1LCWA

Streptavidin-homobiotin complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Unknown function
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1lcwA00
1SREA 1SWKA 1MM9A 2RTNB 4BX7B 1VWIB 4BX7A 2QCBA 4Z6JA 2IZGB 4CPHA 1VWDB 1VWBB 2A8GA 2IZFB 5CHKA 1LUQA 4GGZA 2JGSA 1N7YA 3FDCA 3T2WA 1VWEB 4Z28A 2Y3FA 2RTBB 4Z27A 3T2XA 1SWQA 2RTRB 3MG5A 4CPFA 4CPEA 1SWCA 5CSEA 5B5FA 1AVEA 3RY1A 1I9HA 3WZOA 2CAMA 4GDAA 2RTGB 2RTEB 1SWEA 4Y5DA 3RDUA 2IZIA 1VWCB 4BX6B 2A5CA 3RDSA 3WYQA 1SWFA 4BX6A 4U46A 1SRIA 1VYOA 1SWGA 2G5LA 2GH7A 2IZKA 4JO6A 4EKVA 2IZAA 1N9YA 4GGTA 1SLDB 2ZSCA 5IRUA 5K68A 3SZIA 3VHHA 2RTFB 2Y3EA 2OFAA 1DF8A 1RXKA 2RTCB 4GD9A 4GJVA 3SZHA 2OFBA 2OF8A 1Y52X 3VHMA 1SLFB 1Y55X 4BBOA 1LCVA 1SWOA 2RTMA 1LCZA 1RXJA 3EW2A 1SRHA 3RE6A 2IZHB 3T6FA 2IZCB 4Z2OA 3RDQA 1SLGB 2A5BA 4JHQA 1SRFA 1VWOB 1SWTA 3RDOA 1RXHA 2C1QA 1N43A 4DNEA 2FHLA 1VWHB 1RSUB 4YVBA 1MK5A 2MF6A 1SWHA 3PK2A 5F2BA 3T6LA 1RSTB 4Z2VA 2RTHB 4GJSA 3WZQA 1SWBA 2IZEB 1SWUA 2RTJA 3WYPA 1MEPA 1SWPA 1HQQA 1VWFB 1NDJA 1SWJA 3VHIA 1STPA 2WPUA 1AVDA 1N4JA 3EW1A 1SWRA 2IZDB 4Z2PA 1SWLA 1Y53X 1KL4A 1KFFA 2IZBA 2Y32A 1HXLA 1VWQB 4Y59A 1LCWA 1SWAA 2RTKA 4BCSA 1LDQA 2C1SA 1WBIA 1N9MA 1LELA 1SWSA 1SWNA 3MM0A 1VWJB 3RE5A 1VWKB 1LDOA 2RTDB 1NBXA 5L3YA 4OKAA 1KL5A 1NQNA 4IRWA 1SRJA 1STRB 2FHNX 1KL3A 1PTSA 3VGWA 2UZ2A 2OF9A 5K67A 3RDMA 4BX5B 2UYWA 2C4IA 1HXZA 1NC9A 1IJ8A 1VWAB 4BX5A 2RTLA 4CPHB 5IRAA 3X00A 2BC3A 2IZLB 2IZJA 2RTAA 5JD2A 3WZNA 5B5GA 4JNJA 2RTIB 1VWLB 2RTPB 1SWDA 1VWPB 5IRWA 4I60A 3RDXA 1VWNB 3WZPA 1SLEB 1STSB 1VWMB 2RTOB 1RAVA 4CPIA 4BJ8A 1VWGB 1NQMA 3SZJA 4GGRA 1VWRB 3RY2A 2RTQB 2AVIA 2F01A 1SRGA 1MOYA 1HY2A
chains in the Genus database with same CATH superfamily
2OYBO 2KD2A 2AT3X 4AZNA 4TQ2A 4M7MA 3FEPA 3FR4A 4YDBA 3SLJA 5BYPA 1N0SA 1PBOA 3Q6LA 4XMFA 4AZMA 3PQSA 4KT5A 2L67A 5K06A 3BY0A 4OELA 4YFRA 5AQ6A 3ZW1A 1I04A 5KHPA 1FE3A 1LUQA 3C77X 3FDCA 3T2WA 2R56A 2Y3FA 3FIDA 4Z27A 4QQ1A 2AKQA 1AELA 3FA7A 4ORRA 2PI3O 4CPFA 3NBXX 3NQ9A 2KTDA 1BRQA 1SWCA 3NX1A 5D47A 2BS5A 5AJBA 2FT9A 4AZOA 2X8SA 3VG3A 1I9HA 2OY8A 3O19A 3PH5A 4Y0SA 1CRBA 4GDAA 2OFRX 4A1HA 4BOEA 5HCCC 2MO5A 1ZNHA 3MVFA 4BX6B 3P24A 3RDSA 1OBPA 1YIVA 3WJGA 1AQBA 1SXYA 2ACPX 2LB6A 3WVMA 4EKVA 1OPBA 4CV7A 2IZAA 1GT4A 2ZSCA 3PECA 3VHHA 2OFAA 3FR5A 1OEJA 1RXKA 4GJVA 4ORXA 2LBAA 4ORYA 3RZYA 4A8ZA 1RBPA 1Y52X 1ZNEA 5CE4A 4BBOA 4EEJA 1LCVA 2RTMA 1LCZA 1OEKA 1BRPA 1SRHA 2R74A 5DPQA 3NR3A 2CBRA 2ANSA 1LIEA 4DQ4A 2G79A 2I5ZO 1SRFA 1P6PA 3BX7A 1JJXA 4U8UO 3P02A 5HBSA 2JU3A 3EMMA 1LIDA 1RXHA 1GXAA 3GE2A 3PH6A 4N7DA 4BVMA 4C5PA 4LZVA 1RSUB 4ZGFA 4I9SA 1A18A 1TOUA 2FS6A 4NLIA 5EEDA 4AZRA 1MK5A 2MF6A 3B2IA 4KCAA 4LZUA 4MVLA 4YGHA 4IABA 4QYNA 5D48A 4MVKA 2F09A 3ZI8A 4CDEA 2JOZA 5L8OA 1KQXA 4D6AA 2IZEB 1SWUA 2HYSA 1SWPA 1DZKA 1R0UA 1HQQA 1VWFB 1SWJA 1S2PA 1EPBA 2E4JA 2MJIA 2RD7C 4AZPA 2WPUA 1MUPA 4TLJA 4NNTA 4HPCA 1SWRA 2IZDB 4ZJ0A 1EQDA 1SXXA 5D4AA 3PDFA 4IAWA 2X56A 3TGBA 2Y32A 1VWQB 4IB8A 3F8AA 5F6ZA 5FQ7E 1B56A 1UYNX 2OY7A 2X46A 4BCSA 1LKEA 1N9MA 4L3RA 1KT3A 1SWSA 3SLTA 3P6HA 1LDOA 5HAEA 4EQAC 3NP1A 4O4XA 2A13A 1H91A 1A2DA 1FEMA 1ADLA 1KL5A 1NQNA 1STRB 2AT0X 2WR6A 3EC5A 1PTSA 4I3BA 1A57A 1GX3A 5K67A 4EXZA 2WQAE 1HQPA 1G85A 2IFBA 4DQ3A 4GETA 4GDZA 4BX5A 2RTLA 5FAZA 3ZW1B 1ACDA 1OPAA 2MM3A 