4TJZA

The 0.87 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with capric acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
b'MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, heart
publication title Water-mediated recognition of simple alkyl chains by heart-type Fatty-Acid-binding protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tjzA00
3P6FA 3EBKA 4A1HA 1IKEA 5BVSA 1U0XA 4M6SA 3VG4A 1DFVA 1JYDA 3CQRA 2ALLX 3PP6A 3CBCA 5C0NA 1QY1A 5KICA 2JN3A 4XMDA 4D6BA 1AB0A 1DZKA 1XKIA 1S2PA 1LIDA 4QYNA 2KT4B 1RBPA 2L5PA 2POAA 1X8NA 1ZRYA 2AKQA 2O62A 1ERXA 1ZNDA 2JU7A 4MVIA 1X8QA 3FR2A 3FLLA 1ALBA 5HZ8A 1SY1A 2Q4NA 3FENA 2MM3A 1TOUA 1JYJA 4LKTA 1I04A 4XMGA 3FMZA 1ZNGA 4HPDA 4IBAA 3BDRA 5IO5A 1A18A 3F9DA 3APVA 4YCHA 3RZYA 2A13A 1DF3A 3NX1A 3P6EA 3FA9A 4LZVA 4QGWA 4CK4A 3TZSA 3WJCA 2AT8X 5B29A 2JU8A 2W2FA 1AQBA 1OEJA 5EDCA 2FWVA 4OS3A 5DPQA 1FTPA 1NGLA 3B2JA 4YDAA 4IAWA 5LJKA 2NP1A 1SXXA 2WWPA 3F8AA 1KZWA 1I06A 1PBOA 4ARHA 1GT3A 4ORUA 2LFOA 1ICMA 3WJDA 2AT6X 4BQUA 3AKMA 3APXA 3K3LA 1HQPA 3BX7A 5D45A 3AKNA 3ELZA 1YWCA 1D3SA 2HZQA 1TOWA 4XMCA 4IMOA 1X89A 2Q9SA 4MVKA 4ZH9A 3T1DA 2RQ0A 2WEXA 3CR6A 3G7XA 4AZOA 3C76X 1JJJA 2XSTA 1KT6A 1GM6A 4PSQA 4QGVA 3O22A 2ASNX 3IFBA 4ORRA 3CBSA 4LZUA 4AZQA 3U03A 1I4UA 2FS7A 4RUNA 2FT9A 5HCDC 1EIOA 5LJEA 3KFGA 1BBPA 5LJGA 5LKFA 3STKA 1BSYA 5EZ2A 3U0DA 3D97A 5FFHA 4DQ3A 3L4RA 5LJDA 1VPRA 3EYCA 2CM9A 4WFVA 3STMX 2ACOA 4YFPA 4A60A 5EPQA 1TW4A 3JS1A 2OVAA 4NLIA 3EM0A 2GTFX 1SY3A 4R0BA 4ZJ0A 4N7DA 1T8VA 2HNXA 1YWBA 3BX8A 2K23A 3HWEA 3CMPA 1QG5A 5EEDA 4TQ2A 4OS0A 4GH7A 4XMHA 4Y0SA 5HBSA 4ORXA 1A57A 1KZXA 4BVMA 1Z24A 3HK1A 3KFFA 4TLJA 1E06A 1U17A 3FR4A 3I17A 1QABE 5EEEA 1LPJA 5K06A 2R73A 2W2AA 3NX2A 1LIFA 3P6HA 3OJYC 1T0VA 1YP6A 2FLJA 3FIQA 4GE1A 2G79A 4TJZA 1GT4A 5HCCC 3WJEA 2OZQA 2WQAE 3UEUA 5IO7A 2LB6A 1LNMA 4M7MA 4RUUA 2EU7X 1CJ5A 1OPAA 2G78A 3B2IA 5HA1A 2FS6A 4YGZA 4DQ4A 4OMWA 2OFRX 5KIDA 3GAQA 3DTQA 1FE3A 3FW5A 4AZPA 2HZRA 2KTDA 2X45A 4LKPA 1RLBE 4Y0RA 4OMXA 1JJXA 2AL0X 4YFQA 5HTEA 5LKEA 1OEKA 2JOZA 2AT5X 2HYSA 2GJ5A 2R56A 1O8VA 1CBIA 3STNA 3O2YA 3NPOA 1G74A 1MX7A 3O19A 1LKEA 4ES7A 5F6ZA 5KHPA 1GGLA 3PH6A 1OBUA 4AYHA 1GX9A 2RCQA 4YKMA 4GRJA 2A2GA 1LFOA 4XMFA 1PEEA 2AMMX 2IFBA 2LKKA 1UREA 4OS8A 3U9PC 1BWYA 4NNSA 1PMPA 1NP1A 4EDEA 1E5PA 3ZQ3A 3ELXA 4MVLA 4I9RA 3HWFA 5H9KA 1HN2A 4Y0PA 1IFBA 1OEEA 1EXSA 2P8GA 5H9AA 3WJBA 1GX8A 1KT7A 3WXQA 2NNEA 1B8EA 5EDBA 5F6BA 1OBQA 3BY0A 1BEBA 1SXYA 4YKOA 2AH7X 2WQ9A 3CQNA 1MDCA 1EALA 1S7DA 2A3FX 4GNYA 1U18A 1UZ2X 2G7BA 4ZHDA 4ZCBA 5L8NA 1E02A 3ZUIA 4IB7A 1A2DA 3VG5A 4TKBA 5F7GA 5B27A 2GC9A 2Q39A 1CBRA 2FR3A 2RCTA 4NLJA 2NNDA 4ZH6A 1QQSA 4ZGUA 2MO5A 3C78X 3WVMA 4WFUA 4EFGA 4I3DA 3UEXA 3BU1A 1YP7A 4YH0A 5HZ9A 4YGGA 1G5WA 4I3CA 4K19A 4AZNA 3VG3A 1KT5A 1R0UA 5LJHA 1LIEA 2CZTA 5HZQA 4ALBA 1SXWA 3C77X 5HWZA 1T68X 4IB8A 1FELA 3FA8A 3UEVA 3NQ3A 1KXOA 1YIVA 2CZUA 3WJGA 1EQDA 1JZUA 5D47A 3TGCA 3MVFA 4UU2A 1EUOA 5JR8A 5F58A 2OFMX 1HBQA 3PPTA 4I3BA 3PECA 2XKLA 4NYRA 2RA6A 1TVQA 4NNTA 3B2KA 1DZMA 1BSOA 4O9SA 1DC9A 4ODDA 1YUPA 4QGXA 3KQ0A 1OBPA 1L6MA 2WEWA 3NR3A 1CBSA 3IA8A 1SXUA 4A1YA 1KQWA 1G7NA 1FDQA 3TGBA 4IB6A 3FW4A 3FR5A 3BLGA 4N7CA 1NP4A 3CWKA 3BRNA 1QWDA 1KT3A 4TNNA 1JV4A 2MJIA 1B56A 1QY0A 1TXLA 5HA0A 2CBSA 3B2LA 4AZRA 3JSQA 5LJCA 3EMMA 2L68A 4NP1A 1ICNA 3RSWA 1CBQA 5IO6A 5HZ5A 4IMNA 1QY2A 1S44A 3PEDA 1LICA 2LBVA 4YBPA 3DSZA 4WBKA 5HCEC 1YWDA 3P6GA 1DV9A 1PM1X 4ZHCA 1QFVA 4EXZA 4TKHA 5D8JA 2F73A 2ACPX 4UU3A 1ADLA 2X46A 1N0SA 1B0OA 1VYFA 2QM9A 3P6CA 4IAXA 1DZPA 4KIIA 4GETA 1ZNLA 3TF6A 4YFRA 1SY2A 1VYGA 1E00A 1KGLA 2YG2A 2A0AA 4YGHA 2OVDA 4ORYA 3WJFA 1KT4A 1IW2A 4HFOA 4QZUA 1OPBA 1HBPA 3P6DA 4YDBA 3EBWA 1ZNKA 4BOEA 5CE4A 4HPBA 2AT0X 3BU9A 2QO6A 3FA6A 1AVGI 5FAZA 2WR6A 3KFHA 4QYPA 5HAEA 3FA7A 2AT3X 3UEWA 3FEKA 2A2UA 3APUA 1ACDA 1LIBA 5AQ6A 2L67A 3BS2A 1ERBA 1CRBA 2Q2PA 1GT1A 1O1VA 4EEJA 4ZFXA 2HLVA 5D48A 5D4AA 3NADA 5H8TA 1X8PA 1EPAA 3FEPA 1BRQA 4AW8A 5H9NA 5L8OA 1B4MA 2FRSA 3QKGA 4QAEA 5BVTA 1HMTA 3MBTA 2LBAA 3I0AA 2RD7C 1KOIA 3TGAA 1JBHA 4YCEA 1ZNEA 2QO4A 1BSQA 4ZHFA 4A8ZA 1IIUA 2N93A 2E4JA 3FELA 2PY1A 1X8UA 2ANSA 4XMEA 2NNQA 1FEMA 1XCAA 1GT5A 1SA8A 1BJ7A 2WSJA 2W2BA 3VG2A 1LF7A 1AELA 4ZR2A 3BSZE 3SAOA 5F1EA 1O1UA 3HWGA 3WBGA 1IKJA 1IFCA 1GKAA 3D96A 2Q2MA 4I9SA 1ZNHA 1A3YA 4ORWA 5H9LA 1X71A 2CBRA 4ALOA 2OVEA 2L9CA 1BRPA 5HZ6A 1GXAA 1QFTA 2JU3A 3NP1A 5L8IA 3APWA 3VG7A 4QZTA 3KZAA 1HMSA 3VG6A 2QOSC 1BM5A 4ZHHA 4HPCA 3D95A 1G85A 1KQXA 2R74A 3KFIA 3PH5A 4YBUA 1BLRA 2BLGA 1FENA 3B2HA 1DZJA 4GKCA 4ZHGA 1GKAB 2DM5A 1X8OA 4ORSA 1YWAA 3HWDA 1H91A 2QO5A 2K62A 2FR2A 5DG4A 2CM4A 4D6AA 1D2UA 1HMRA 1MUPA 3Q6LA 2WUTA 2HMBA 4Y0QA 1EIIA 5LJBA 5HTDA 5FENA 4GNWA 4TKJA 2FTBA 3NQ9A 1P6PA 1ML7A 4IB9A 4NYQA 1MVGA 1EW3A 1I05A 4AZMA 1SY0A 1MX8A 3ZUOA 4HPAA 1EPBA 3S26A 4YMYA 5BVQA
chains in the Genus database with same CATH superfamily
