A;  1SRF A;  1EPB A;  4FBR A;  1VWJ B;  4CDE A;  1NDJ A;  5BVS A;  4JNJ A;  1G85 A;  4QZU A;  1U18 A;  2JU3 A;  4CK4 A;  1GGL A;  1LNM A;  2ACP X;  1MUP A;  2FWV A;  2WEX A;  2CBS A;  2WSJ A;  3CKG A;  4WFU A;  5HBS A;  5BVT A;  2OL7 A;  2OVE A;  3D96 A;  4ZHF A;  3FW5 A;  1OEK A;  4XMG A;  1B0O A;  2CM9 A;  3PDF A;  1GM6 A;  3SLT A;  4Z6J A;  4BX6 B;  3OJY C;  3U03 A;  2ZSC A;  1A57 A;  3PK2 A;  4YMY A;  2OL8 O;  4I3B A;  2Z4I A;  4U9C A;  1W4T A;  1KZW A;  1RXJ A;  1S7D A;  4IAW A;  1SWF A;  3JSQ A;  4UU3 A;  1TVQ A;  3NX2 A;  3JS1 A;  3WJB A;  1KL3 A;  4GKC A;  5AJC A;  1GT1 A;  4YFP A;  1DFV A;  1E06 A;  3TGB A;  5H8T A;  3NQK A;  1YP6 A;  1YWB A;  4IMO A;  1EUO A;  3T6L A;  1SXX A;  1GX9 A;  4QGW A;  1EI5 A;  3GE2 A;  5L3Y A;  4I9S A;  1VWQ B;  2FT9 A;  5B27 A;  1GXA A;  4KC7 A;  2CAM A;  1DZP A;  1DZJ A;  2I5Z O;  2RTA A;  1QY0 A;  2FS7 A;  2GJ5 A;  3HOE A;  1YIV A;  3BSZ E;  3QKG A;  4NNT A;  3I0A A;  1RXH A;  1MOY A;  2OVA A;  3APW A;  4AW8 A;  4COT A;  4EQA C;  2GTL O;  4MEE A;  1HQP A;  4BX7 A;  4LKT A;  1KXO A;  1ZNE A;  3FA8 A;  4KT5 A;  1SLD B;  2ZAI A;  2RTE B;  1AVD A;  3F6Z B;  1RBP A;  4M6S A;  5LKF A;  2L68 A;  1EII A;  2IZI A;  5C0N A;  2ALL X;  1YP7 A;  1X71 A;  5AQ6 A;  4QNI A;  5B2A O;  3CQR A;  3WJD A;  2L5P A;  1X8U A;  4GDZ A;  4HFO A;  4ORX A;  1XCA A;  4YFQ A;  2OFM X;  2FLJ A;  5D47 A;  1URE A;  5F2B A;  2OY5 O;  4NYR A;  2Q4N A;  4MIS A;  1N0S A;  2AT5 X;  1EIO A;  4RUU A;  5HZ9 A;  1KGL A;  2X45 A;  1CJ5 A;  4Z27 A;  1IW2 A;  1VWC B;  4NLJ A;  4Z2P A;  2BT9 A;  1VWR B;  1SRI A;  1R0U A;  1NBX A;  3D97 A;  4KII A;  3PQU A;  4K19 A;  4MVI A;  4PJ2 A;  1FEM A;  1KL4 A;  2XKL A;  2AT3 X;  5L8N A;  5EDC A;  5LJC A;  2OFA A;  3CMP A;  1HQQ A;  1JJX A;  3C76 X;  1LDQ A;  2X8T A;  4O4X A;  4WFV A;  1ZNG A;  1KQX A;  1DC9 A;  1T68 X;  4LKP A;  2IZD B;  1LPJ A;  2GC9 A;  3WJG A;  4YCE A;  5LKE A;  1JYD A;  1Y9T A;  5EPQ A;  1X8O A;  3PEC A;  4ALB A;  1VWP B;  1MEP A;  5HZ5 A;  1LKE A;  4QZT A;  1NP4 A;  1BRQ A;  4ZR2 A;  1SWP A;  4GD9 A;  4NP1 A;  3S60 A;  1SXU A;  2OYB O;  1KT6 A;  1BSQ A;  3VE1 A;  4BJ8 A;  4HPB A;  5LJG A;  3MVF A;  4Z2V A;  1UYN X;  