3X00A 4NNSA 4MVIA 2AT8X 2IZLB 4ZHHA 3FEKA 3BLGA 4YCHA 1LPJA 2L5PA 3L4RA 5B5GA 4JNJA 2RCTA 4ZHFA 2RTIB 2RTPB 1SWDA 2NP1A 1OSPO 3D97A 5BVQA 1FELA 3BU9A 2RTOB 1STSB 4U8UN 4OS0A 2OZQA 1RAVA 1YWCA 1ALBA 2ZAGA 4RUUA 2VFBA 4PJ2A 3WBGA 4BJ8A 1NQMA 4NLJA 1QFTA 4GGRA 1VWRB 5L8IA 2A2GA 3RY2A 2AVIA 4MEEA 1B8EA 1SRGA 1FENA 3BX8A 4KC7A 1D2UA 4EDEA 1DFVA 4NW4A 4FQBB 1SREA 2FLJA 5L8NA 3U0DA 4YMYA 2OL6O 4IBAA 1MM9A 3VG4A 1Y0GA 2L68A 1DZMA 4MVEA 1VWIB 1KZWA 1BBPA 3KZAA 4YBPA 4BX7A 2QCBA 5FFHA 2N93A 2CM4A 2IZGB 4CPHA 2IZFB 1VWBB 5C0NA 2K23A 4XMCA 1HBQA 1EALA 4GGZA 4O3XB 3C78X 1VWEB 1DF3A 4NP1A 4O4OA 3TGAA 2KT4B 1EPAA 5F7GA 2ASNX 4ORSA 1BM5A 3H3IA 2ACOA 5B5FA 1O8VA 2VDFA 3RY1A 4Y0QA 3TF6A 2L9CA 1YWBA 2YG2A 3B2JA 5HCDC 5EEEA 1VYGA 4QRLA 2RTEB 3HWDA 4IMOA 4Y5DA 2FTBA 1TXLA 2IZIA 1GT1A 1ICNA 1GT5A 3B2LA 3VU1A 5LKFA 2A5CA 4WHIA 4O49A 1IIUA 4Y0PA 1VYOA 4KC8A 1SWGA 3OD9A 2A3FX 3KFGA 4M6SA 5LJKA 4GGTA 3JQOA 3CQRA 5K68A 4GE1A 4QGVA 2Q39A 1DF8A 4GD9A 3ELXA 2CZUA 1ML7A 1QY0A 1EW3A 2GTFX 3ELZA 1SLFB 1ZRYA 1X8UA 3ZW0A 2GTLO 1RXJA 1BSQA 1LIFA 2LFOA 3T6FA 2IZCB 4O3YA 1JV4A 2X32A 2A5BA 3APXA 3PQUA 2POAA 4JHQA 3D4RA 4ZFXA 4O9SA 3P6EA 4YFPA 3SAOA 3O2YA 1YP6A 1YUPA 2GJ5A 4JGLA 3CMPA 5D45A 2X55A 4UU3A 3STMX 1OBQA 3RDOA 1KZXA 2AL0X 1IW2A 1HMSA 4YVBA 5AEOA 4ZHGA 5HZ8A 1GGLA 1EI5A 4ALOA 1BJ7A 2RQ0A 3PK2A 3T6LA 2OY1O 3FW4A 4TKJA 2RTHB 4Z2VA 4YFQA 1SWBA 2FKJA 1GKAA 3WYPA 1T68X 1MEPA 2X34A 4FBVA 3VHIA 1X8QA 2W2AA 1STPA 2OFMX 3BDRA 3HOLA 1G5WA 1N4JA 5HA0A 4U9CA 4ZGUA 1UREA 2JW1A 1X8OA 2QOMA 1JBHA 3HWGA 3FR2A 2FS7A 2IZBA 4QAEA 1LCWA 2OVSA 2QM9A 2HLVA 1LDQA 2C1SA 2RN4A 5EZ2A 1SY0A 1LELA 1ICMA 5LJGA 1PEEA 3MM0A 4FBOA 1HN2A 2FRSA 4YBUA 3AEHA 2OVDA 2CZTA 4HFOA 4XMEA 5EDCA 4LQZA 1NP4A 3BS2A 3BSZE 3D96A 1SA8A 1IKJA 2UZ2A 1TOWA 2HNXA 1HXZA 1NC9A 1PMPA 4LKTA 1CBSA 1IFBA 3KFFA 5HA1A 2X8TA 3VG2A 1EUOA 4CPHB 4BQUA 2IZJA 3APWA 2JU8A 2RTAA 5HTEA 1DZPA 3BRNA 3EYCA 3KFHA 3NX2A 4GKCA 2GTLN 5JD2A 3TZSA 4B55A 2HKDA 3CR6A 3ZQ3A 2W2BA 3FA9A 1U0XA 2XSTA 3P6FA 1EIIA 3QKGA 4I60A 3AKNA 3OBLA 4PSQA 3D95A 1GM6A 1VWNB 1SLEB 5LJCA 1JIWI 3P6DA 5EPQA 3S60A 4OMXA 3T1DA 1ZNGA 1VYFA 1ZNLA 2G8CO 1WUBA 2WWPA 3FLLA 1UYOX 1TW4A 4ORUA 3FYFA 4GNYA 4CPIA 3KFIA 1FDQA 2HZQA 3STKA 5DG4A 2WQ9A 1KT7A 1LICA 5H9NA 2AT5X 2RTQB 2WUTA 2F01A 1S7DA 1MOYA 3JSQA 1FTPA 5F58A 5IRUA 1SWKA 4YDAA 3ZW2A 1Y9TA 2BS6A 3WJCA 1NP1A 2JU7A 5B2AO 5HZ5A 2QOSC 2LA7A 2X4MA 2OVAA 4YH0A 2JMBA 1VWDB 3FIQA 3TGCA 5CHKA 3I17A 3STNA 1YP7A 1N7YA 3OE3A 4YGGA 3VPJE 1MVGA 1BEBA 3MG5A 3VE1A 3S5VA 4OS8A 4CPEA 4ORWA 5CSEA 4ON1A 5KIDA 5LJBA 1W6FA 4KIIA 5LJHA 3WZOA 4XMHA 4CK4A 1EXSA 4U8UM 5D8JA 1KT4A 4ZCBA 5BVSA 5H9AA 3O22A 1L6MA 1VWCB 1Z24A 4O3WA 5HCEC 1GKAB 1SY1A 2YMSA 4UU2A 4HPDA 3WJBA 2F73A 3WYQA 4BX6A 1QFVA 1X8NA 2FGSA 4O3ZA 1K24A 1N9YA 1SLDB 3SZIA 4HPAA 4OMWA 2NNQA 4AYHA 3FENA 2RCQA 2RTCB 2OFBA 2OF8A 3S5XA 1YWDA 3HWEA 4GK9A 3AKMA 1SWOA 1U18A 1X89A 3GAQA 5B29A 5B11O 2CBSA 3RE6A 1QY2A 3RDQA 3CWKA 1VWOB 1SWTA 1JZUA 3CBSA 3HWFA 4MIRA 2P8GA 3B2KA 3ZUIA 4ML7B 3B2HA 2FHLA 1VWHB 4COTA 3EM0A 2G7BA 2I5VO 1JYDA 3UEWA 1QABE 2X45A 1SWHA 3NQ3A 4QYPA 5F2BA 3UEXA 1HMRA 3RWXA 2RTJA 3CKFA 4GUZA 2Z4IA 3RKGA 1NDJA 2KTSA 2FWVA 3EW1A 3FA8A 3E3CA 2DM5A 1BWYA 4Z2PA 3CBCA 1Y53X 2AMMX 1MX8A 3C76X 1RLBE 1QQSA 3FMZA 1KL4A 1KFFA 1HXLA 4Y59A 