3P24A 1VWLB 3P6FA 3EBKA 1SLGB 1IKEA 4GU8A 2RTQB 1U0XA 4JO6A 4M6SA 5BVSA 1DFVA 1JYDA 1SWSA 2LA7A 3CQRA 3QQ2A 3VG4A 3T6FA 2ALLX 5CSEA 4OELA 3PP6A 1SRHA 2RTIB 3CBCA 5C0NA 1QY1A 1VWAB 2JN3A 4XMDA 5KICA 4D6BA 3T2WA 1WBIA 1AB0A 2GTLM 1DZKA 1PBYA 1XKIA 1VWCB 1S2PA 1STPA 1LIDA 4QYNA 3JQOA 2KT4B 1RBPA 5FQ7E 2L5PA 4BGFA 1X8NA 2O62A 1ZRYA 2AKQA 2POAA 4MVEA 2JW1A 1LCWA 1ERXA 1ZNDA 2JU7A 1SWOA 3CKFA 3FIDA 1X8QA 3FR2A 3FLLA 4MVIA 3GE2A 3EW2A 3T6LA 4CDDA 1ALBA 5HZ8A 1SY1A 1NC9A 4COTA 2Q4NA 3FENA 1SLDB 2MM3A 2RTRB 1TOUA 2X8TA 1JYJA 4LKTA 1GX3A 1I04A 2OVSA 3FMZA 4XMGA 1ZNGA 4Y59A 1VWKB 2RTDB 3BDRA 4HPDA 4IBAA 4CDCA 1A18A 3F9DA 1SRFA 1N4JA 1HXLA 1Y55X 3APVA 4U8UN 4YCHA 2KW1A 2A13A 3EW1A 3RZYA 4GJVA 3NX1A 3P6EA 1DF3A 3FA9A 4LZVA 4QGWA 4CK4A 3TZSA 3WJCA 2AT8X 5B29A 2JU8A 1OEJA 1AQBA 2W2FA 5EDCA 2FWVA 4KC7A 2IZFB 1FTPA 1NGLA 2ZSCA 1SRJA 4O4OA 4OS3A 4U46A 5DPQA 3B2JA 4YDAA 4IAWA 4BCSA 5LJKA 3ZW1A 2NP1A 1SXXA 2WWPA 5CYBA 3F8AA 4CPEA 4EQAC 1KZWA 1I06A 1PBOA 4ARHA 1GT3A 4ORUA 5HZ6A 2LFOA 1ICMA 3WJDA 2A5BA 2AT6X 4BQUA 3AKMA 3APXA 1RXHA 3K3LA 1HQPA 3BX7A 5D45A 3AKNA 4U3QA 5IO5A 3ELZA 1YWCA 2RN4A 1D3SA 2HZQA 1TOWA 4XMCA 4DNEA 1SWLA 4BX5B 2Y32A 4IMOA 3SZIA 1VWGB 1X89A 1SWEA 2Q9SA 4MVKA 4ZH9A 3T1DA 2RQ0A 2WEXA 3CR6A 3G7XA 4AZOA 3C76X 4B55A 1JJJA 2XSTA 1KT6A 3PQUA 4QRLA 1GM6A 2A8GA 1SWJA 4PSQA 4QGVA 1NQNA 3O22A 2RTFB 3WZQA 2ASNX 3IFBA 4ORRA 3CBSA 4LZUA 4AZQA 3U03A 1I4UA 2FS7A 4RUNA 2FT9A 5HCDC 4MISA 1EIOA 5LJEA 1Y9LA 3KFGA 1BBPA 5LJGA 1VWNB 2IZIA 5LKFA 3STKA 1BSYA 3HOEA 5EZ2A 2X8SA 3FDCA 2BSZA 3U0DA 3D97A 4HWMA 5FFHA 4C5PA 2G5LA 2IZGB 3L4RA 5LJDA 1VPRA 3SZHA 4DQ3A 2Y3EA 3EYCA 4CPHB 3VPJE 2WPUA 2CM9A 4WFVA 2ZAGA 3STMX 2ACOA 4YFPA 4ID2A 4O49A 3PK2A 5IRUA 2FGSA 1TW4A 3JS1A 5EPQA 2OVAA 4I6SA 4NLIA 4A60A 3EM0A 1SY3A 2GTFX 2IZEB 4R0BA 4DCBA 4ZJ0A 4N7DA 1T8VA 2HNXA 2RTHB 1YWBA 2RTLA 3BX8A 2K23A 3CKGA 1LUQA 3HWEA 1Y53X 3WYPA 2X32A 3CMPA 4ZHGA 4MEEA 1QG5A 5EEDA 1MOYA 2RTKA 4GUZA 4TQ2A 2OFAA 4OS0A 4GH7A 1PTSA 1NDJA 1NQMA 4OEMA 2X34A 4XMHA 4Y0SA 5HBSA 4ORXA 2IZBA 1A57A 1KZXA 4BVMA 1Z24A 3HK1A 3KFFA 4TLJA 1W4TA 5AJBA 5FQ6E 1RSUB 3N91A 4O3YA 1E06A 1U17A 2A5CA 3FR4A 1KL3A 1QABE 3I17A 4U8UO 5EEEA 1LPJA 4O3WA 2R73A 3RE5A 2W2AA 3NX2A 1LIFA 2M4LA 3P6HA 1VWFB 4GGRA 1HXZA 1T0VA 1YP6A 2FLJA 3FIQA 3OJYC 2G79A 4GE1A 4TJZA 1GT4A 5HCCC 3WJEA 2OZQA 2WQAE 3UEUA 5IO7A 2LB6A 1LNMA 4M7MA 4RUUA 2EU7X 3RY1A 3HOLA 1CJ5A 1OPAA 2G78A 3B2IA 3HTYA 5HA1A 1LCVA 2FS6A 4YGZA 4DQ4A 2BS6A 4OMWA 2OFRX 2MF6A 5KIDA 3GAQA 3DTQA 1FE3A 3VHHA 2I5ZO 3FW5A 4AZPA 2HZRA 2KTDA 2X45A 4LKPA 1RLBE 4Y0RA 4OMXA 1JJXA 1N43A 2AL0X 4YFQA 4FBVA 5HTEA 5LKEA 1OEKA 1SRIA 2JOZA 2AT5X 2HYSA 4O4SA 2GJ5A 5IXGA 2R56A 5AJCA 1VWOB 1O8VA 1CBIA 1RAVA 3O2YA 2OL7A 2ZAIA 1G74A 1MX7A 3NPOA 1LKEA 1VWRB 3O19A 4ES7A 4PJ2A 5F6ZA 5KHPA 1GGLA 3FYFA 4L3RA 3PH6A 1OBUA 2FKGA 4AYHA 1GX9A 2GTLN 2JMBA 2RCQA 4GRJA 2A2GA 4YKMA 3S5VA 4FGIB 1LFOA 2AVIA 4XMFA 1PEEA 3RDUA 3ZW0A 2AMMX 2IFBA 2LKKA 1UREA 4OS8A 3OBLA 1SWPA 3MG5A 3U9PC 3T2XA 1BWYA 1RXJA 2Y3FA 2BHVA 2Z4HA 3HPEA 1PMPA 1NP1A 3OD9A 4NNSA 4EDEA 1E5PA 3ZQ3A 3ELXA 4MVLA 4Z27A 4BJ8A 4I9RA 1SMPI 1LDQA 1MK5A 1UYOX 3HWFA 5H9KA 3SLTA 1HN2A 4Y0PA 4A1HA 4GGTA 1IFBA 1OEEA 4INNA 1EXSA 2P8GA 1KFFA 3RDQA 4O3ZA 2X56A 2IZLB 5H9AA 3WJBA 1EI5A 1GX8A 4U9CA 1KT7A 1JQPA 3SOTA 4CDFA 3WXQA 2NNEA 1B8EA 4I95A 1SWQA 5EDBA 5F6BA 1OBQA 3BY0A 1BEBA 2X55A 1SXYA 3P02A 4Z6JA 4YKOA 5B10O 3E3CA 2AH7X 3WZOA 3RDOA 1N7YA 2WQ9A 1MDCA 3CQNA 4CV7A 1EALA 1S7DA 2A3FX 2OL6O 1LELA 1U18A 1UZ2X 2G7BA 4GNYA 4ZHDA 2F01A 4ZCBA 4MIRA 4CSBA 5L8NA 1E02A 1KL5A 3ZUIA 4IB7A 1A2DA 3VG5A 4TKBA 1UYNX 5F7GA 5B5FA 5B27A 3ZW1B 2GC9A 3PQSA 2Q39A 1CBRA 2FR3A 1AVDA 2RCTA 4NLJA 2NNDA 4ZH6A 1QQSA 4Z2VA 2MO5A 4ZGUA 3C78X 1DV9A 3ZW2A 4JNJA 3WVMA 4WFUA 2OF8A 4I3DA 3ZZVA 4EFGA 3UEXA 4QQ1A 3BU1A 2F09A 1YP7A 4YH0A 5HZ9A 4YGGA 1KL4A 4I3CA 1SWTA 1G5WA 2IZCB 1JMXA 4K19A 4AZNA 3VG3A 1KT5A 1NBXA 1R0UA 4I60A 5LJHA 1LIEA 2CZTA 5HZQA 4ALBA 2CAMA 1SXWA 3C77X 5HWZA 3LTWA 1T68X 1W5RA 4IB8A 2QMIA 1FELA 2OY1O 3FA8A 3UEVA 3NQ3A 1KXOA 5CHKA 2RTOB 1YIVA 2CZUA 3WJGA 3RWXA 2OY5O 4GKCA 1OSPO 3SLOA 1EQDA 3RE6A 1JZUA 5D47A 1HQQA 3TGCA 3MVFA 2KD2A 1EUOA 4UU2A 5IRAA 5JR8A 5F58A 1SWFA 2OFMX 1HBQA 3PPTA 4I3BA 3VE1A 3PECA 2KTSA 2XKLA 4NYRA 2IZDB 2RA6A 5BYPA 4KT5A 1TVQA 3NQKA 4NNTA 1DF8A 2GTLO 5K68A 2BS5A 2IZAA 3B2KA 1DZMA 3STNA 1BSOA 4O9SA 1DC9A 4ODDA 1YUPA 4QGXA 3KQ0A 1OBPA 1L6MA 2WEWA 3RBYA 3NR3A 2HKDA 1CBSA 4CDEA 1VWPB 1K3BA 1VWHB 3IA8A 1SXUA 4A1YA 1KQWA 2IZJA 3ZWEA 2GH7A 4GD9A 3VU1A 1G7NA 1FDQA 2C4IA 3RDMA 3TGBA 4IB6A 5B5GA 3FW4A 1AVEA 2QCBA 3X00A 2C1SA 3BLGA 3FR5A 2X4MA 4N7CA 1VWEB 1NP4A 3CWKA 4NV7A 3BRNA 1QWDA 1KT3A 1MM9A 2FHLA 3SZJA 3Q34A 4TNNA 1JV4A 1N9YA 1Y9TA 2MJIA 1B56A 4Y5DA 1SWHA 5FQ8E 1QY0A 1TXLA 2QOMA 5HA0A 2CBSA 4JHQA 1K24A 3B2LA 4KCAA 4FBRA 4AZRA 4IRWA 3JSQA 5LJCA 3EMMA 2L68A 4JGLA 4GDZA 4NP1A 3RDXA 1STRB 1ICNA 3RSWA 1CBQA 2RTBB 5IO6A 5HZ5A 3PDFA 4IMNA 1QY2A 2RTCB 1S44A 3PEDA 1LICA 2LBVA 4YBPA 5K67A 3DSZA 4WBKA 4O4UA 1YWDA 3P6GA 5HCEC 1PM1X 3KVNA 4ZHCA 1QFVA 4EXZA 1IJ8A 1FJ1E 4TKHA 5D8JA 2F73A 2ACPX 4UU3A 1ADLA 1RXKA 1N0SA 1B0OA 1Y0GA 2IZKA 1VYFA 2OFBA 2QM9A 2X46A 3MX7A 3P6CA 4IAXA 1DZPA 4KIIA 2BT9A 1VWIB 1HY2A 3AUMO 4GETA 1ZNLA 1SWUA 3TF6A 4YFRA 1SY2A 1VYGA 1E00A 1KGLA 1SWNA 2YG2A 2A0AA 4YGHA 2OVDA 4L1NA 4ORYA 1STSB 4U8UM 4ZHFA 3WJFA 4O3XB 1KT4A 2OL8O 1IW2A 4HFOA 4QZUA 4CPIA 1OPBA 1HBPA 3D9WA 2Z4IA 2G8CO 3P6DA 4YDBA 1SWCA 3EBWA 1LCZA 1ZNKA 4BOEA 5CE4A 4HPBA 2AT0X 3WZPA 1JIWI 3BU9A 2QO6A 3FA6A 5B11O 1AVGI 3RDSA 3EC5A 5FAZA 2WR6A 3KFHA 4QYPA 2RTMA 2C1QA 5JD2A 5HAEA 3FA7A 2VFCA 3ZW0B 2AT3X 3UEWA 3FEKA 2A2UA 3APUA 1ACDA 1LIBA 5AQ6A 2L67A 4KH8A 3BS2A 4BX5A 1ERBA 1CRBA 2Q2PA 1GT1A 1O1VA 1SLFB 1W6FA 2HLVA 2RTNB 4O4XA 5D48A 5D4AA 4EEJA 4Z2OA 3NADA 4ZFXA 5H8TA 1X8PA 1EPAA 2X8FA 2RTJA 3FEPA 1BRQA 1VYOA 4AW8A 1JMZA 5H9NA 5L8OA 1B4MA 1WUBA 3AEHA 3WYQA 2FRSA 2DJGA 2MWHA 3QKGA 4QAEA 1LDOA 1HMTA 3ZI8A 4BX6A 5BVTA 3UAQA 5K06A 3RKGA 3MBTA 2LBAA 3I0AA 2FHNX 2IZHB 2OF9A 2RTEB 