1LFO A;  1KL5 A;  2Y3F A;  3STN A;  1SWD A;  2ZAG A;  3BU1 A;  4IB8 A;  1GKA B;  4EFG A;  3EBK A;  4TQ2 A;  1HMS A;  4OS0 A;  4BX7 B;  3C77 X;  4ZJ0 A;  4QRL A;  3SZI A;  3FDC A;  4M7M A;  5FFH A;  5K06 A;  2F01 A;  2K23 A;  1HY2 A;  2QO4 A;  5EED A;  3HWD A;  3KZA A;  1MX8 A;  2NNQ A;  5K67 A;  2EU7 X;  2OFB A;  2R73 A;  3K3L A;  4Y0Q A;  3FA7 A;  5F1E A;  3ZW1 A;  1SXW A;  2IZL B;  3OE3 A;  3CR6 A;  1G5W A;  3SZH A;  1L6M A;  4I95 A;  4ZGF A;  2LA7 A;  5LJE A;  3P6D A;  1LDO A;  1NQN A;  3BY0 A;  4BBO A;  2PI3 O;  1SWL A;  2AL0 X;  2HZR A;  2X55 A;  2FHL A;  4O4O A;  5HCE C;  4BX5 A;  4ZHH A;  5LJH A;  2RTK A;  1SY3 A;  5D48 A;  5CHK A;  5F6Z A;  4AZO A;  2BS5 A;  1FTP A;  1QG5 A;  2P8G A;  4ODD A;  5BYP A;  2X56 A;  3FA9 A;  1JV4 A;  1X8Q A;  3NX1 A;  4L3R A;  4YDA A;  5HZ6 A;  5IO6 A;  3FEK A;  3EMM A;  3RDO A;  3Q6L A;  5JR8 A;  1VYG A;  2FGS A;  4AZN A;  4NNS A;  5D4A A;  1RSU B;  4O4U A;  1JYJ A;  1BRP A;  2F73 A;  4O3Y A;  4CPF A;  5LJD A;  1SWH A;  1HBP A;  2RA6 A;  1ZNK A;  1N7Y A;  4U8U O;  3DSZ A;  4ALO A;  3CQN A;  4Z28 A;  1ACD A;  3WZP A;  4YBP A;  3WYP A;  4FBV A;  3WJE A;  1H91 A;  2RN4 A;  2E4J A;  3CKF A;  5F7G A;  3VU1 A;  1QY2 A;  2RTI B;  1KT5 A;  2VFB A;  4MIR A;  4Y5D A;  5H9N A;  1VWA B;  1PMP A;  5IRA A;  4AZM A;  4DQ3 A;  4MVK A;  5JD2 A;  2IZB A;  4OMX A;  4TNN A;  1SY2 A;  1K3B A;  1HMR A;  2KTS A;  4ZH9 A;  2X34 A;  4TKJ A;  4U3Q A;  1I06 A;  3U0D A;  1BLR A;  4OEM A;  1U17 A;  3HWG A;  1EW3 A;  2A2U A;  3RDS A;  4ZHC A;  2JU8 A;  5FAZ A;  3ZW0 A;  2WEW A;  4LZV A;  2OVS A;  3Q34 A;  1Y0G A;  3KFG A;  2LBV A;  3RWX A;  4TLJ A;  5IXG A;  3FIQ A;  3FW4 A;  4O49 A;  1FEL A;  3RZY A;  1E2T A;  1VWE B;  5H9L A;  2QO5 A;  3PP6 A;  4IRW A;  1CBQ A;  2FR2 A;  2CZU A;  4ZCB A;  2IZK A;  3FR2 A;  4YH0 A;  3EBW A;  2C4I A;  4IAB A;  1A18 A;  2IFB A;  2Q2P A;  4IBA A;  4QYN A;  4BGF A;  3ZW1 B;  1G74 A;  4ON1 A;  2JU7 A;  1SWR A;  1HBQ A;  1SWU A;  2RCQ A;  4GNY A;  4DNE A;  3NR3 A;  3FR4 A;  1MM9 A;  4IMN A;  4WBK A;  4ZGU A;  4EDE A;  1JMX A;  2HLV A;  2M4L A;  4BX5 B;  1SLF B;  1GT3 A;  2BSZ A;  1O8V A;  2LBA A;  2OVD A;  1DF8 A;  2RTC B;  4GGZ A;  2A0A