2QO5A 1SWAA 1BSOA 5LJEA 4GRJA 1O1UA 4YCEA 2QMIA 1WBIA 5IO7A 1PBYA 3DTQA 3OJYC 1MX7A 1SWNA 3FA6A 1VWJB 4OS3A 4ID2A 3RE5A 2NNDA 3SOTA 2DJGA 3CQNA 5IO5A 3PPTA 4A1YA 5HWZA 1S44A 3MBTA 5L3YA 1I06A 2GC9A 3ZUOA 2FHNX 2W2FA 5AJCA 3HTYA 2HMBA 2MHDA 4XMDA 3RDMA 4BX5B 4DCBA 1BLRA 1CBIA 1IJ8A 2Q9SA 5BVTA 4FGIB 4HWMA 1E06A 5IRAA 2BC3A 1U17A 3I0AA 2NNEA 4I3CA 2AF5A 4YKOA 2AT6X 1PM1X 3K3LA 4I9RA 1HBPA 1JQPA 1VWLB 1X71A 1KQWA 4NV8A 5FQ8E 5JR8A 1CBRA 1LNMA 2MWHA 5IRWA 1I78A 1KXOA 3WZPA 3APVA 1E00A 2OL7A 4O4SA 5B27A 1Y9LA 3SZJA 2BSZA 2Q4NA 4U3QA 1FJ1E 3AUMO 3N91A 3VG5A 1XKIA 4BGFA 5LJDA 4NYRA 2BHVA 4D6BA 4QZUA 1KT6A 2RTNB 3G7XA 3PEDA 4BX7B 5HZ9A 3FW5A 5H9LA 1IKEA 4EFGA 2PY1A 2Q2PA 4HPBA 1T0VA 3F6ZB 4Z6JA 3ZZVA 3UEUA 3EBWA 2A8GA 4IB6A 1ERXA 3NQKA 1SMPI 2JGSA 4MISA 5F6BA 4Z28A 3VG6A 2RTBB 1LFOA 3T2XA 1SWQA 2KW1A 2RTRB 3HOEA 1EIOA 2GTLM 4QZTA 1NGLA 1DZJA 2RA6A 1G7NA 4ZHDA 1SXUA 1W5RA 2WEXA 4YGZA 5CYBA 1AVEA 3UEVA 2ALLX 4AZQA 4CDCA 3NADA 3PP6A 1W4TA 2CAMA 1GT3A 2QO4A 4TNNA 1B4MA 3RDUA 2RTGB 1E02A 1SWEA 2BT9A 5H8TA 1LIBA 4WFVA 1JYJA 1JJUA 3APUA 4N7CA 1K3BA 4YKMA 5KICA 1KGLA 4FBRA 3P6GA 1SWFA 4OEMA 4ZH9A 3CKGA 4U46A 1SRIA 2G5LA 1AVGI 2GH7A 1QY1A 2IZKA 1ERBA 3DSZA 3P6CA 1HMTA 4GU8A 4JO6A 3VG7A 4TKHA 2FR3A 3WOVA 3LV4A 5B10O 3ZWEA 2RTFB 2Y3EA 2BLGA 3QQ2A 4TKBA 3IFBA 1SY3A 3SZHA 3ZW0B 3VHMA 2FKGA 4CDDA 2VFCA 1Y55X 5F1EA 1TVQA 1ZNKA 4ZHCA 2A0AA 3EW2A 1JJJA 2AH7X 3F9DA 2IZHB 4IB9A 4LKPA 3FELA 4IMNA 4ES7A 4Z2OA 5IO6A 1SLGB 4XMGA 4AW8A 5B3MO 2EU7X 2A2UA 2JN3A 4O4UA 4KH8A 5IXGA 1X8PA 1VPRA 1GX9A 4GH7A 1I4UA 1N43A 2C1QA 2R73A 4DNEA 5HZ6A 4QNIA 3HPEA 3V8UA 2Z4HA 1RSTB 3UAQA 4GJSA 3WJEA 1A3YA 3WZQA 4CSBA 3KVNA 2FR2A 5HTDA 2OVEA 3LTWA 4ODDA 4L1NA 5EDBA 1AVDA 1KT5A 1SY2A 1T8VA 4TJZA 4ARHA 1UZ2X 4I95A 2OL8O 3D9WA 1SWLA 5FQ6E 1B0OA 3S26A 4R0BA 3MX7A 3NPOA 2LBVA 1SXWA 2RTKA 5LKEA 3BU1A 2HZRA 3Q34A 3WJDA 1E5PA 2G78A 3WJFA 4RUNA 4CDFA 1OBUA 4QGXA 1VWKB 2DJFA 2RTDB 1NBXA 1GX8A 3VE2A 1I05A 3IA8A 3KQ0A 4OKAA 2ZAIA 1AB0A 4IRWA 1SRJA 4WFUA 5H9KA 1KL3A 4GZVA 2OY5O 3VGWA 2M4LA 2OF9A 3RBYA 3LHNA 2UYWA 2C4IA 1MDCA 1YWAA 1VWAB 1JMZA 2WSJA 3EBKA 3HK1A 3WXQA 4A60A 2CM9A 4GNWA 1QG5A 1OEEA 5FENA 4IAXA 2K62A 1KOIA 4ALBA 4I3DA 2QO6A 2Q2MA 3WZNA 2LKKA 4Y0RA 1VWPB 4ZH6A 1LF7A 1CJ5A 3RDXA 1CBQA 4INNA 4ZR2A 1VWMB 2O62A 5HZQA 3RSWA 4NV7A 2XKLA 1D3SA 4WBKA 1E2TA 1QWDA 1ZNDA 4K19A 1BSYA 4I6SA 1VWGB 3JS1A 2WEWA 4NYQA 2X8FA 1JMXA 1O1VA 3U03A 4QGWA 3U9PC 4IB7A 1G74A 1DV9A 3SLOA 1XCAA 1IFCA 1DC9A 1HY2A
chains in the Genus database with same CATH topology
1SREA 1SWKA 1MM9A 2RTNB 4BX7B 1VWIB 4BX7A 2QCBA 4Z6JA 2IZGB 4CPHA 1VWDB 1VWBB 2A8GA 2IZFB 5CHKA 1LUQA 4GGZA 2JGSA 1N7YA 3FDCA 3T2WA 1VWEB 4Z28A 2Y3FA 2RTBB 4Z27A 3T2XA 1SWQA 2RTRB 3MG5A 4CPFA 4CPEA 1SWCA 5CSEA 5B5FA 1AVEA 3RY1A 1I9HA 3WZOA 2CAMA 4GDAA 2RTGB 2RTEB 1SWEA 4Y5DA 3RDUA 2IZIA 1VWCB 4BX6B 2A5CA 3RDSA 3WYQA 1SWFA 4BX6A 4U46A 1SRIA 1VYOA 1SWGA 2G5LA 2GH7A 2IZKA 4JO6A 4EKVA 2IZAA 1N9YA 4GGTA 1SLDB 2ZSCA 5IRUA 5K68A 3SZIA 3VHHA 2RTFB 2Y3EA 2OFAA 1DF8A 1RXKA 2RTCB 4GD9A 4GJVA 3SZHA 2OFBA 2OF8A 1Y52X 3VHMA 1SLFB 1Y55X 4BBOA 1LCVA 1SWOA 2RTMA 1LCZA 1RXJA 3EW2A 1SRHA 3RE6A 2IZHB 3T6FA 2IZCB 4Z2OA 3RDQA 1SLGB 2A5BA 4JHQA 1SRFA 1VWOB 1SWTA 3RDOA 1RXHA 2C1QA 1N43A 4DNEA 2FHLA 1VWHB 1RSUB 4YVBA 1MK5A 2MF6A 1SWHA 