4GZVA 4BBOA 1I9HA 2RD7C 1VWDB 3D4RA 1KOIA 3TGAA 1JBHA 4CPFA 4YCEA 3OE3A 2YMSA 1VWBB 1ZNEA 1BSQA 2QO4A 3V8UA 4A8ZA 1JJUA 1IIUA 3H3IA 2N93A 4GK9A 2E4JA 3FELA 2OY8A 2PY1A 1X8UA 2ANSA 4XMEA 3VE2A 4QNIA 2NNQA 1FEMA 3F6ZB 4CPHA 1SWKA 1GT5A 1XCAA 1I78A 2UYWA 1SA8A 1SWBA 4WHIA 1BJ7A 2WSJA 2W2BA 3VG2A 1LF7A 1AELA 4ZR2A 3VHIA 1SWGA 3BSZE 3SAOA 5F1EA 1O1UA 3HWGA 3WBGA 1IKJA 1IFCA 3WZNA 3RY2A 1GKAA 4BX6B 4LQZA 3D96A 2Q2MA 1E2TA 1SWDA 5F2BA 2OY7A 3MM0A 4I9SA 1ZNHA 1A3YA 4ORWA 1RSTB 4BX7A 2VDFA 1SREA 2RTGB 3NBXX 1VWQB 5H9LA 2FKJA 5L3YA 1X71A 2CBRA 4ALOA 2OVEA 2L9CA 1BRPA 2VFBA 4IABA 1GXAA 1QFTA 2JU3A 3NP1A 4ML7B 3APWA 5L8IA 3VG7A 4QZTA 3KZAA 4FQBB 4GDAA 3S60A 1HMSA 1MEPA 3VG6A 2QOSC 1Y52X 1BM5A 4ZHHA 4HPCA 3VHMA 3D95A 2OYBO 1G85A 1KQXA 2R74A 3KFIA 3PH5A 4YBUA 4ZGFA 1BLRA 2BLGA 1FENA 4NV8A 4GJSA 3B2HA 1DZJA 2PI3O 1SLEB 1GKAB 2BC3A 1X8OA 2DM5A 1YWAA 2UZ2A 3HWDA 4ORSA 1H91A 2QO5A 2K62A 2MHDA 4Z2PA 4EKVA 4NW4A 4YVBA 2FR2A 5DG4A 2AF5A 5IRWA 1VWMB 2CM4A 4D6AA 1D2UA 1HMRA 1MUPA 3Q6LA 4OKAA 4BX7B 5AEOA 2WUTA 2HMBA 4Y0QA 3S5XA 1EIIA 5LJBA 4GGZA 5FENA 5HTDA 4GNWA 4FBOA 3LHNA 4TKJA 1SRGA 3VGWA 2FTBA 3NQ9A 1P6PA 2RTPB 4Z28A 2RTAA 1ML7A 1N9MA 4IB9A 4KC8A 4NYQA 1MVGA 1SWRA 5B3MO 1EW3A 1I05A 3WOVA 4AZMA 2I5VO 3LV4A 1SY0A 2JGSA 1MX8A 5B2AO 3ZUOA 4HPAA 3SLJA 1VWJB 1SWAA 1EPBA 4ON1A 2DJFA 3S26A 4YMYA 5BVQA
chains in the Genus database with same CATH topology
3P24A 3P6FA 3EBKA 4GU8A 1IKEA 5BVSA 4A1HA 1U0XA 4M6SA 3VG4A 1DFVA 1JYDA 2LA7A 3CQRA 2ALLX 3PP6A 3CBCA 5C0NA 1QY1A 5KICA 2JN3A 4XMDA 4D6BA 1AB0A 2GTLM 1DZKA 1XKIA 1S2PA 1LIDA 4QYNA 3JQOA 2KT4B 1RBPA 5FQ7E 2L5PA 2POAA 1X8NA 1ZRYA 2AKQA 2O62A 4MVEA 2JW1A 1ERXA 1ZNDA 2JU7A 4MVIA 1X8QA 3FR2A 3FLLA 3GE2A 1ALBA 5HZ8A 1SY1A 4COTA 2Q4NA 3FENA 2MM3A 1TOUA 2X8TA 1JYJA 4LKTA 1I04A 2OVSA 3FMZA 4XMGA 1ZNGA 4HPDA 4IBAA 3BDRA 5IO5A 1A18A 3F9DA 4U8UN 3APVA 4YCHA 2KW1A 2A13A 3RZYA 1DF3A 3NX1A 3P6EA 3FA9A 4LZVA 4QGWA 4CK4A 3TZSA 3WJCA 2AT8X 5B29A 2JU8A 1OEJA 1AQBA 2W2FA 5EDCA 2FWVA 4KC7A 4OS3A 1FTPA 1NGLA 4O4OA 5DPQA 3B2JA 4YDAA 4IAWA 5LJKA 3ZW1A 2NP1A 1SXXA 2WWPA 5CYBA 3F8AA 4EQAC 1KZWA 1I06A 1PBOA 4ARHA 1GT3A 4ORUA 2LFOA 1ICMA 3WJDA 2AT6X 4BQUA 3AKMA 3APXA 3K3LA 1HQPA 3BX7A 5D45A 3AKNA 4U3QA 3ELZA 1YWCA 2RN4A 1D3SA 2HZQA 1TOWA 4XMCA 4IMOA 1X89A 2Q9SA 4MVKA 4ZH9A 3T1DA 2RQ0A 2WEXA 3CR6A 3G7XA 4AZOA 3C76X 1JJJA 2XSTA 1KT6A 3PQUA 4QRLA 1GM6A 4PSQA 4QGVA 3O22A 2ASNX 3IFBA 4ORRA 3CBSA 4LZUA 4AZQA 3U03A 1I4UA 2FS7A 4RUNA 2FT9A 5HCDC 4MISA 1EIOA 5LJEA 1Y9LA 3KFGA 1BBPA 5LJGA 5LKFA 3STKA 1BSYA 3HOEA 5EZ2A 2X8SA 3U0DA 3D97A 4HWMA 5FFHA 4DQ3A 3L4RA 5LJDA 1VPRA 3EYCA 3VPJE 2CM9A 4WFVA 2ZAGA 3STMX 2ACOA 4YFPA 4ID2A 4O49A 4A60A 5EPQA 1TW4A 3JS1A 2OVAA 4I6SA 4NLIA 3EM0A 2GTFX 1SY3A 4R0BA 4ZJ0A 4N7DA 1T8VA 2HNXA 1YWBA 3BX8A 2K23A 3HWEA 3CMPA 1QG5A 5EEDA 4TQ2A 4OS0A 4GH7A 4XMHA 4Y0SA 5HBSA 4ORXA 1A57A 1KZXA 4BVMA 1Z24A 3HK1A 3KFFA 4TLJA 5AJBA 5FQ6E 3N91A 4O3YA 1E06A 1U17A 3FR4A 3I17A 1QABE 4U8UO 5EEEA 1LPJA 4O3WA 2R73A 5K06A 2W2AA 3NX2A 1LIFA 2M4LA 3P6HA 3OJYC 1T0VA 1YP6A 2FLJA 3FIQA 4GE1A 2G79A 4TJZA 1GT4A 5HCCC 3WJEA 2OZQA 2WQAE 3UEUA 5IO7A 2LB6A 1LNMA 4M7MA 4RUUA 2EU7X 1CJ5A 3HOLA 1OPAA 2G78A 3B2IA 3HTYA 5HA1A 2FS6A 4YGZA 4DQ4A 2BS6A 4OMWA 2OFRX 5KIDA 3GAQA 3DTQA 1FE3A 3FW5A 4AZPA 2HZRA 2KTDA 2X45A 4LKPA 1RLBE 4Y0RA 4OMXA 1JJXA 2AL0X 4YFQA 4FBVA 5HTEA 5LKEA 1OEKA 2JOZA 2AT5X 2HYSA 4O4SA 2GJ5A 2R56A 5AJCA 1O8VA 1CBIA 3STNA 3O2YA 2ZAIA 1G74A 1MX7A 3NPOA 1LKEA 3O19A 4ES7A 4PJ2A 5F6ZA 5KHPA 1GGLA 3FYFA 4L3RA 3PH6A 1OBUA 4AYHA 1GX9A 2GTLN 2JMBA 2RCQA 4GRJA 2A2GA 4YKMA 3S5VA 4FGIB 1LFOA 4XMFA 1PEEA 3ZW0A 2AMMX 2IFBA 2LKKA 1UREA 4OS8A 3OBLA 3U9PC 1BWYA 2BHVA 2Z4HA 3OD9A 1PMPA 1NP1A 4NNSA 4EDEA 1E5PA 3ZQ3A 3ELXA 4MVLA 4I9RA 1SMPI 3HWFA 5H9KA 1HN2A 4Y0PA 4INNA 1IFBA 1OEEA 1EXSA 2P8GA 4O3ZA 5H9AA 3WJBA 1EI5A 1GX8A 4U9CA 1KT7A 3SOTA 3WXQA 2NNEA 1B8EA 4I95A 5EDBA 5F6BA 1OBQA 3BY0A 1BEBA 1SXYA 3P02A 4YKOA 2AH7X 3E3CA 2WQ9A 3CQNA 1MDCA 4CV7A 1EALA 1S7DA 2A3FX 4GNYA 1U18A 1UZ2X 2G7BA 4ZHDA 4ZCBA 4MIRA 4CSBA 5L8NA 1E02A 3ZUIA 4IB7A 1A2DA 3VG5A 4TKBA 5F7GA 5B27A 3ZW1B 2GC9A 3PQSA 2Q39A 1CBRA 2FR3A 2RCTA 4NLJA 2NNDA 4ZH6A 1QQSA 4ZGUA 2MO5A 3C78X 3ZW2A 3WVMA 4WFUA 3ZZVA 4I3DA 4EFGA 3UEXA 4QQ1A 3BU1A 2F09A 1YP7A 4YH0A 5HZ9A 4YGGA 1G5WA 4I3CA 4K19A 4AZNA 3VG3A 1KT5A 1R0UA 5LJHA 1LIEA 2CZTA 5HZQA 4ALBA 1SXWA 3C77X 5HWZA 1T68X 4IB8A 2QMIA 1FELA 3FA8A 3UEVA 3NQ3A 1KXOA 1YIVA 2CZUA 3WJGA 3RWXA 1EQDA 1JZUA 5D47A 3TGCA 3MVFA 2KD2A 1EUOA 4UU2A 5JR8A 5F58A 2OFMX 1HBQA 3PPTA 4I3BA 3VE1A 3PECA 2KTSA 2XKLA 4NYRA 2RA6A 5BYPA 4KT5A 1TVQA 3NQKA 4NNTA 2GTLO 2BS5A 3B2KA 1DZMA 1BSOA 4O9SA 1DC9A 4ODDA 1YUPA 4QGXA 3KQ0A 1OBPA 1L6MA 2WEWA 3RBYA 3NR3A 1CBSA 3IA8A 1SXUA 4A1YA 1KQWA 3ZWEA 3VU1A 1G7NA 1FDQA 3TGBA 4IB6A 3FW4A 3FR5A 3BLGA 4N7CA 1NP4A 3CWKA 3BRNA 1QWDA 1KT3A 4TNNA 1JV4A 1Y9TA 2MJIA 1B56A 5FQ8E 1QY0A 1TXLA 5HA0A 2CBSA 4KCAA 3B2LA 4FBRA 4AZRA 3JSQA 5LJCA 3EMMA 2L68A 4JGLA 4GDZA 4NP1A 1ICNA 3RSWA 1CBQA 5IO6A 5HZ5A 4IMNA 1QY2A 1S44A 3PEDA 1LICA 2LBVA 4YBPA 3DSZA 4WBKA 4O4UA 1YWDA 3P6GA 5HCEC 1PM1X 1DV9A 4ZHCA 1QFVA 4EXZA 4TKHA 5D8JA 2F73A 2ACPX 4UU3A 1ADLA 2X46A 1N0SA 1B0OA 1VYFA 2QM9A 3MX7A 3P6CA 4IAXA 1DZPA 4KIIA 2BT9A 4GETA 1ZNLA 3TF6A 4YFRA 1SY2A 1VYGA 1E00A 1KGLA 2YG2A 2A0AA 4YGHA 2OVDA 4L1NA 4ORYA 4U8UM 3WJFA 4O3XB 1KT4A 1IW2A 4HFOA 4QZUA 1OPBA 1HBPA 2Z4IA 3P6DA 4YDBA 3EBWA 1ZNKA 4BOEA 5CE4A 4HPBA 2AT0X 1JIWI 3BU9A 2QO6A 3FA6A 