A;  5B11 O;  1EAL A;  3AUM O;  2AT0 X;  1LCV A;  1LIF A;  1WUB A;  4Y0R A;  4UU2 A;  4B55 A;  1BM5 A;  4O4S A;  3RE5 A;  3H3I A;  5FEN A;  5FQ6 E;  1SMP I;  3P02 A;  2IZF B;  2A2G A;  3ZUI A;  4D6B A;  2MM3 A;  1KT3 A;  1SWB A;  3BRN A;  4GGT A;  5IO7 A;  4BCS A;  4I3D A;  4A60 A;  1W5R A;  2A13 A;  1RST B;  3KQ0 A;  3WXQ A;  1EXS A;  4GDA A;  3FLL A;  1AB0 A;  2OL6 O;  5BVQ A;  1VWB B;  2Q39 A;  4CPH A;  4GK9 A;  4R0B A;  4GH7 A;  3ZUO A;  1VWL B;  2A5B A;  4QQ1 A;  4HPA A;  1I05 A;  2AVI A;  5EDB A;  4DQ4 A;  4TJZ A;  1OSP O;  5DG4 A;  3PPT A;  4A1H A;  3PQS A;  3P6F A;  1X89 A;  2NNE A;  4ORR A;  1I04 A;  1QWD A;  2OFR X;  3NQ3 A;  2YG2 A;  1N43 A;  1BWY A;  1QY1 A;  1IJ8 A;  4A8Z A;  2X8F A;  3NPO A; 
#chains in the Genus database with same CATH homology
 1O1V A;  3E3C A;  4ZH6 A;  5H9K A;  3B2H A;  2Z4H A;  1A2D A;  4YCH A;  1KOI A;  3NBX X;  3V8U A;  3BS2 A;  3ZW0 B;  1YUP A;  2BS6 A;  4HPD A;  3DTQ A;  4ORU A;  4EXZ A;  3WBG A;  4CSB A;  5H9A A;  4ORY A;  2R74 A;  1X8N A;  2Q2M A;  4GZV A;  4N7C A;  4N7D A;  1IFB A;  1ICM A;  4YGZ A;  3VG4 A;  1BJ7 A;  4NW4 A;  4QYP A;  1Z24 A;  1CRB A;  1OPA A;  4BQU A;  1KQW A;  2LFO A;  3JQO A;  1AEL A;  4ZHD A;  3NP1 A;  3G7X A;  1NGL A;  4GE1 A;  5EZ2 A;  3ZW2 A;  1ERX A;  4IB7 A;  4KC8 A;  1RLB E;  1AQB A;  3UAQ A;  3UEV A;  4ZFX A;  2AH7 X;  3C78 X;  1S44 A;  2GTL M;  3APU A;  4GRJ A;  1SXY A;  4YGH A;  5L8O A;  1TW4 A;  4TKB A;  3EM0 A;  3WVM A;  2KW1 A;  4I9R A;  3PH6 A;  3S5X A;  3VG2 A;  2L67 A;  3APX A;  1O1U A;  1ZRY A;  1S2P A;  2MWH A;  3VE2 A;  2HMB A;  1JZU A;  1CBS A;  4HPC A;  3CBC A;  1X8P A;  1PM1 X;  2WR6 A;  2BLG A;  4ZHG A;  1YWC A;  1ICN A;  1QFT A;  3P6C A;  1LIE A;  3U9P C;  2GTL N;  4Y0P A;  2BHV A;  2CZT A;  1LID A;  3KFF A;  3VG7 A;  1QQS A;  4YKM A;  4BVM A;  4QGV A;  4I3C A;  5HZ8 A;  1KZX A;  3P6H A;  1KT7 A;  1YWA A;  3B2I A;  3HWE A;  5F6B A;  2R56 A;  1A3Y A;  1TXL A;  3IFB A;  1UZ2 X;  1HN2 A;  1TOU A;  1IIU A;  2WWP A;  3T1D A;  3TGA A;  3HOL A;  5HZQ A;  4XMD A;  2XST A;  3VG5 A;  1OEE A;  4YGG A;  1XKI A;  1IFC A;  1PEE A;  1DF3 A;  2LB6 A;  1EQD A;  2RQ0 A;  3N91 A;  5HTD A;  3BLG A;  1AVG I;  