3PK2A 5F2BA 3T6LA 1RSTB 4Z2VA 2RTHB 4GJSA 3WZQA 1SWBA 2IZEB 1SWUA 2RTJA 3WYPA 1MEPA 1SWPA 1HQQA 1VWFB 1NDJA 1SWJA 3VHIA 1STPA 2WPUA 1AVDA 1N4JA 3EW1A 1SWRA 2IZDB 4Z2PA 1SWLA 1Y53X 1KL4A 1KFFA 2IZBA 2Y32A 1HXLA 1VWQB 4Y59A 1LCWA 1SWAA 2RTKA 4BCSA 1LDQA 2C1SA 1WBIA 1N9MA 1LELA 1SWSA 1SWNA 3MM0A 1VWJB 3RE5A 1VWKB 1LDOA 2RTDB 1NBXA 5L3YA 4OKAA 1KL5A 1NQNA 4IRWA 1SRJA 1STRB 2FHNX 1KL3A 1PTSA 3VGWA 2UZ2A 2OF9A 5K67A 3RDMA 4BX5B 2UYWA 2C4IA 1HXZA 1NC9A 1IJ8A 1VWAB 4BX5A 2RTLA 4CPHB 5IRAA 3X00A 2BC3A 2IZLB 2IZJA 2RTAA 5JD2A 3WZNA 5B5GA 4JNJA 2RTIB 1VWLB 2RTPB 1SWDA 1VWPB 5IRWA 4I60A 3RDXA 1VWNB 3WZPA 1SLEB 1STSB 1VWMB 2RTOB 1RAVA 4CPIA 4BJ8A 1VWGB 1NQMA 3SZJA 4GGRA 1VWRB 3RY2A 2RTQB 2AVIA 2F01A 1SRGA 1MOYA 1HY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRE A;  1SWK A;  1MM9 A;  2RTN B;  4BX7 B;  1VWI B;  4BX7 A;  2QCB A;  4Z6J A;  2IZG B;  4CPH A;  1VWD B;  1VWB B;  2A8G A;  2IZF B;  5CHK A;  1LUQ A;  4GGZ A;  2JGS A;  1N7Y A;  3FDC A;  3T2W A;  1VWE B;  4Z28 A;  2Y3F A;  2RTB B;  4Z27 A;  3T2X A;  1SWQ A;  2RTR B;  3MG5 A;  4CPF A;  4CPE A;  1SWC A;  5CSE A;  5B5F A;  1AVE A;  3RY1 A;  1I9H A;  3WZO A;  2CAM A;  4GDA A;  2RTG B;  2RTE B;  1SWE A;  4Y5D A;  3RDU A;  2IZI A;  1VWC B;  4BX6 B;  2A5C A;  3RDS A;  3WYQ A;  1SWF A;  4BX6 A;  4U46 A;  1SRI A;  1VYO A;  1SWG A;  2G5L A;  2GH7 A;  2IZK A;  4JO6 A;  4EKV A;  2IZA A;  1N9Y A;  4GGT A;  1SLD B;  2ZSC A;  5IRU A;  5K68 A;  3SZI A;  3VHH A;  2RTF B;  2Y3E A;  2OFA A;  1DF8 A;  1RXK A;  2RTC B;  4GD9 A;  4GJV A;  3SZH A;  2OFB A;  2OF8 A;  1Y52 X;  3VHM A;  1SLF B;  1Y55 X;  4BBO A;  1LCV A;  1SWO A;  2RTM A;  1LCZ A;  1RXJ A;  3EW2 A;  1SRH A;  3RE6 A;  2IZH B;  3T6F A;  2IZC B;  4Z2O A;  3RDQ A;  1SLG B;  2A5B A;  4JHQ A;  1SRF A;  1VWO B;  1SWT A;  3RDO A;  1RXH A;  2C1Q A;  1N43 A;  4DNE A;  2FHL A;  1VWH B;  1RSU B;  4YVB A;  1MK5 A;  2MF6 A;  1SWH A;  3PK2 A;  5F2B A;  3T6L A;  1RST B;  4Z2V A;  2RTH B;  4GJS A;  3WZQ A;  1SWB A;  2IZE B;  1SWU A;  2RTJ A;  3WYP A;  1MEP A;  1SWP A;  1HQQ A;  1VWF B;  1NDJ A;  1SWJ A;  3VHI A;  1STP A;  2WPU A;  1AVD A;  1N4J A;  3EW1 A;  1SWR A;  2IZD B;  4Z2P A;  1SWL A;  1Y53 X;  1KL4 A;  1KFF A;  2IZB A;  2Y32 A;  1HXL A;  1VWQ B;  4Y59 A;  1LCW A;  1SWA A;  2RTK A;  4BCS A;  1LDQ A;  2C1S A;  1WBI A;  1N9M A;  1LEL A;  1SWS A;  1SWN A;  3MM0 A;  1VWJ B;  3RE5 A;  1VWK B;  1LDO A;  2RTD B;  1NBX A;  5L3Y A;  4OKA A;  1KL5 A;  1NQN A;  4IRW A;  1SRJ A;  1STR B;  2FHN X;  1KL3 A;  1PTS A;  3VGW A;  2UZ2 A;  2OF9 A;  5K67 A;  3RDM A;  4BX5 B;  2UYW A;  2C4I A;  1HXZ A;  1NC9 A;  1IJ8 A;  1VWA B;  4BX5 A;  2RTL A;  4CPH B;  5IRA A;  3X00 A;  2BC3 A;  2IZL B;  2IZJ A;  2RTA A;  5JD2 A;  3WZN A;  5B5G A;  4JNJ A;  2RTI B;  1VWL B;  2RTP B;  1SWD A;  1VWP B;  5IRW A;  4I60 A;  3RDX A;  1VWN B;  3WZP A;  1SLE B;  1STS B;  1VWM B;  2RTO B;  1RAV A;  4CPI A;  4BJ8 A;  1VWG B;  1NQM A;  3SZJ A;  4GGR A;  1VWR B;  3RY2 A;  2RTQ B;  2AVI A;  2F01 A;  1SRG A;  1MOY A;  1HY2 A; 
#chains in the Genus database with same CATH topology