1AVGI 5FAZA 2WR6A 3KFHA 4QYPA 5HAEA 3FA7A 3ZW0B 2AT3X 3UEWA 3FEKA 2A2UA 3APUA 1ACDA 1LIBA 5AQ6A 2L67A 4KH8A 3BS2A 1ERBA 1CRBA 2Q2PA 1GT1A 1O1VA 4EEJA 4ZFXA 2HLVA 4O4XA 5D48A 5D4AA 3NADA 5H8TA 1X8PA 1EPAA 2X8FA 3FEPA 1BRQA 4AW8A 5H9NA 5L8OA 1B4MA 2FRSA 3QKGA 2MWHA 4QAEA 3ZI8A 1HMTA 5BVTA 3UAQA 3RKGA 3MBTA 2LBAA 3I0AA 4GZVA 2RD7C 3D4RA 1KOIA 3TGAA 1JBHA 4YCEA 3OE3A 2YMSA 1ZNEA 2QO4A 1BSQA 3V8UA 4ZHFA 4A8ZA 3H3IA 1IIUA 4GK9A 2N93A 2E4JA 3FELA 2PY1A 1X8UA 2ANSA 4XMEA 3VE2A 4QNIA 2NNQA 1FEMA 3F6ZB 1XCAA 1GT5A 1SA8A 4WHIA 1BJ7A 2WSJA 2W2BA 3VG2A 1LF7A 1AELA 4ZR2A 3BSZE 3SAOA 5F1EA 1O1UA 3HWGA 3WBGA 1IKJA 1IFCA 1GKAA 4LQZA 3D96A 2Q2MA 4I9SA 1ZNHA 1A3YA 4ORWA 3NBXX 5H9LA 1X71A 2CBRA 4ALOA 2OVEA 2L9CA 1BRPA 4IABA 5HZ6A 1GXAA 1QFTA 2JU3A 3NP1A 4ML7B 3APWA 5L8IA 3VG7A 4QZTA 3KZAA 4FQBB 3S60A 1HMSA 3VG6A 2QOSC 1BM5A 4ZHHA 4HPCA 3D95A 1G85A 1KQXA 2R74A 3KFIA 3PH5A 4YBUA 4ZGFA 1BLRA 2BLGA 1FENA 3B2HA 1DZJA 4GKCA 4ZHGA 1GKAB 2DM5A 1X8OA 4ORSA 1YWAA 3HWDA 1H91A 2QO5A 2K62A 2MHDA 4NW4A 2FR2A 5DG4A 2CM4A 4D6AA 1D2UA 1HMRA 1MUPA 3Q6LA 5AEOA 2WUTA 2HMBA 4Y0QA 3S5XA 1EIIA 5LJBA 5HTDA 5FENA 4GNWA 4FBOA 3LHNA 4TKJA 2FTBA 3NQ9A 1P6PA 1ML7A 4IB9A 4KC8A 4NYQA 1MVGA 1EW3A 1I05A 3WOVA 4AZMA 3LV4A 1SY0A 1MX8A 3ZUOA 4HPAA 1EPBA 4ON1A 3S26A 4YMYA 5BVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P6F A;  3EBK A;  4A1H A;  1IKE A;  5BVS A;  1U0X A;  4M6S A;  3VG4 A;  1DFV A;  1JYD A;  3CQR A;  2ALL X;  3PP6 A;  3CBC A;  5C0N A;  1QY1 A;  5KIC A;  2JN3 A;  4XMD A;  4D6B A;  1AB0 A;  1DZK A;  1XKI A;  1S2P A;  1LID A;  4QYN A;  2KT4 B;  1RBP A;  2L5P A;  2POA A;  1X8N A;  1ZRY A;  2AKQ A;  2O62 A;  1ERX A;  1ZND A;  2JU7 A;  4MVI A;  1X8Q A;  3FR2 A;  3FLL A;  1ALB A;  5HZ8 A;  1SY1 A;  2Q4N A;  3FEN A;  2MM3 A;  1TOU A;  1JYJ A;  4LKT A;  1I04 A;  4XMG A;  3FMZ A;  1ZNG A;  4HPD A;  4IBA A;  3BDR A;  5IO5 A;  1A18 A;  3F9D A;  3APV A;  4YCH A;  3RZY A;  2A13 A;  1DF3 A;  3NX1 A;  3P6E A;  3FA9 A;  4LZV A;  4QGW A;  4CK4 A;  3TZS A;  3WJC A;  2AT8 X;  5B29 A;  2JU8 A;  2W2F A;  1AQB A;  1OEJ A;  5EDC A;  2FWV A;  4OS3 A;  5DPQ A;  1FTP A;  1NGL A;  3B2J A;  4YDA A;  4IAW A;  5LJK A;  2NP1 A;  1SXX A;  2WWP A;  3F8A A;  1KZW A;  1I06 A;  1PBO A;  4ARH A;  1GT3 A;  4ORU A;  2LFO A;  1ICM A;  3WJD A;  2AT6 X;  4BQU A;  3AKM A;  3APX A;  3K3L A;  1HQP A;  3BX7 A;  5D45 A;  3AKN A;  3ELZ A;  1YWC A;  1D3S A;  2HZQ A;  1TOW A;  4XMC A;  4IMO A;  1X89 A;  2Q9S A;  4MVK A;  4ZH9 A;  3T1D A;  2RQ0 A;  2WEX A;  3CR6 A;  3G7X A;  4AZO A;  3C76 X;  1JJJ A;  2XST A;  1KT6 A;  1GM6 A;  4PSQ A;  4QGV A;  3O22 A;  2ASN X;  3IFB A;  4ORR A;  3CBS A;  4LZU A;  4AZQ A;  3U03 A;  1I4U A;  2FS7 A;  4RUN A;  2FT9 A;  5HCD C;  1EIO A;  5LJE A;  3KFG A;  1BBP A;  5LJG A;  5LKF A;  3STK A;  1BSY A;  5EZ2 A;  3U0D A;  3D97 A;  5FFH A;  4DQ3 A;  3L4R A;  5LJD A;  1VPR A;  3EYC A;  2CM9 A;  4WFV A;  3STM X;  2ACO A;  4YFP A;  4A60 A;  5EPQ A;  1TW4 A;  3JS1 A;  2OVA A;  4NLI A;  3EM0 A;  2GTF X;  1SY3 A;  4R0B A;  4ZJ0 A;  4N7D A;  1T8V A;  2HNX A;  1YWB A;  3BX8 A;  2K23 A;  3HWE A;  3CMP A;  1QG5 A;  5EED A;  4TQ2 A;  4OS0 A;  4GH7 A;  4XMH A;  4Y0S A;  5HBS A;  4ORX A;  1A57 A;  1KZX A;  4BVM A;  1Z24 A;  3HK1 A;  3KFF A;  4TLJ A;  1E06 A;  1U17 A;  3FR4 A;  3I17 A;  1QAB E;  5EEE A;  1LPJ A;  5K06 A;  2R73 A;  2W2A A;  3NX2 A;  1LIF A;  3P6H A;  3OJY C;  1T0V A;  1YP6 A;  2FLJ A;  3FIQ A;  4GE1 A;  2G79 A;  4TJZ A;  1GT4 A;  5HCC C;  3WJE A;  2OZQ A;  2WQA E;  3UEU A;  5IO7 A;  2LB6 A;  1LNM A;  4M7M A;  4RUU A;  2EU7 X;  1CJ5 A;  1OPA A;  2G78 A;  3B2I A;  5HA1 A;  2FS6 A;  4YGZ A;  4DQ4 A;  4OMW A;  2OFR X;  5KID A;  3GAQ A;  3DTQ A;  1FE3 A;  3FW5 A;  4AZP A;  2HZR A;  2KTD A;  2X45 A;  4LKP A;  1RLB E;  4Y0R A;  4OMX A;  1JJX A;  2AL0 X;  4YFQ A;  5HTE A;  5LKE A;  1OEK A;  2JOZ A;  2AT5 X;  2HYS A;  2GJ5 A;  2R56 A;  1O8V A;  1CBI A;  3STN A;  3O2Y A;  3NPO A;  1G74 A;  1MX7 A;  3O19 A;  1LKE A;  4ES7 A;  5F6Z A;  5KHP A;  1GGL A;  3PH6 A;  1OBU A;  4AYH A;  1GX9 A;  2RCQ A;  4YKM A;  4GRJ A;  2A2G A;  1LFO A;  4XMF A;  1PEE A;  2AMM X;  2IFB A;  2LKK A;  1URE A;  4OS8 A;  3U9P C;  1BWY A;  4NNS A;  1PMP A;  1NP1 A;  4EDE A;  1E5P A;  3ZQ3 A;  3ELX A;  4MVL A;  4I9R A;  3HWF A;  5H9K A;  1HN2 A;  4Y0P A;  1IFB A;  1OEE A;  1EXS A;  2P8G A;  5H9A A;  3WJB A;  1GX8 A;  1KT7 A;  3WXQ A;  2NNE A;  1B8E A;  5EDB A;  5F6B A;  1OBQ A;  3BY0 A;  1BEB A;  1SXY A;  4YKO A;  2AH7 X;  2WQ9 A;  3CQN A;  1MDC A;  1EAL A;  1S7D A;  2A3F X;  4GNY A;  1U18 A;  1UZ2 X;  2G7B A;  4ZHD A;  4ZCB A;  5L8N A;  1E02 A;  3ZUI A;  4IB7 A;  1A2D A;  3VG5 A;  4TKB A;  5F7G A;  5B27 A;  2GC9 A;  2Q39 A;  1CBR A;  2FR3 A;  2RCT A;  4NLJ A;  2NND A;  4ZH6 A;  1QQS A;  4ZGU A;  2MO5 A;  3C78 X;  3WVM A;  4WFU A;  4EFG A;  4I3D A;  3UEX A;  3BU1 A;  1YP7 A;  4YH0 A;  5HZ9 A;  4YGG A;  1G5W A;  4I3C A;  4K19 A;  4AZN A;  3VG3 A;  1KT5 A;  1R0U A;  5LJH A;  1LIE A;  2CZT A;  5HZQ A;  4ALB A;  1SXW A;  3C77 X;  5HWZ A;  1T68 X;  4IB8 A;  1FEL A;  3FA8 A;  3UEV A;  3NQ3 A;  1KXO A;  1YIV A;  2CZU A;  3WJG A;  1EQD A;  1JZU A;  5D47 A;  3TGC A;  3MVF A;  4UU2 A;  1EUO A;  5JR8 A;  5F58 A;  2OFM X;  1HBQ A;  3PPT A;  4I3B A;  3PEC A;  2XKL A;  4NYR A;  2RA6 A;  1TVQ A;  4NNT A;  3B2K A;  1DZM A;  1BSO A;  4O9S A;  1DC9 A;  4ODD A;  1YUP A;  4QGX A;  3KQ0 A;  1OBP A;  1L6M A;  2WEW