1ERB A;  5FQ8 E;  2NND A;  4XMH A;  4FBO A;  4O3Z A;  1B56 A;  1BEB A;  4LQZ A;  2HNX A;  4TKH A;  1I4U A;  2KT4 B;  3P24 A;  4GET A;  1T8V A;  5DPQ A;  4GU8 A;  5HA1 A;  3ZQ3 A;  1FE3 A;  4YBU A;  2K62 A;  4KCA A;  3B2K A;  5KID A;  1OBP A;  1E02 A;  2QO6 A;  3OBL A;  4NLI A;  4QAE A;  4GNW A;  5KIC A;  3VPJ E;  5AJB A;  2CBR A;  3PH5 A;  1LIB A;  3S26 A;  3B2L A;  5CYB A;  2JOZ A;  5HWZ A;  1TOW A;  3I17 A;  3S5V A;  4AZQ A;  4L1N A;  3O2Y A;  4YDB A;  4O3X B;  1E00 A;  5EEE A;  3ZZV A;  1QAB E;  2X46 A;  2Q9S A;  5IO5 A;  2CM4 A;  3HK1 A;  3FYF A;  2OZQ A;  2AKQ A;  2F09 A;  3AKN A;  3ELZ A;  3WJF A;  3PED A;  4AYH A;  3LHN A;  4D6A A;  4INN A;  1ADL A;  2LKK A;  2JMB A;  1ML7 A;  2L9C A;  3SOT A;  1FDQ A;  1G7N A;  1P6P A;  3RKG A;  3BDR A;  3UEU A;  1T0V A;  3AKM A;  4YKO A;  3BX7 A;  3L4R A;  3STM X;  5KHP A;  2QOS C;  4ID2 A;  1NP1 A;  2ACO A;  1JIW I;  3WOV A;  3EYC A;  1D2U A;  3FMZ A;  3MX7 A;  4OS3 A;  5D45 A;  2AT8 X;  5F58 A;  2A3F X;  4EEJ A;  1GKA A;  5B29 A;  3FEN A;  3RSW A;  2G79 A;  2ASN X;  1D3S A;  3FA6 A;  5CE4 A;  5HCC C;  1JBH A;  3WJC A;  2RD7 C;  2X8S A;  3GAQ A;  3CWK A;  3F9D A;  1SY0 A;  3O22 A;  2HZQ A;  2NP1 A;  3ZWE A;  3BU9 A;  3VG3 A;  1OBU A;  2W2B A;  1OBQ A;  4A1Y A;  2AT6 X;  2MO5 A;  3VG6 A;  2QM9 A;  5HA0 A;  3P6E A;  4U8U M;  1YWD A;  3HWF A;  4XMC A;  4XME A;  5HCD C;  1CBR A;  1ZND A;  2JW1 A;  1QFV A;  3KFI A;  4I6S A;  4FQB B;  2KD2 A;  4AZP A;  1EPA A;  2JN3 A;  2WQA E;  3D95 A;  2W2F A;  1B8E A;  1BSO A;  1MX7 A;  5LJK A;  3TGC A;  3RBY A;  4CV7 A;  4U8U N;  4NYQ A;  1DZK A;  1LIC A;  1PBO A;  1IKJ A;  2ANS A;  3NAD A;  4HWM A;  1E5P A;  2FTB A;  1DZM A;  1FEN A;  3MBT A;  1VYF A;  4IAX A;  4ARH A;  4ORS A;  1DV9 A;  3LV4 A;  3FEL A;  3UEW A;  1JJJ A;  2FR3 A;  4FGI B;  4LZU A;  3ZI8 A;  1BBP A;  1GT4 A;  1LF7 A;  3CBS A;  4ML7 B;  1OPB A;  3FEP A;  2MJI A;  3BX8 A;  2RCT A;  1Y9L A;  4YFR A;  3FR5 A;  1ZNH A;  3B2J A;  5L8I A;  1OEJ A;  1GX8 A;  3TZS A;  4XMF A;  4IB6 A;  1GT5 A;  3F8A A;  2MHD A;  2DM5 A;  3O19 A;  3TF6 A;  2YMS A;  1IKE A;  2G78 A;  2O62 A;  5D8J A;  1VPR A;  4KH8 A;  1U0X A;  4MVE A;  2G7B A;  4AZR A;  1SY1 