 2OYB O;  2KD2 A;  2AT3 X;  4AZN A;  4TQ2 A;  4M7M A;  3FEP A;  3FR4 A;  4YDB A;  3SLJ A;  5BYP A;  1N0S A;  1PBO A;  3Q6L A;  4XMF A;  4AZM A;  3PQS A;  4KT5 A;  2L67 A;  5K06 A;  3BY0 A;  4OEL A;  4YFR A;  5AQ6 A;  3ZW1 A;  1I04 A;  5KHP A;  1FE3 A;  1LUQ A;  3C77 X;  3FDC A;  3T2W A;  2R56 A;  2Y3F A;  3FID A;  4Z27 A;  4QQ1 A;  2AKQ A;  1AEL A;  3FA7 A;  4ORR A;  2PI3 O;  4CPF A;  3NBX X;  3NQ9 A;  2KTD A;  1BRQ A;  1SWC A;  3NX1 A;  5D47 A;  2BS5 A;  5AJB A;  2FT9 A;  4AZO A;  2X8S A;  3VG3 A;  1I9H A;  2OY8 A;  3O19 A;  3PH5 A;  4Y0S A;  1CRB A;  4GDA A;  2OFR X;  4A1H A;  4BOE A;  5HCC C;  2MO5 A;  1ZNH A;  3MVF A;  4BX6 B;  3P24 A;  3RDS A;  1OBP A;  1YIV A;  3WJG A;  1AQB A;  1SXY A;  2ACP X;  2LB6 A;  3WVM A;  4EKV A;  1OPB A;  4CV7 A;  2IZA A;  1GT4 A;  2ZSC A;  3PEC A;  3VHH A;  2OFA A;  3FR5 A;  1OEJ A;  1RXK A;  4GJV A;  4ORX A;  2LBA A;  4ORY A;  3RZY A;  4A8Z A;  1RBP A;  1Y52 X;  1ZNE A;  5CE4 A;  4BBO A;  4EEJ A;  1LCV A;  2RTM A;  1LCZ A;  1OEK A;  1BRP A;  1SRH A;  2R74 A;  5DPQ A;  3NR3 A;  2CBR A;  2ANS A;  1LIE A;  4DQ4 A;  2G79 A;  2I5Z O;  1SRF A;  1P6P A;  3BX7 A;  1JJX A;  4U8U O;  3P02 A;  5HBS A;  2JU3 A;  3EMM A;  1LID A;  1RXH A;  1GXA A;  3GE2 A;  3PH6 A;  4N7D A;  4BVM A;  4C5P A;  4LZV A;  1RSU B;  4ZGF A;  4I9S A;  1A18 A;  1TOU A;  2FS6 A;  4NLI A;  5EED A;  4AZR A;  1MK5 A;  2MF6 A;  3B2I A;  4KCA A;  4LZU A;  4MVL A;  4YGH A;  4IAB A;  4QYN A;  5D48 A;  4MVK A;  2F09 A;  3ZI8 A;  4CDE A;  2JOZ A;  5L8O A;  1KQX A;  4D6A A;  2IZE B;  1SWU A;  2HYS A;  1SWP A;  1DZK A;  1R0U A;  1HQQ A;  1VWF B;  1SWJ A;  1S2P A;  1EPB A;  2E4J A;  2MJI A;  2RD7 C;  4AZP A;  2WPU A;  1MUP A;  4TLJ A;  4NNT A;  4HPC A;  1SWR A;  2IZD B;  4ZJ0 A;  1EQD A;  1SXX A;  5D4A A;  3PDF A;  4IAW A;  2X56 A;  3TGB A;  2Y32 A;  1VWQ B;  4IB8 A;  3F8A A;  5F6Z A;  5FQ7 E;  1B56 A;  1UYN X;  2OY7 A;  2X46 A;  4BCS A;  1LKE A;  1N9M A;  4L3R A;  1KT3 A;  1SWS A;  3SLT A;  3P6H A;  1LDO A;  5HAE A;  4EQA C;  3NP1 A;  4O4X A;  2A13 A;  1H91 A;  1A2D A;  1FEM A;  1ADL A;  1KL5 A;  1NQN A;  1STR B;  2AT0 X;  2WR6 A;  3EC5 A;  1PTS A;  4I3B A;  1A57 A;  1GX3 A;  5K67 A;  4EXZ A;  2WQA E;  1HQP A;  1G85 A;  2IFB A;  4DQ3 A;  4GET A;  4GDZ A;  4BX5 A;  2RTL A;  5FAZ A;  3ZW1 B;  1ACD A;  1OPA A;  2MM3 A;  3X00 A;  4NNS A;  4MVI A;  2AT8 X;  2IZL B;  4ZHH A;  3FEK A;  3BLG A;  4YCH A;  1LPJ A;  2L5P A;  3L4R A;  5B5G A;  4JNJ A;  2RCT A;  4ZHF A;  2RTI B;  2RTP B;  1SWD A;  2NP1 A;  1OSP O;  3D97 A;  5BVQ A;  1FEL A;  3BU9 A;  2RTO B;  1STS B;  4U8U N;  4OS0 A;  2OZQ A;  1RAV A;  1YWC A;  1ALB A;  2ZAG A;  4RUU A;  2VFB A;  4PJ2 A;  3WBG A;  4BJ8 A;  1NQM A;  4NLJ A;  1QFT A;  4GGR A;  1VWR B;  5L8I A;  2A2G A;  3RY2 A;  2AVI A;  4MEE A;  1B8E A;  1SRG A;  1FEN A;  3BX8 A;  4KC7 A;  1D2U A;  4EDE A;  1DFV A;  4NW4 A;  4FQB B;  1SRE A;  2FLJ A;  5L8N A;  3U0D A;  4YMY A;  2OL6 O;  4IBA A;  1MM9 A;  3VG4 A;  1Y0G A;  2L68 A;  1DZM A;  4MVE A;  1VWI B;  1KZW A;  1BBP A;  3KZA A;  4YBP A;  4BX7 A;  2QCB A;  5FFH A;  2N93 A;  2CM4 A;  2IZG B;  4CPH A;  2IZF B;  1VWB B;  5C0N A;  2K23 A;  4XMC A;  1HBQ A;  1EAL A;  4GGZ A;  4O3X B;  3C78 X;  1VWE B;  1DF3 A;  4NP1 A;  4O4O A;  3TGA A;  2KT4 B;  1EPA A;  5F7G A;  2ASN X;  4ORS A;  1BM5 A;  3H3I A;  2ACO A;  5B5F A;  1O8V A;  2VDF A;  3RY1 A;  4Y0Q A;  3TF6 A;  2L9C A;  1YWB A;  2YG2 A;  3B2J A;  5HCD C;  5EEE A;  1VYG A;  4QRL A;  