A;  3NR3 A;  1CBS A;  3IA8 A;  1SXU A;  4A1Y A;  1KQW A;  1G7N A;  1FDQ A;  3TGB A;  4IB6 A;  3FW4 A;  3FR5 A;  3BLG A;  4N7C A;  1NP4 A;  3CWK A;  3BRN A;  1QWD A;  1KT3 A;  4TNN A;  1JV4 A;  2MJI A;  1B56 A;  1QY0 A;  1TXL A;  5HA0 A;  2CBS A;  3B2L A;  4AZR A;  3JSQ A;  5LJC A;  3EMM A;  2L68 A;  4NP1 A;  1ICN A;  3RSW A;  1CBQ A;  5IO6 A;  5HZ5 A;  4IMN A;  1QY2 A;  1S44 A;  3PED A;  1LIC A;  2LBV A;  4YBP A;  3DSZ A;  4WBK A;  5HCE C;  1YWD A;  3P6G A;  1DV9 A;  1PM1 X;  4ZHC A;  1QFV A;  4EXZ A;  4TKH A;  5D8J A;  2F73 A;  2ACP X;  4UU3 A;  1ADL A;  2X46 A;  1N0S A;  1B0O A;  1VYF A;  2QM9 A;  3P6C A;  4IAX A;  1DZP A;  4KII A;  4GET A;  1ZNL A;  3TF6 A;  4YFR A;  1SY2 A;  1VYG A;  1E00 A;  1KGL A;  2YG2 A;  2A0A A;  4YGH A;  2OVD A;  4ORY A;  3WJF A;  1KT4 A;  1IW2 A;  4HFO A;  4QZU A;  1OPB A;  1HBP A;  3P6D A;  4YDB A;  3EBW A;  1ZNK A;  4BOE A;  5CE4 A;  4HPB A;  2AT0 X;  3BU9 A;  2QO6 A;  3FA6 A;  1AVG I;  5FAZ A;  2WR6 A;  3KFH A;  4QYP A;  5HAE A;  3FA7 A;  2AT3 X;  3UEW A;  3FEK A;  2A2U A;  3APU A;  1ACD A;  1LIB A;  5AQ6 A;  2L67 A;  3BS2 A;  1ERB A;  1CRB A;  2Q2P A;  1GT1 A;  1O1V A;  4EEJ A;  4ZFX A;  2HLV A;  5D48 A;  5D4A A;  3NAD A;  5H8T A;  1X8P A;  1EPA A;  3FEP A;  1BRQ A;  4AW8 A;  5H9N A;  5L8O A;  1B4M A;  2FRS A;  3QKG A;  4QAE A;  5BVT A;  1HMT A;  3MBT A;  2LBA A;  3I0A A;  2RD7 C;  1KOI A;  3TGA A;  1JBH A;  4YCE A;  1ZNE A;  2QO4 A;  1BSQ A;  4ZHF A;  4A8Z A;  1IIU A;  2N93 A;  2E4J A;  3FEL A;  2PY1 A;  1X8U A;  2ANS A;  4XME A;  2NNQ A;  1FEM A;  1XCA A;  1GT5 A;  1SA8 A;  1BJ7 A;  2WSJ A;  2W2B A;  3VG2 A;  1LF7 A;  1AEL A;  4ZR2 A;  3BSZ E;  3SAO A;  5F1E A;  1O1U A;  3HWG A;  3WBG A;  1IKJ A;  1IFC A;  1GKA A;  3D96 A;  2Q2M A;  4I9S A;  1ZNH A;  1A3Y A;  4ORW A;  5H9L A;  1X71 A;  2CBR A;  4ALO A;  2OVE A;  2L9C A;  1BRP A;  5HZ6 A;  1GXA A;  1QFT A;  2JU3 A;  3NP1 A;  5L8I A;  3APW A;  3VG7 A;  4QZT A;  3KZA A;  1HMS A;  3VG6 A;  2QOS C;  1BM5 A;  4ZHH A;  4HPC A;  3D95 A;  1G85 A;  1KQX A;  2R74 A;  3KFI A;  3PH5 A;  4YBU A;  1BLR A;  2BLG A;  1FEN A;  3B2H A;  1DZJ A;  4GKC A;  4ZHG A;  1GKA B;  2DM5 A;  1X8O A;  4ORS A;  1YWA A;  3HWD A;  1H91 A;  2QO5 A;  2K62 A;  2FR2 A;  5DG4 A;  2CM4 A;  4D6A A;  1D2U A;  1HMR A;  1MUP A;  3Q6L A;  2WUT A;  2HMB A;  4Y0Q A;  1EII A;  5LJB A;  5HTD A;  5FEN A;  4GNW A;  4TKJ A;  2FTB A;  3NQ9 A;  1P6P A;  1ML7 A;  4IB9 A;  4NYQ A;  1MVG A;  1EW3 A;  1I05 A;  4AZM A;  1SY0 A;  1MX8 A;  3ZUO A;  4HPA A;  1EPB A;  3S26 A;  4YMY A;  5BVQ A; 
#chains in the Genus database with same CATH topology
 3P24 A;  1VWL B;  3P6F A;  3EBK A;  1SLG B;  1IKE A;  4GU8 A;  2RTQ B;  1U0X A;  4JO6 A;  4M6S A;  5BVS A;  1DFV A;  1JYD A;  1SWS A;  2LA7 A;  3CQR A;  3QQ2 A;  3VG4 A;  3T6F A;  2ALL X;  5CSE A;  4OEL A;  3PP6 A;  1SRH A;  2RTI B;  3CBC A;  5C0N A;  1QY1 A;  1VWA B;  2JN3 A;  4XMD A;  5KIC A;  4D6B A;  3T2W A;  1WBI A;  1AB0 A;  2GTL M;  1DZK A;  1PBY A;  1XKI A;  1VWC B;  1S2P A;  1STP A;  1LID A;  4QYN A;  3JQO A;  2KT4 B;  1RBP A;  5FQ7 E;  2L5P A;  4BGF A;  1X8N A;  2O62 A;  1ZRY A;  2AKQ A;  2POA A;  4MVE A;  2JW1 A;  1LCW A;  1ERX A;  1ZND A;  2JU7 A;  1SWO A;  3CKF A;  3FID A;  1X8Q A;  3FR2 A;  3FLL A;  4MVI A;  3GE2 A;  3EW2 A;  3T6L A;  4CDD A;  1ALB A;  5HZ8 A;  1SY1 A;  1NC9 A;  4COT A;  2Q4N A;  3FEN A;  1SLD B;  2MM3 A;  2RTR B;  1TOU A;  2X8T A;  1JYJ A;  4LKT A;  1GX3 A;  1I04 A;  2OVS A;  3FMZ A;  4XMG A;  1ZNG A;  4Y59 A;  1VWK B;  2RTD B;  3BDR A;  4HPD A;  4IBA A;  4CDC A;  1A18 A;  3F9D A;  1SRF A;  1N4J A;  1HXL A;  1Y55 X;  3APV A;  4U8U N;  4YCH A;  2KW1 A;  2A13 A;  3EW1 A;  3RZY A;  4GJV A;  3NX1 A;  3P6E A;  1DF3 A;  3FA9 A;  4LZV A;  4QGW A;  4CK4 A;  3TZS A;  3WJC A;  2AT8 X;  5B29 A;  2JU8 A;  1OEJ A;  1AQB A;  2W2F A;  5EDC A;  2FWV A;  4KC7 A;  2IZF B;  1FTP A;  1NGL A;  2ZSC A;  1SRJ A;  4O4O A;  4OS3 A;  4U46 A;  5DPQ A;  3B2J A;  4YDA A;  4IAW A;  4BCS A;  5LJK A;  3ZW1 A;  2NP1 A;  1SXX A;  2WWP A;  5CYB A;  3F8A A;  4CPE A;  4EQA C;  1KZW A;  1I06 A;  1PBO A;  4ARH A;  1GT3 A;  4ORU A;  5HZ6 A;  2LFO A;  1ICM A;  3WJD A;  2A5B A;  2AT6 X;  4BQU A;  3AKM A;  3APX A;  1RXH A;  3K3L A;  1HQP A;  3BX7 A;  5D45 A;  3AKN A;  4U3Q A;  5IO5 A;  3ELZ A;  1YWC A;  2RN4 A;  1D3S A;  2HZQ A;  1TOW A;  4XMC A;  4DNE A;  1SWL A;  4BX5 B;  2Y32 A;  4IMO A;  3SZI A;  1VWG B;  1X89 A;  1SWE A;  2Q9S A;  4MVK A;  4ZH9 A;  3T1D A;  2RQ0 A;  2WEX A;  3CR6 A;  3G7X A;  4AZO A;  3C76 X;  4B55 A;  1JJJ A;  2XST A;  1KT6 A;  3PQU A;  4QRL A;  1GM6 A;  2A8G A;  1SWJ A;  4PSQ A;  4QGV A;  1NQN A;  3O22 A;  2RTF B;  3WZQ A;  2ASN X;  3IFB A;  4ORR A;  3CBS A;  4LZU A;  4AZQ A;  3U03 A;  1I4U A;  2FS7 A;  4RUN A;  2FT9 A;  5HCD C;  4MIS A;  1EIO A;  5LJE A;  1Y9L A;  3KFG A;  1BBP A;  5LJG A;  1VWN B;  2IZI A;  5LKF A;  3STK A;  1BSY A;  3HOE A;  5EZ2 A;  2X8S A;  3FDC A;  2BSZ A;  3U0D A;  3D97 A;  4HWM A;  5FFH A;  4C5P A;  2G5L A;  2IZG B;  3L4R A;  5LJD A;  1VPR A;  3SZH A;  4DQ3 A;  2Y3E A;  3EYC A;  4CPH B;  3VPJ E;  2WPU A;  2CM9 A;  4WFV A;  2ZAG A;  3STM X;  2ACO A;  4YFP A;  4ID2 A;  4O49 A;  3PK2 A;  5IRU A;  2FGS A;  1TW4 A;  3JS1 A;  5EPQ A;  2OVA A;  4I6S A;  4NLI A;  4A60 A;  3EM0 A;  1SY3 A;  2GTF X;  2IZE B;  4R0B A;  4DCB A;  4ZJ0 A;  4N7D A;  1T8V A;  2HNX A;  2RTH B;  1YWB A;  2RTL A;  3BX8 A;  2K23 