A;  4IB9 A;  1MDC A;  3UEX A;  3ELX A;  2WQ9 A;  4ORW A;  3APV A;  1SA8 A;  1HMT A;  3STK A;  4BOE A;  4PSQ A;  3OD9 A;  4OMW A;  4JGL A;  3HTY A;  2W2A A;  3NQ9 A;  3P6G A;  2PY1 A;  2QMI A;  5HAE A;  3IA8 A;  4OS8 A;  4WHI A;  4RUN A;  3SAO A;  2AMM X;  1MVG A;  4O3W A;  1BSY A;  2HYS A;  2GTF X;  1B4M A;  4O9S A;  2POA A;  5FQ7 E;  5HTE A;  1ZNL A;  5AEO A;  2KTD A;  4QGX A;  4ES7 A;  4Y0S A;  2FS6 A;  2WUT A;  2N93 A;  5LJB A;  1ALB A;  1CBI A;  3D4R A;  3KFH A;  4MVL A;  2FRS A;  1KT4 A;  1EPB A;  4FBR A;  5BVS A;  1G85 A;  4QZU A;  1U18 A;  2JU3 A;  4CK4 A;  1GGL A;  1LNM A;  2ACP X;  1MUP A;  2FWV A;  2WEX A;  2CBS A;  2WSJ A;  4WFU A;  5HBS A;  5BVT A;  3D96 A;  2OVE A;  4ZHF A;  3FW5 A;  1OEK A;  4XMG A;  1B0O A;  2CM9 A;  1GM6 A;  3OJY C;  3U03 A;  1A57 A;  4YMY A;  4I3B A;  2Z4I A;  4U9C A;  1KZW A;  1S7D A;  4IAW A;  4UU3 A;  3JSQ A;  1TVQ A;  3NX2 A;  3JS1 A;  3WJB A;  4GKC A;  5AJC A;  1GT1 A;  4YFP A;  1DFV A;  1E06 A;  3TGB A;  5H8T A;  3NQK A;  1YP6 A;  1YWB A;  4IMO A;  1EUO A;  1SXX A;  1GX9 A;  4QGW A;  1EI5 A;  3GE2 A;  4I9S A;  2FT9 A;  5B27 A;  1GXA A;  4KC7 A;  1DZP A;  1DZJ A;  1QY0 A;  2FS7 A;  2GJ5 A;  3HOE A;  1YIV A;  3BSZ E;  3QKG A;  4NNT A;  3I0A A;  2OVA A;  4AZO A;  4AW8 A;  3APW A;  4EQA C;  4COT A;  2GTL O;  1HQP A;  4LKT A;  1KXO A;  1ZNE A;  3FA8 A;  4KT5 A;  2ZAI A;  3F6Z B;  1RBP A;  4M6S A;  5LKF A;  2L68 A;  1EII A;  5C0N A;  2ALL X;  1YP7 A;  1X71 A;  5AQ6 A;  4QNI A;  3WJD A;  3CQR A;  2L5P A;  1X8U A;  4GDZ A;  4HFO A;  4ORX A;  1XCA A;  4YFQ A;  2OFM X;  2FLJ A;  5D47 A;  1URE A;  4NYR A;  2Q4N A;  4MIS A;  1N0S A;  2AT5 X;  1EIO A;  4RUU A;  5HZ9 A;  1KGL A;  2X45 A;  1CJ5 A;  1IW2 A;  4NLJ A;  2BT9 A;  1R0U A;  3D97 A;  4KII A;  3PQU A;  4K19 A;  4MVI A;  4PJ2 A;  1FEM A;  2XKL A;  2AT3 X;  5L8N A;  5EDC A;  5LJC A;  3CMP A;  1JJX A;  3C76 X;  4O4X A;  2X8T A;  4WFV A;  1ZNG A;  1KQX A;  1DC9 A;  1T68 X;  4LKP A;  1LPJ A;  2GC9 A;  3WJG A;  4YCE A;  5LKE A;  1JYD A;  1Y9T A;  5EPQ A;  1X8O A;  3PEC A;  4ALB A;  5HZ5 A;  1LKE A;  4QZT A;  1NP4 A;  1BRQ A;  4ZR2 A;  4NP1 A;  3S60 A;  1SXU A;  1KT6 A;  1BSQ A;  3VE1 A;  4HPB A;  