2RTE B;  3HWD A;  4IMO A;  4Y5D A;  2FTB A;  1TXL A;  2IZI A;  1GT1 A;  1ICN A;  1GT5 A;  3B2L A;  3VU1 A;  5LKF A;  2A5C A;  4WHI A;  4O49 A;  1IIU A;  4Y0P A;  1VYO A;  4KC8 A;  1SWG A;  3OD9 A;  2A3F X;  3KFG A;  4M6S A;  5LJK A;  4GGT A;  3JQO A;  3CQR A;  5K68 A;  4GE1 A;  4QGV A;  2Q39 A;  1DF8 A;  4GD9 A;  3ELX A;  2CZU A;  1ML7 A;  1QY0 A;  1EW3 A;  2GTF X;  3ELZ A;  1SLF B;  1ZRY A;  1X8U A;  3ZW0 A;  2GTL O;  1RXJ A;  1BSQ A;  1LIF A;  2LFO A;  3T6F A;  2IZC B;  4O3Y A;  1JV4 A;  2X32 A;  2A5B A;  3APX A;  3PQU A;  2POA A;  4JHQ A;  3D4R A;  4ZFX A;  4O9S A;  3P6E A;  4YFP A;  3SAO A;  3O2Y A;  1YP6 A;  1YUP A;  2GJ5 A;  4JGL A;  3CMP A;  5D45 A;  2X55 A;  4UU3 A;  3STM X;  1OBQ A;  3RDO A;  1KZX A;  2AL0 X;  1IW2 A;  1HMS A;  4YVB A;  5AEO A;  4ZHG A;  5HZ8 A;  1GGL A;  1EI5 A;  4ALO A;  1BJ7 A;  2RQ0 A;  3PK2 A;  3T6L A;  2OY1 O;  3FW4 A;  4TKJ A;  2RTH B;  4Z2V A;  4YFQ A;  1SWB A;  2FKJ A;  1GKA A;  3WYP A;  1T68 X;  1MEP A;  2X34 A;  4FBV A;  3VHI A;  1X8Q A;  2W2A A;  1STP A;  2OFM X;  3BDR A;  3HOL A;  1G5W A;  1N4J A;  5HA0 A;  4U9C A;  4ZGU A;  1URE A;  2JW1 A;  1X8O A;  2QOM A;  1JBH A;  3HWG A;  3FR2 A;  2FS7 A;  2IZB A;  4QAE A;  1LCW A;  2OVS A;  2QM9 A;  2HLV A;  1LDQ A;  2C1S A;  2RN4 A;  5EZ2 A;  1SY0 A;  1LEL A;  1ICM A;  5LJG A;  1PEE A;  3MM0 A;  4FBO A;  1HN2 A;  2FRS A;  4YBU A;  3AEH A;  2OVD A;  2CZT A;  4HFO A;  4XME A;  5EDC A;  4LQZ A;  1NP4 A;  3BS2 A;  3BSZ E;  3D96 A;  1SA8 A;  1IKJ A;  2UZ2 A;  1TOW A;  2HNX A;  1HXZ A;  1NC9 A;  1PMP A;  4LKT A;  1CBS A;  1IFB A;  3KFF A;  5HA1 A;  2X8T A;  3VG2 A;  1EUO A;  4CPH B;  4BQU A;  2IZJ A;  3APW A;  2JU8 A;  2RTA A;  5HTE A;  1DZP A;  3BRN A;  3EYC A;  3KFH A;  3NX2 A;  4GKC A;  2GTL N;  5JD2 A;  3TZS A;  4B55 A;  2HKD A;  3CR6 A;  3ZQ3 A;  2W2B A;  3FA9 A;  1U0X A;  2XST A;  3P6F A;  1EII A;  3QKG A;  4I60 A;  3AKN A;  3OBL A;  4PSQ A;  3D95 A;  1GM6 A;  1VWN B;  1SLE B;  5LJC A;  1JIW I;  3P6D A;  5EPQ A;  3S60 A;  4OMX A;  3T1D A;  1ZNG A;  1VYF A;  1ZNL A;  2G8C O;  1WUB A;  2WWP A;  3FLL A;  1UYO X;  1TW4 A;  4ORU A;  3FYF A;  4GNY A;  4CPI A;  3KFI A;  1FDQ A;  2HZQ A;  3STK A;  5DG4 A;  2WQ9 A;  1KT7 A;  1LIC A;  5H9N A;  2AT5 X;  2RTQ B;  2WUT A;  2F01 A;  1S7D A;  1MOY A;  3JSQ A;  1FTP A;  5F58 A;  5IRU A;  1SWK A;  4YDA A;  3ZW2 A;  1Y9T A;  2BS6 A;  3WJC A;  1NP1 A;  2JU7 A;  5B2A O;  5HZ5 A;  2QOS C;  2LA7 A;  2X4M A;  2OVA A;  4YH0 A;  2JMB A;  1VWD B;  3FIQ A;  3TGC A;  5CHK A;  3I17 A;  3STN A;  1YP7 A;  1N7Y A;  3OE3 A;  4YGG A;  3VPJ E;  1MVG A;  1BEB A;  3MG5 A;  3VE1 A;  3S5V A;  4OS8 A;  4CPE A;  4ORW A;  5CSE A;  4ON1 A;  5KID A;  5LJB A;  1W6F A;  4KII A;  5LJH A;  3WZO A;  4XMH A;  4CK4 A;  1EXS A;  4U8U M;  5D8J A;  1KT4 A;  4ZCB A;  5BVS A;  5H9A A;  3O22 A;  1L6M A;  1VWC B;  1Z24 A;  4O3W A;  5HCE C;  1GKA B;  1SY1 A;  2YMS A;  4UU2 A;  4HPD A;  3WJB A;  2F73 A;  3WYQ A;  4BX6 A;  1QFV A;  1X8N A;  2FGS A;  4O3Z A;  1K24 A;  1N9Y A;  1SLD B;  3SZI A;  4HPA A;  4OMW A;  2NNQ A;  4AYH A;  3FEN A;  2RCQ A;  2RTC B;  2OFB A;  2OF8 A;  3S5X A;  1YWD A;  3HWE A;  4GK9 A;  3AKM A;  1SWO A;  1U18 A;  1X89 A;  3GAQ A;  5B29 A;  5B11 O;  2CBS A;  3RE6 A;  1QY2 A;  3RDQ A;  3CWK A;  1VWO B;  