A;  3CKG A;  1LUQ A;  3HWE A;  1Y53 X;  3WYP A;  2X32 A;  3CMP A;  4ZHG A;  4MEE A;  1QG5 A;  5EED A;  1MOY A;  2RTK A;  4GUZ A;  4TQ2 A;  2OFA A;  4OS0 A;  4GH7 A;  1PTS A;  1NDJ A;  1NQM A;  4OEM A;  2X34 A;  4XMH A;  4Y0S A;  5HBS A;  4ORX A;  2IZB A;  1A57 A;  1KZX A;  4BVM A;  1Z24 A;  3HK1 A;  3KFF A;  4TLJ A;  1W4T A;  5AJB A;  5FQ6 E;  1RSU B;  3N91 A;  4O3Y A;  1E06 A;  1U17 A;  2A5C A;  3FR4 A;  1KL3 A;  1QAB E;  3I17 A;  4U8U O;  5EEE A;  1LPJ A;  4O3W A;  2R73 A;  3RE5 A;  2W2A A;  3NX2 A;  1LIF A;  2M4L A;  3P6H A;  1VWF B;  4GGR A;  1HXZ A;  1T0V A;  1YP6 A;  2FLJ A;  3FIQ A;  3OJY C;  2G79 A;  4GE1 A;  4TJZ A;  1GT4 A;  5HCC C;  3WJE A;  2OZQ A;  2WQA E;  3UEU A;  5IO7 A;  2LB6 A;  1LNM A;  4M7M A;  4RUU A;  2EU7 X;  3RY1 A;  3HOL A;  1CJ5 A;  1OPA A;  2G78 A;  3B2I A;  3HTY A;  5HA1 A;  1LCV A;  2FS6 A;  4YGZ A;  4DQ4 A;  2BS6 A;  4OMW A;  2OFR X;  2MF6 A;  5KID A;  3GAQ A;  3DTQ A;  1FE3 A;  3VHH A;  2I5Z O;  3FW5 A;  4AZP A;  2HZR A;  2KTD A;  2X45 A;  4LKP A;  1RLB E;  4Y0R A;  4OMX A;  1JJX A;  1N43 A;  2AL0 X;  4YFQ A;  4FBV A;  5HTE A;  5LKE A;  1OEK A;  1SRI A;  2JOZ A;  2AT5 X;  2HYS A;  4O4S A;  2GJ5 A;  5IXG A;  2R56 A;  5AJC A;  1VWO B;  1O8V A;  1CBI A;  1RAV A;  3O2Y A;  2OL7 A;  2ZAI A;  1G74 A;  1MX7 A;  3NPO A;  1LKE A;  1VWR B;  3O19 A;  4ES7 A;  4PJ2 A;  5F6Z A;  5KHP A;  1GGL A;  3FYF A;  4L3R A;  3PH6 A;  1OBU A;  2FKG A;  4AYH A;  1GX9 A;  2GTL N;  2JMB A;  2RCQ A;  4GRJ A;  2A2G A;  4YKM A;  3S5V A;  4FGI B;  1LFO A;  2AVI A;  4XMF A;  1PEE A;  3RDU A;  3ZW0 A;  2AMM X;  2IFB A;  2LKK A;  1URE A;  4OS8 A;  3OBL A;  1SWP A;  3MG5 A;  3U9P C;  3T2X A;  1BWY A;  1RXJ A;  2Y3F A;  2BHV A;  2Z4H A;  3HPE A;  1PMP A;  1NP1 A;  3OD9 A;  4NNS A;  4EDE A;  1E5P A;  3ZQ3 A;  3ELX A;  4MVL A;  4Z27 A;  4BJ8 A;  4I9R A;  1SMP I;  1LDQ A;  1MK5 A;  1UYO X;  3HWF A;  5H9K A;  3SLT A;  1HN2 A;  4Y0P A;  4A1H A;  4GGT A;  1IFB A;  1OEE A;  4INN A;  1EXS A;  2P8G A;  1KFF A;  3RDQ A;  4O3Z A;  2X56 A;  2IZL B;  5H9A A;  3WJB A;  1EI5 A;  1GX8 A;  4U9C A;  1KT7 A;  1JQP A;  3SOT A;  4CDF A;  3WXQ A;  2NNE A;  1B8E A;  4I95 A;  1SWQ A;  5EDB A;  5F6B A;  1OBQ A;  3BY0 A;  1BEB A;  2X55 A;  1SXY A;  3P02 A;  4Z6J A;  4YKO A;  5B10 O;  3E3C A;  2AH7 X;  3WZO A;  3RDO A;  1N7Y A;  2WQ9 A;  1MDC A;  3CQN A;  4CV7 A;  1EAL A;  1S7D A;  2A3F X;  2OL6 O;  1LEL A;  1U18 A;  1UZ2 X;  2G7B A;  4GNY A;  4ZHD A;  2F01 A;  4ZCB A;  4MIR A;  4CSB A;  5L8N A;  1E02 A;  1KL5 A;  3ZUI A;  4IB7 A;  1A2D A;  3VG5 A;  4TKB A;  1UYN X;  5F7G A;  5B5F A;  5B27 A;  3ZW1 B;  2GC9 A;  3PQS A;  2Q39 A;  1CBR A;  2FR3 A;  1AVD A;  2RCT A;  4NLJ A;  2NND A;  4ZH6 A;  1QQS A;  4Z2V A;  2MO5 A;  4ZGU A;  3C78 X;  1DV9 A;  3ZW2 A;  4JNJ A;  3WVM A;  4WFU A;  2OF8 A;  4I3D A;  3ZZV A;  4EFG A;  3UEX A;  4QQ1 A;  3BU1 A;  2F09 A;  1YP7 A;  4YH0 A;  5HZ9 A;  4YGG A;  1KL4 A;  4I3C A;  1SWT A;  1G5W A;  2IZC B;  1JMX A;  4K19 A;  4AZN A;  3VG3 A;  1KT5 A;  1NBX A;  1R0U A;  4I60 A;  5LJH A;  1LIE A;  2CZT A;  5HZQ A;  4ALB A;  2CAM A;  1SXW A;  3C77 X;  5HWZ A;  3LTW A;  1T68 X;  1W5R A;  4IB8 A;  2QMI A;  1FEL A;  2OY1 O;  3FA8 A;  3UEV A;  3NQ3 A;  1KXO A;  5CHK A;  2RTO B;  1YIV A;  2CZU A;  3WJG A;  3RWX A;  2OY5 O;  4GKC A;  1OSP O;  3SLO A;  1EQD A;  3RE6 A;  1JZU A;  5D47 A;  1HQQ A;  3TGC A;  3MVF A;  2KD2 A;  1EUO A;  4UU2 A;  5IRA A;  5JR8 A;  5F58 A;  1SWF A;  2OFM X;  1HBQ A;  3PPT A;  4I3B A;  3VE1 A;  3PEC A;  2KTS A;  2XKL A;  4NYR A;  2IZD B;  2RA6 A;  5BYP A;  4KT5 A;  1TVQ A;  3NQK A;  4NNT A;  1DF8 A;  2GTL O;  5K68 A;  2BS5 A;  2IZA A;  3B2K A;  1DZM A;  3STN A;  1BSO A;  4O9S A;  1DC9 A;  4ODD A;  1YUP A;  4QGX A;  3KQ0 A;  1OBP A;  1L6M A;  2WEW A;  3RBY A;  3NR3 A;  2HKD A;  1CBS A;  4CDE A;  1VWP B;  1K3B A;  1VWH B;  3IA8 A;  1SXU A;  4A1Y A;  1KQW A;  2IZJ A;  3ZWE A;  2GH7 A;  4GD9 A;  3VU1 A;  1G7N A;  1FDQ A;  2C4I A;  3RDM A;  3TGB A;  4IB6 A;  5B5G A;  3FW4 A;  1AVE A;  2QCB A;  3X00 A;  2C1S A;  3BLG A;  3FR5 A;  2X4M A;  4N7C A;  1VWE B;  1NP4 A;  3CWK A;  4NV7 A;  3BRN A;  1QWD A;  1KT3 A;  1MM9 A;  2FHL A;  3SZJ A;  3Q34 A;  4TNN A;  1JV4 A;  1N9Y A;  1Y9T A;  2MJI A;  1B56 A;  4Y5D A;  1SWH A;  5FQ8 E;  1QY0 A;  1TXL A;  2QOM A;  5HA0 A;  2CBS A;  4JHQ A;  1K24 A;  3B2L A;  4KCA A;  4FBR A;  4AZR A;  4IRW A;  3JSQ A;  5LJC A;  3EMM A;  2L68 A;  4JGL A;  4GDZ A;  4NP1 A;  3RDX A;  1STR B;  1ICN A;  3RSW A;  1CBQ A;  2RTB B;  5IO6 A;  5HZ5 A;  3PDF A;  4IMN A;  1QY2 A;  2RTC B;  1S44 A;  3PED A;  1LIC A;  2LBV A;  4YBP A;  5K67 A;  3DSZ A;  4WBK A;  4O4U A;  1YWD A;  3P6G A;  5HCE C;  1PM1 X;  3KVN A;  4ZHC A;  1QFV A;  4EXZ A;  1IJ8 A;  1FJ1 E;  4TKH A;  5D8J A;  2F73 A;  2ACP X;  4UU3 A;  1ADL A;  1RXK A;  1N0S A;  1B0O A;  1Y0G A;  2IZK A;  1VYF A;  2OFB A;  2QM9 A;  2X46 A;  3MX7 A;  3P6C A;  4IAX A;  1DZP A;  4KII A;  2BT9 A;  1VWI B;  1HY2 A;  3AUM O;  4GET A;  1ZNL A;  1SWU A;  3TF6 A;  4YFR A;  1SY2 A;  1VYG A;  1E00 A;  1KGL A;  1SWN A;  2YG2 A;  2A0A A;  4YGH A;  2OVD A;  4L1N A;  4ORY A;  1STS B;  4U8U M;  4ZHF A;  3WJF A;  4O3X B;  1KT4 A;  2OL8 O;  1IW2 A;  4HFO A;  4QZU A;  4CPI A;  1OPB A;  1HBP A;  3D9W A;  2Z4I A;  2G8C O;  3P6D A;  4YDB A;  1SWC A;  3EBW A;  1LCZ A;  1ZNK A;  4BOE A;  5CE4 A;  4HPB A;  2AT0 X;  3WZP A;  1JIW I;  3BU9 A;  2QO6 A;  3FA6 A;  