5LJG A;  3MVF A;  1LFO A;  3STN A;  2ZAG A;  3BU1 A;  4IB8 A;  1GKA B;  4EFG A;  3EBK A;  4TQ2 A;  1HMS A;  4OS0 A;  3C77 X;  4ZJ0 A;  4QRL A;  4M7M A;  5FFH A;  5K06 A;  2K23 A;  2QO4 A;  5EED A;  3HWD A;  3KZA A;  1MX8 A;  2NNQ A;  2EU7 X;  4Y0Q A;  2R73 A;  3K3L A;  3FA7 A;  5F1E A;  3ZW1 A;  1SXW A;  3OE3 A;  3CR6 A;  1G5W A;  1L6M A;  4I95 A;  4ZGF A;  2LA7 A;  5LJE A;  3P6D A;  3BY0 A;  2AL0 X;  2HZR A;  4ZHH A;  4O4O A;  5HCE C;  5LJH A;  5F6Z A;  1SY3 A;  5D48 A;  2BS5 A;  1FTP A;  1QG5 A;  2P8G A;  4ODD A;  5BYP A;  3FA9 A;  1JV4 A;  1X8Q A;  3NX1 A;  4L3R A;  4YDA A;  5HZ6 A;  5IO6 A;  3FEK A;  3EMM A;  3Q6L A;  5JR8 A;  1VYG A;  4AZN A;  4NNS A;  5D4A A;  4O4U A;  1JYJ A;  1BRP A;  2F73 A;  4O3Y A;  5LJD A;  1HBP A;  2RA6 A;  1ZNK A;  4U8U O;  3DSZ A;  4ALO A;  3CQN A;  1ACD A;  4YBP A;  4FBV A;  3WJE A;  1H91 A;  2RN4 A;  2E4J A;  5F7G A;  3VU1 A;  1QY2 A;  4AZM A;  1KT5 A;  4MIR A;  5H9N A;  4DQ3 A;  1PMP A;  4MVK A;  4OMX A;  4TNN A;  1SY2 A;  1HMR A;  2KTS A;  4ZH9 A;  4TKJ A;  4U3Q A;  1I06 A;  3U0D A;  1BLR A;  1U17 A;  3HWG A;  1EW3 A;  2A2U A;  4ZHC A;  2JU8 A;  5FAZ A;  3ZW0 A;  2WEW A;  4LZV A;  2OVS A;  2LBV A;  3KFG A;  3RWX A;  4TLJ A;  3FIQ A;  3FW4 A;  4O49 A;  1FEL A;  3RZY A;  5H9L A;  2QO5 A;  3PP6 A;  1CBQ A;  2FR2 A;  2CZU A;  4ZCB A;  3FR2 A;  4YH0 A;  3EBW A;  4IAB A;  4QYN A;  1A18 A;  2IFB A;  2Q2P A;  4IBA A;  3ZW1 B;  1G74 A;  4ON1 A;  2JU7 A;  1HBQ A;  2RCQ A;  4GNY A;  3NR3 A;  3FR4 A;  4IMN A;  4WBK A;  4ZGU A;  4EDE A;  2M4L A;  2HLV A;  1GT3 A;  1O8V A;  2LBA A;  2OVD A;  1EAL A;  2A0A A;  2AT0 X;  1LIF A;  4Y0R A;  4UU2 A;  1BM5 A;  4O4S A;  3H3I A;  5FEN A;  5FQ6 E;  1SMP I;  3P02 A;  2A2G A;  3ZUI A;  4D6B A;  2MM3 A;  1KT3 A;  3BRN A;  5IO7 A;  4I3D A;  4A60 A;  2A13 A;  3KQ0 A;  3WXQ A;  1EXS A;  3FLL A;  1AB0 A;  5BVQ A;  2Q39 A;  4GK9 A;  4R0B A;  4GH7 A;  3ZUO A;  4QQ1 A;  4HPA A;  1I05 A;  4DQ4 A;  5EDB A;  4TJZ A;  5DG4 A;  3PPT A;  4A1H A;  3PQS A;  3P6F A;  1X89 A;  2NNE A;  4ORR A;  1I04 A;  1QWD A;  2OFR X;  3NQ3 A;  2YG2 A;  1BWY A;  1QY1 A;  4A8Z A;  2X8F A;  3NPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...