1SWT A;  1JZU A;  3CBS A;  3HWF A;  4MIR A;  2P8G A;  3B2K A;  3ZUI A;  4ML7 B;  3B2H A;  2FHL A;  1VWH B;  4COT A;  3EM0 A;  2G7B A;  2I5V O;  1JYD A;  3UEW A;  1QAB E;  2X45 A;  1SWH A;  3NQ3 A;  4QYP A;  5F2B A;  3UEX A;  1HMR A;  3RWX A;  2RTJ A;  3CKF A;  4GUZ A;  2Z4I A;  3RKG A;  1NDJ A;  2KTS A;  2FWV A;  3EW1 A;  3FA8 A;  3E3C A;  2DM5 A;  1BWY A;  4Z2P A;  3CBC A;  1Y53 X;  2AMM X;  1MX8 A;  3C76 X;  1RLB E;  1QQS A;  3FMZ A;  1KL4 A;  1KFF A;  1HXL A;  4Y59 A;  2QO5 A;  1SWA A;  1BSO A;  5LJE A;  4GRJ A;  1O1U A;  4YCE A;  2QMI A;  1WBI A;  5IO7 A;  1PBY A;  3DTQ A;  3OJY C;  1MX7 A;  1SWN A;  3FA6 A;  1VWJ B;  4OS3 A;  4ID2 A;  3RE5 A;  2NND A;  3SOT A;  2DJG A;  3CQN A;  5IO5 A;  3PPT A;  4A1Y A;  5HWZ A;  1S44 A;  3MBT A;  5L3Y A;  1I06 A;  2GC9 A;  3ZUO A;  2FHN X;  2W2F A;  5AJC A;  3HTY A;  2HMB A;  2MHD A;  4XMD A;  3RDM A;  4BX5 B;  4DCB A;  1BLR A;  1CBI A;  1IJ8 A;  2Q9S A;  5BVT A;  4FGI B;  4HWM A;  1E06 A;  5IRA A;  2BC3 A;  1U17 A;  3I0A A;  2NNE A;  4I3C A;  2AF5 A;  4YKO A;  2AT6 X;  1PM1 X;  3K3L A;  4I9R A;  1HBP A;  1JQP A;  1VWL B;  1X71 A;  1KQW A;  4NV8 A;  5FQ8 E;  5JR8 A;  1CBR A;  1LNM A;  2MWH A;  5IRW A;  1I78 A;  1KXO A;  3WZP A;  3APV A;  1E00 A;  2OL7 A;  4O4S A;  5B27 A;  1Y9L A;  3SZJ A;  2BSZ A;  2Q4N A;  4U3Q A;  1FJ1 E;  3AUM O;  3N91 A;  3VG5 A;  1XKI A;  4BGF A;  5LJD A;  4NYR A;  2BHV A;  4D6B A;  4QZU A;  1KT6 A;  2RTN B;  3G7X A;  3PED A;  4BX7 B;  5HZ9 A;  3FW5 A;  5H9L A;  1IKE A;  4EFG A;  2PY1 A;  2Q2P A;  4HPB A;  1T0V A;  3F6Z B;  4Z6J A;  3ZZV A;  3UEU A;  3EBW A;  2A8G A;  4IB6 A;  1ERX A;  3NQK A;  1SMP I;  2JGS A;  4MIS A;  5F6B A;  4Z28 A;  3VG6 A;  2RTB B;  1LFO A;  3T2X A;  1SWQ A;  2KW1 A;  2RTR B;  3HOE A;  1EIO A;  2GTL M;  4QZT A;  1NGL A;  1DZJ A;  2RA6 A;  1G7N A;  4ZHD A;  1SXU A;  1W5R A;  2WEX A;  4YGZ A;  5CYB A;  1AVE A;  3UEV A;  2ALL X;  4AZQ A;  4CDC A;  3NAD A;  3PP6 A;  1W4T A;  2CAM A;  1GT3 A;  2QO4 A;  4TNN A;  1B4M A;  3RDU A;  2RTG B;  1E02 A;  1SWE A;  2BT9 A;  5H8T A;  1LIB A;  4WFV A;  1JYJ A;  1JJU A;  3APU A;  4N7C A;  1K3B A;  4YKM A;  5KIC A;  1KGL A;  4FBR A;  3P6G A;  1SWF A;  4OEM A;  4ZH9 A;  3CKG A;  4U46 A;  1SRI A;  2G5L A;  1AVG I;  2GH7 A;  1QY1 A;  2IZK A;  1ERB A;  3DSZ A;  3P6C A;  1HMT A;  4GU8 A;  4JO6 A;  3VG7 A;  4TKH A;  2FR3 A;  3WOV A;  3LV4 A;  5B10 O;  3ZWE A;  2RTF B;  2Y3E A;  2BLG A;  3QQ2 A;  4TKB A;  3IFB A;  1SY3 A;  3SZH A;  3ZW0 B;  3VHM A;  2FKG A;  4CDD A;  2VFC A;  1Y55 X;  5F1E A;  1TVQ A;  1ZNK A;  4ZHC A;  2A0A A;  3EW2 A;  1JJJ A;  2AH7 X;  3F9D A;  2IZH B;  4IB9 A;  4LKP A;  3FEL A;  4IMN A;  4ES7 A;  4Z2O A;  5IO6 A;  1SLG B;  4XMG A;  4AW8 A;  5B3M O;  2EU7 X;  2A2U A;  2JN3 A;  4O4U A;  4KH8 A;  5IXG A;  1X8P A;  1VPR A;  1GX9 A;  4GH7 A;  1I4U A;  1N43 A;  2C1Q A;  2R73 A;  4DNE A;  5HZ6 A;  4QNI A;  3HPE A;  3V8U A;  2Z4H A;  1RST B;  3UAQ A;  4GJS A;  3WJE A;  1A3Y A;  3WZQ A;  4CSB A;  3KVN A;  2FR2 A;  5HTD A;  2OVE A;  3LTW A;  4ODD A;  4L1N A;  5EDB A;  1AVD A;  1KT5 A;  1SY2 A;  1T8V A;  4TJZ A;  4ARH A;  1UZ2 X;  4I95 A;  2OL8 O;  3D9W A;  1SWL A;  5FQ6 E;  1B0O A;  3S26 A;  4R0B A;  3MX7 A;  3NPO A;  2LBV A;  1SXW A;  2RTK A;  5LKE A;  3BU1 A;  2HZR A;  