5B11 O;  1AVG I;  3RDS A;  3EC5 A;  5FAZ A;  2WR6 A;  3KFH A;  4QYP A;  2RTM A;  2C1Q A;  5JD2 A;  5HAE A;  3FA7 A;  2VFC A;  3ZW0 B;  2AT3 X;  3UEW A;  3FEK A;  2A2U A;  3APU A;  1ACD A;  1LIB A;  5AQ6 A;  2L67 A;  4KH8 A;  3BS2 A;  4BX5 A;  1ERB A;  1CRB A;  2Q2P A;  1GT1 A;  1O1V A;  1SLF B;  1W6F A;  2HLV A;  2RTN B;  4O4X A;  5D48 A;  5D4A A;  4EEJ A;  4Z2O A;  3NAD A;  4ZFX A;  5H8T A;  1X8P A;  1EPA A;  2X8F A;  2RTJ A;  3FEP A;  1BRQ A;  1VYO A;  4AW8 A;  1JMZ A;  5H9N A;  5L8O A;  1B4M A;  1WUB A;  3AEH A;  3WYQ A;  2FRS A;  2DJG A;  2MWH A;  3QKG A;  4QAE A;  1LDO A;  1HMT A;  3ZI8 A;  4BX6 A;  5BVT A;  3UAQ A;  5K06 A;  3RKG A;  3MBT A;  2LBA A;  3I0A A;  2FHN X;  2IZH B;  2OF9 A;  2RTE B;  4GZV A;  4BBO A;  1I9H A;  2RD7 C;  1VWD B;  3D4R A;  1KOI A;  3TGA A;  1JBH A;  4CPF A;  4YCE A;  3OE3 A;  2YMS A;  1VWB B;  1ZNE A;  1BSQ A;  2QO4 A;  3V8U A;  4A8Z A;  1JJU A;  1IIU A;  3H3I A;  2N93 A;  4GK9 A;  2E4J A;  3FEL A;  2OY8 A;  2PY1 A;  1X8U A;  2ANS A;  4XME A;  3VE2 A;  4QNI A;  2NNQ A;  1FEM A;  3F6Z B;  4CPH A;  1SWK A;  1GT5 A;  1XCA A;  1I78 A;  2UYW A;  1SA8 A;  1SWB A;  4WHI A;  1BJ7 A;  2WSJ A;  2W2B A;  3VG2 A;  1LF7 A;  1AEL A;  4ZR2 A;  3VHI A;  1SWG A;  3BSZ E;  3SAO A;  5F1E A;  1O1U A;  3HWG A;  3WBG A;  1IKJ A;  1IFC A;  3WZN A;  3RY2 A;  1GKA A;  4BX6 B;  4LQZ A;  3D96 A;  2Q2M A;  1E2T A;  1SWD A;  5F2B A;  2OY7 A;  3MM0 A;  4I9S A;  1ZNH A;  1A3Y A;  4ORW A;  1RST B;  4BX7 A;  2VDF A;  1SRE A;  2RTG B;  3NBX X;  1VWQ B;  5H9L A;  2FKJ A;  5L3Y A;  1X71 A;  2CBR A;  4ALO A;  2OVE A;  2L9C A;  1BRP A;  2VFB A;  4IAB A;  1GXA A;  1QFT A;  2JU3 A;  3NP1 A;  4ML7 B;  3APW A;  5L8I A;  3VG7 A;  4QZT A;  3KZA A;  4FQB B;  4GDA A;  3S60 A;  1HMS A;  1MEP A;  3VG6 A;  2QOS C;  1Y52 X;  1BM5 A;  4ZHH A;  4HPC A;  3VHM A;  3D95 A;  2OYB O;  1G85 A;  1KQX A;  2R74 A;  3KFI A;  3PH5 A;  4YBU A;  4ZGF A;  1BLR A;  2BLG A;  1FEN A;  4NV8 A;  4GJS A;  3B2H A;  1DZJ A;  2PI3 O;  1SLE B;  1GKA B;  2BC3 A;  1X8O A;  2DM5 A;  1YWA A;  2UZ2 A;  3HWD A;  4ORS A;  1H91 A;  2QO5 A;  2K62 A;  2MHD A;  4Z2P A;  4EKV A;  4NW4 A;  4YVB A;  2FR2 A;  5DG4 A;  2AF5 A;  5IRW A;  1VWM B;  2CM4 A;  4D6A A;  1D2U A;  1HMR A;  1MUP A;  3Q6L A;  4OKA A;  4BX7 B;  5AEO A;  2WUT A;  2HMB A;  4Y0Q A;  3S5X A;  1EII A;  5LJB A;  4GGZ A;  5FEN A;  5HTD A;  4GNW A;  4FBO A;  3LHN A;  4TKJ A;  1SRG A;  3VGW A;  2FTB A;  3NQ9 A;  1P6P A;  2RTP B;  4Z28 A;  2RTA A;  1ML7 A;  1N9M A;  4IB9 A;  4KC8 A;  4NYQ A;  1MVG A;  1SWR A;  5B3M O;  1EW3 A;  1I05 A;  3WOV A;  4AZM A;  2I5V O;  3LV4 A;  1SY0 A;  2JGS A;  1MX8 A;  5B2A O;  3ZUO A;  4HPA A;  3SLJ A;  1VWJ B;  1SWA A;  1EPB A;  4ON1 A;  2DJF A;  3S26 A;  4YMY A;  5BVQ A; 
#chains in the Genus database with same CATH homology
 3P24 A;  3P6F A;  3EBK A;  4GU8 A;  1IKE A;  5BVS A;  4A1H A;  1U0X A;  4M6S A;  3VG4 A;  1DFV A;  1JYD A;  2LA7 A;  3CQR A;  2ALL X;  3PP6 A;  3CBC A;  5C0N A;  1QY1 A;  5KIC A;  2JN3 A;  4XMD A;  4D6B A;  1AB0 A;  2GTL M;  1DZK A;  1XKI A;  1S2P A;  1LID A;  4QYN A;  3JQO A;  2KT4 B;  1RBP A;  5FQ7 E;  2L5P A;  2POA A;  1X8N A;  1ZRY A;  2AKQ A;  2O62 A;  4MVE A;  2JW1 A;  1ERX A;  1ZND A;  2JU7 A;  4MVI A;  1X8Q A;  3FR2 A;  3FLL A;  3GE2 A;  1ALB A;  5HZ8 A;  1SY1 A;  4COT A;  2Q4N A;  3FEN A;  2MM3 A;  1TOU A;  2X8T A;  1JYJ A;  4LKT A;  1I04 A;  2OVS A;  3FMZ A;  4XMG A;  1ZNG A;  4HPD A;  4IBA A;  3BDR A;  5IO5 A;  1A18 A;  3F9D A;  4U8U N;  3APV A;  4YCH A;  2KW1 A;  2A13 A;  3RZY A;  1DF3 A;  3NX1 A;  3P6E A;  3FA9 A;  4LZV A;  4QGW A;  4CK4 A;  3TZS A;  3WJC A;  2AT8 X;  5B29 A;  2JU8 A;  1OEJ A;  1AQB A;  2W2F A;  5EDC A;  2FWV A;  4KC7 A;  4OS3 A;  1FTP A;  1NGL A;  4O4O A;  5DPQ A;  3B2J A;  4YDA A;  4IAW A;  5LJK A;  3ZW1 A;  2NP1 A;  1SXX A;  2WWP A;  5CYB A;  3F8A A;  4EQA C;  1KZW A;  1I06 A;  1PBO A;  4ARH A;  1GT3 A;  4ORU A;  2LFO A;  1ICM A;  3WJD A;  2AT6 X;  4BQU A;  3AKM A;  3APX A;  3K3L A;  1HQP A;  3BX7 A;  5D45 A;  3AKN A;  4U3Q A;  3ELZ A;  1YWC A;  2RN4 A;  1D3S A;  2HZQ A;  1TOW A;  4XMC A;  4IMO A;  1X89 A;  2Q9S A;  4MVK A;  4ZH9 A;  3T1D A;  2RQ0 A;  2WEX A;  3CR6 A;  3G7X A;  4AZO A;  3C76 X;  1JJJ A;  2XST A;  1KT6 A;  3PQU A;  4QRL A;  1GM6 A;  4PSQ A;  4QGV A;  3O22 A;  2ASN X;  3IFB A;  4ORR A;  3CBS A;  4LZU A;  4AZQ A;  3U03 A;  1I4U A;  2FS7 A;  4RUN A;  2FT9 A;  5HCD C;  4MIS A;  1EIO A;  5LJE A;  1Y9L A;  3KFG A;  1BBP A;  5LJG A;  5LKF A;  3STK A;  1BSY A;  3HOE A;  5EZ2 A;  2X8S A;  3U0D A;  3D97 A;  4HWM A;  5FFH A;  4DQ3 A;  3L4R A;  5LJD A;  1VPR A;  3EYC A;  3VPJ E;  2CM9 A;  4WFV A;  2ZAG A;  3STM X;  2ACO A;  4YFP A;  4ID2 A;  4O49 A;  4A60 A;  5EPQ A;  1TW4 A;  3JS1 A;  2OVA A;  4I6S A;  4NLI A;  3EM0 A;  2GTF X;  1SY3 A;  4R0B A;  4ZJ0 A;  4N7D A;  1T8V A;  2HNX A;  1YWB A;  3BX8 A;  2K23 A;  3HWE A;  3CMP A;  1QG5 A;  5EED A;  4TQ2 A;  4OS0 A;  4GH7 A;  4XMH A;  4Y0S A;  5HBS A;  4ORX A;  1A57 A;  1KZX A;  4BVM A;  1Z24 A;  3HK1 A;  3KFF A;  4TLJ A;  5AJB A;  5FQ6 E;  3N91 A;  4O3Y A;  1E06 A;  1U17 A;  3FR4 A;  3I17 A;  1QAB E;  4U8U O;  5EEE A;  1LPJ A;  4O3W A;  2R73 A;  5K06 A;  2W2A A;  3NX2 A;  1LIF A;  2M4L A;  3P6H A;  3OJY C;  1T0V A;  1YP6 A;  2FLJ A;  3FIQ A;  4GE1 A;  2G79 A;  4TJZ A;  1GT4 A;  5HCC C;  3WJE A;  2OZQ A;  2WQA E;  3UEU A;  5IO7 A;  2LB6 A;  1LNM A;  4M7M