3Q34 A;  3WJD A;  1E5P A;  2G78 A;  3WJF A;  4RUN A;  4CDF A;  1OBU A;  4QGX A;  1VWK B;  2DJF A;  2RTD B;  1NBX A;  1GX8 A;  3VE2 A;  1I05 A;  3IA8 A;  3KQ0 A;  4OKA A;  2ZAI A;  1AB0 A;  4IRW A;  1SRJ A;  4WFU A;  5H9K A;  1KL3 A;  4GZV A;  2OY5 O;  3VGW A;  2M4L A;  2OF9 A;  3RBY A;  3LHN A;  2UYW A;  2C4I A;  1MDC A;  1YWA A;  1VWA B;  1JMZ A;  2WSJ A;  3EBK A;  3HK1 A;  3WXQ A;  4A60 A;  2CM9 A;  4GNW A;  1QG5 A;  1OEE A;  5FEN A;  4IAX A;  2K62 A;  1KOI A;  4ALB A;  4I3D A;  2QO6 A;  2Q2M A;  3WZN A;  2LKK A;  4Y0R A;  1VWP B;  4ZH6 A;  1LF7 A;  1CJ5 A;  3RDX A;  1CBQ A;  4INN A;  4ZR2 A;  1VWM B;  2O62 A;  5HZQ A;  3RSW A;  4NV7 A;  2XKL A;  1D3S A;  4WBK A;  1E2T A;  1QWD A;  1ZND A;  4K19 A;  1BSY A;  4I6S A;  1VWG B;  3JS1 A;  2WEW A;  4NYQ A;  2X8F A;  1JMX A;  1O1V A;  3U03 A;  4QGW A;  3U9P C;  4IB7 A;  1G74 A;  1DV9 A;  3SLO A;  1XCA A;  1IFC A;  1DC9 A;  1HY2 A; 
#chains in the Genus database with same CATH homology
 1SRE A;  1SWK A;  1MM9 A;  2RTN B;  4BX7 B;  1VWI B;  4BX7 A;  2QCB A;  4Z6J A;  2IZG B;  4CPH A;  1VWD B;  1VWB B;  2A8G A;  2IZF B;  5CHK A;  1LUQ A;  4GGZ A;  2JGS A;  1N7Y A;  3FDC A;  3T2W A;  1VWE B;  4Z28 A;  2Y3F A;  2RTB B;  4Z27 A;  3T2X A;  1SWQ A;  2RTR B;  3MG5 A;  4CPF A;  4CPE A;  1SWC A;  5CSE A;  5B5F A;  1AVE A;  3RY1 A;  1I9H A;  3WZO A;  2CAM A;  4GDA A;  2RTG B;  2RTE B;  1SWE A;  4Y5D A;  3RDU A;  2IZI A;  1VWC B;  4BX6 B;  2A5C A;  3RDS A;  3WYQ A;  1SWF A;  4BX6 A;  4U46 A;  1SRI A;  1VYO A;  1SWG A;  2G5L A;  2GH7 A;  2IZK A;  4JO6 A;  4EKV A;  2IZA A;  1N9Y A;  4GGT A;  1SLD B;  2ZSC A;  5IRU A;  5K68 A;  3SZI A;  3VHH A;  2RTF B;  2Y3E A;  2OFA A;  1DF8 A;  1RXK A;  2RTC B;  4GD9 A;  4GJV A;  3SZH A;  2OFB A;  2OF8 A;  1Y52 X;  3VHM A;  1SLF B;  1Y55 X;  4BBO A;  1LCV A;  1SWO A;  2RTM A;  1LCZ A;  1RXJ A;  3EW2 A;  1SRH A;  3RE6 A;  2IZH B;  3T6F A;  2IZC B;  4Z2O A;  3RDQ A;  1SLG B;  2A5B A;  4JHQ A;  1SRF A;  1VWO B;  1SWT A;  3RDO A;  1RXH A;  2C1Q A;  1N43 A;  4DNE A;  2FHL A;  1VWH B;  1RSU B;  4YVB A;  1MK5 A;  2MF6 A;  1SWH A;  3PK2 A;  5F2B A;  3T6L A;  1RST B;  4Z2V A;  2RTH B;  4GJS A;  3WZQ A;  1SWB A;  2IZE B;  1SWU A;  2RTJ A;  3WYP A;  1MEP A;  1SWP A;  1HQQ A;  1VWF B;  1NDJ A;  1SWJ A;  3VHI A;  1STP A;  2WPU A;  1AVD A;  1N4J A;  3EW1 A;  1SWR A;  2IZD B;  4Z2P A;  1SWL A;  1Y53 X;  1KL4 A;  1KFF A;  2IZB A;  2Y32 A;  1HXL A;  1VWQ B;  4Y59 A;  1LCW A;  1SWA A;  2RTK A;  4BCS A;  1LDQ A;  2C1S A;  1WBI A;  1N9M A;  1LEL A;  1SWS A;  1SWN A;  3MM0 A;  1VWJ B;  3RE5 A;  1VWK B;  1LDO A;  2RTD B;  1NBX A;  5L3Y A;  4OKA A;  1KL5 A;  1NQN A;  4IRW A;  1SRJ A;  1STR B;  2FHN X;  1KL3 A;  1PTS A;  3VGW A;  2UZ2 A;  2OF9 A;  5K67 A;  3RDM A;  4BX5 B;  2UYW A;  2C4I A;  1HXZ A;  1NC9 A;  1IJ8 A;  1VWA B;  4BX5 A;  2RTL A;  4CPH B;  5IRA A;  3X00 A;  2BC3 A;  2IZL B;  2IZJ A;  2RTA A;  5JD2 A;  3WZN A;  5B5G A;  4JNJ A;  2RTI B;  1VWL B;  2RTP B;  1SWD A;  1VWP B;  5IRW A;  4I60 A;  3RDX A;  1VWN B;  3WZP A;  1SLE B;  1STS B;  1VWM B;  2RTO B;  1RAV A;  4CPI A;  4BJ8 A;  1VWG B;  1NQM A;  3SZJ A;  4GGR A;  1VWR B;  3RY2 A;  2RTQ B;  2AVI A;  2F01 A;  1SRG A;  1MOY A;  1HY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...