A;  4RUU A;  2EU7 X;  1CJ5 A;  3HOL A;  1OPA A;  2G78 A;  3B2I A;  3HTY A;  5HA1 A;  2FS6 A;  4YGZ A;  4DQ4 A;  2BS6 A;  4OMW A;  2OFR X;  5KID A;  3GAQ A;  3DTQ A;  1FE3 A;  3FW5 A;  4AZP A;  2HZR A;  2KTD A;  2X45 A;  4LKP A;  1RLB E;  4Y0R A;  4OMX A;  1JJX A;  2AL0 X;  4YFQ A;  4FBV A;  5HTE A;  5LKE A;  1OEK A;  2JOZ A;  2AT5 X;  2HYS A;  4O4S A;  2GJ5 A;  2R56 A;  5AJC A;  1O8V A;  1CBI A;  3STN A;  3O2Y A;  2ZAI A;  1G74 A;  1MX7 A;  3NPO A;  1LKE A;  3O19 A;  4ES7 A;  4PJ2 A;  5F6Z A;  5KHP A;  1GGL A;  3FYF A;  4L3R A;  3PH6 A;  1OBU A;  4AYH A;  1GX9 A;  2GTL N;  2JMB A;  2RCQ A;  4GRJ A;  2A2G A;  4YKM A;  3S5V A;  4FGI B;  1LFO A;  4XMF A;  1PEE A;  3ZW0 A;  2AMM X;  2IFB A;  2LKK A;  1URE A;  4OS8 A;  3OBL A;  3U9P C;  1BWY A;  2BHV A;  2Z4H A;  3OD9 A;  1PMP A;  1NP1 A;  4NNS A;  4EDE A;  1E5P A;  3ZQ3 A;  3ELX A;  4MVL A;  4I9R A;  1SMP I;  3HWF A;  5H9K A;  1HN2 A;  4Y0P A;  4INN A;  1IFB A;  1OEE A;  1EXS A;  2P8G A;  4O3Z A;  5H9A A;  3WJB A;  1EI5 A;  1GX8 A;  4U9C A;  1KT7 A;  3SOT A;  3WXQ A;  2NNE A;  1B8E A;  4I95 A;  5EDB A;  5F6B A;  1OBQ A;  3BY0 A;  1BEB A;  1SXY A;  3P02 A;  4YKO A;  2AH7 X;  3E3C A;  2WQ9 A;  3CQN A;  1MDC A;  4CV7 A;  1EAL A;  1S7D A;  2A3F X;  4GNY A;  1U18 A;  1UZ2 X;  2G7B A;  4ZHD A;  4ZCB A;  4MIR A;  4CSB A;  5L8N A;  1E02 A;  3ZUI A;  4IB7 A;  1A2D A;  3VG5 A;  4TKB A;  5F7G A;  5B27 A;  3ZW1 B;  2GC9 A;  3PQS A;  2Q39 A;  1CBR A;  2FR3 A;  2RCT A;  4NLJ A;  2NND A;  4ZH6 A;  1QQS A;  4ZGU A;  2MO5 A;  3C78 X;  3ZW2 A;  3WVM A;  4WFU A;  3ZZV A;  4I3D A;  4EFG A;  3UEX A;  4QQ1 A;  3BU1 A;  2F09 A;  1YP7 A;  4YH0 A;  5HZ9 A;  4YGG A;  1G5W A;  4I3C A;  4K19 A;  4AZN A;  3VG3 A;  1KT5 A;  1R0U A;  5LJH A;  1LIE A;  2CZT A;  5HZQ A;  4ALB A;  1SXW A;  3C77 X;  5HWZ A;  1T68 X;  4IB8 A;  2QMI A;  1FEL A;  3FA8 A;  3UEV A;  3NQ3 A;  1KXO A;  1YIV A;  2CZU A;  3WJG A;  3RWX A;  1EQD A;  1JZU A;  5D47 A;  3TGC A;  3MVF A;  2KD2 A;  1EUO A;  4UU2 A;  5JR8 A;  5F58 A;  2OFM X;  1HBQ A;  3PPT A;  4I3B A;  3VE1 A;  3PEC A;  2KTS A;  2XKL A;  4NYR A;  2RA6 A;  5BYP A;  4KT5 A;  1TVQ A;  3NQK A;  4NNT A;  2GTL O;  2BS5 A;  3B2K A;  1DZM A;  1BSO A;  4O9S A;  1DC9 A;  4ODD A;  1YUP A;  4QGX A;  3KQ0 A;  1OBP A;  1L6M A;  2WEW A;  3RBY A;  3NR3 A;  1CBS A;  3IA8 A;  1SXU A;  4A1Y A;  1KQW A;  3ZWE A;  3VU1 A;  1G7N A;  1FDQ A;  3TGB A;  4IB6 A;  3FW4 A;  3FR5 A;  3BLG A;  4N7C A;  1NP4 A;  3CWK A;  3BRN A;  1QWD A;  1KT3 A;  4TNN A;  1JV4 A;  1Y9T A;  2MJI A;  1B56 A;  5FQ8 E;  1QY0 A;  1TXL A;  5HA0 A;  2CBS A;  4KCA A;  3B2L A;  4FBR A;  4AZR A;  3JSQ A;  5LJC A;  3EMM A;  2L68 A;  4JGL A;  4GDZ A;  4NP1 A;  1ICN A;  3RSW A;  1CBQ A;  5IO6 A;  5HZ5 A;  4IMN A;  1QY2 A;  1S44 A;  3PED A;  1LIC A;  2LBV A;  4YBP A;  3DSZ A;  4WBK A;  4O4U A;  1YWD A;  3P6G A;  5HCE C;  1PM1 X;  1DV9 A;  4ZHC A;  1QFV A;  4EXZ A;  4TKH A;  5D8J A;  2F73 A;  2ACP X;  4UU3 A;  1ADL A;  2X46 A;  1N0S A;  1B0O A;  1VYF A;  2QM9 A;  3MX7 A;  3P6C A;  4IAX A;  1DZP A;  4KII A;  2BT9 A;  4GET A;  1ZNL A;  3TF6 A;  4YFR A;  1SY2 A;  1VYG A;  1E00 A;  1KGL A;  2YG2 A;  2A0A A;  4YGH A;  2OVD A;  4L1N A;  4ORY A;  4U8U M;  3WJF A;  4O3X B;  1KT4 A;  1IW2 A;  4HFO A;  4QZU A;  1OPB A;  1HBP A;  2Z4I A;  3P6D A;  4YDB A;  3EBW A;  1ZNK A;  4BOE A;  5CE4 A;  4HPB A;  2AT0 X;  1JIW I;  3BU9 A;  2QO6 A;  3FA6 A;  1AVG I;  5FAZ A;  2WR6 A;  3KFH A;  4QYP A;  5HAE A;  3FA7 A;  3ZW0 B;  2AT3 X;  3UEW A;  3FEK A;  2A2U A;  3APU A;  1ACD A;  1LIB A;  5AQ6 A;  2L67 A;  4KH8 A;  3BS2 A;  1ERB A;  1CRB A;  2Q2P A;  1GT1 A;  1O1V A;  4EEJ A;  4ZFX A;  2HLV A;  4O4X A;  5D48 A;  5D4A A;  3NAD A;  5H8T A;  1X8P A;  1EPA A;  2X8F A;  3FEP A;  1BRQ A;  4AW8 A;  5H9N A;  5L8O A;  1B4M A;  2FRS A;  3QKG A;  2MWH A;  4QAE A;  3ZI8 A;  1HMT A;  5BVT A;  3UAQ A;  3RKG A;  3MBT A;  2LBA A;  3I0A A;  4GZV A;  2RD7 C;  3D4R A;  1KOI A;  3TGA A;  1JBH A;  4YCE A;  3OE3 A;  2YMS A;  1ZNE A;  2QO4 A;  1BSQ A;  3V8U A;  4ZHF A;  4A8Z A;  3H3I A;  1IIU A;  4GK9 A;  2N93 A;  2E4J A;  3FEL A;  2PY1 A;  1X8U A;  2ANS A;  4XME A;  3VE2 A;  4QNI A;  2NNQ A;  1FEM A;  3F6Z B;  1XCA A;  1GT5 A;  1SA8 A;  4WHI A;  1BJ7 A;  2WSJ A;  2W2B A;  3VG2 A;  1LF7 A;  1AEL A;  4ZR2 A;  3BSZ E;  3SAO A;  5F1E A;  1O1U A;  3HWG A;  3WBG A;  1IKJ A;  1IFC A;  1GKA A;  4LQZ A;  3D96 A;  2Q2M A;  4I9S A;  1ZNH A;  1A3Y A;  4ORW A;  3NBX X;  5H9L A;  1X71 A;  2CBR A;  4ALO A;  2OVE A;  2L9C A;  1BRP A;  4IAB A;  5HZ6 A;  1GXA A;  1QFT A;  2JU3 A;  3NP1 A;  4ML7 B;  3APW A;  5L8I A;  3VG7 A;  4QZT A;  3KZA A;  4FQB B;  3S60 A;  1HMS A;  3VG6 A;  2QOS C;  1BM5 A;  4ZHH A;  4HPC A;  3D95 A;  1G85 A;  1KQX A;  2R74 A;  3KFI A;  3PH5 A;  4YBU A;  4ZGF A;  1BLR A;  2BLG A;  1FEN A;  3B2H A;  1DZJ A;  4GKC A;  4ZHG A;  1GKA B;  2DM5 A;  1X8O A;  4ORS A;  1YWA A;  3HWD A;  1H91 A;  2QO5 A;  2K62 A;  2MHD A;  4NW4 A;  2FR2 A;  5DG4 A;  2CM4 A;  4D6A A;  1D2U A;  1HMR A;  1MUP A;  3Q6L A;  5AEO A;  2WUT A;  2HMB A;  4Y0Q A;  3S5X A;  1EII A;  5LJB A;  5HTD A;  5FEN A;  4GNW A;  4FBO A;  3LHN A;  4TKJ A;  2FTB A;  3NQ9 A;  1P6P A;  1ML7 A;  4IB9 A;  4KC8 A;  4NYQ A;  1MVG A;  1EW3 A;  1I05 A;  3WOV A;  4AZM A;  3LV4 A;  1SY0 A;  1MX8 A;  3ZUO A;  4HPA A;  1EPB A;  4ON1 A;  3S26 A;  4YMY A;  5BVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...