4TJZA

The 0.87 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with capric acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Fatty acid-binding protein, heart
publication title Water-mediated recognition of simple alkyl chains by heart-type Fatty-Acid-binding protein
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tjzA00
5LJCA 4GE1A 1GT3A 1ZRYA 1B8EA 1KT6A 5LJEA 1OBPA 2L68A 1UZ2X 1G7NA 4ZFXA 1BSQA 2JN3A 5LJKA 4IB7A 1N0SA 1S44A 1TXLA 2X45A 2FR3A 5LJHA 3C77X 1ZNHA 2AT5X 4NP1A 2XKLA 1FTPA 5F1EA 5F7GA 2FWVA 2QO4A 2FTBA 5HA0A 1MDCA 1FE3A 4QZUA 3KFFA 5C0NA 4I9SA 4ZCBA 2R73A 3D95A 3S26A 2HMBA 5HZ5A 1G74A 1L6MA 2JU7A 1LIFA 1YP7A 4GRJA 4YFQA 1VYFA 3UEUA 5F58A 1KGLA 2FLJA 4LZVA 2WQ9A 1GXAA 2OVEA 1LPJA 1SXUA 4YCEA 4ARHA 4YKMA 3JS1A 2CBRA 4ALBA 1YWCA 1DFVA 2L9CA 1GKAA 1JJXA 2QO6A 1EUOA 1YUPA 1NP1A 4GNWA 2N93A 4GH7A 5B29A 5IO5A 1E00A 2X46A 3GAQA 1X89A 2LFOA 4Y0PA 3BDRA 2HYSA 4TKBA 1GGLA 1GKAB 1AQBA 5KIDA 1QABE 2JOZA 2K62A 2R56A 3C76X 3OJYC 5B27A 1IKJA 3BS2A 3CWKA 3NPOA 4ORYA 1T8VA 5FAZA 1GT1A 1QG5A 5LKFA 2HZQA 4N7DA 1MX8A 2QO5A 3EM0A 3O22A 3HK1A 4EXZA 1AB0A 3WJEA 4GETA 3HWEA 5EDCA 3FR4A 1I04A 1VPRA 5KHPA 5BVQA 1JZUA 4NLIA 3WJCA 3WJFA 4RUUA 1JJJA 3UEVA 2JU8A 3KQ0A 5IO6A 4IAWA 2FT9A 1LIEA 4K19A 1OPAA 4M7MA 4OS8A 4ALOA 3BLGA 4OS0A 4YBUA 1HBQA 1QY1A 5H9LA 1O8VA 1O1VA 1ZNLA 1RBPA 1RLBE 3WXQA 4GKCA 5H8TA 1AVGI 2FS6A 4NLJA 4HPCA 3FENA 3EBWA 2CM9A 4ORSA 3B2HA 5H9AA 3B2LA 3MBTA 3ELXA 1GX8A 1XCAA 3L4RA 1A3YA 1KT7A 4YDBA 3FR2A 5K06A 3BU1A 3CQNA 5FENA 2LB6A 1IIUA 3BX7A 3FA8A 4ORRA 2OFRX 4TKHA 3EMMA 4ODDA 1KT4A 2WUTA 1CRBA 4ORXA 1KXOA 1PMPA 1YWBA 2PY1A 1EPAA 1ERBA 1DF3A 1G85A 3HWGA 3QKGA 3B2IA 4MVIA 3NP1A 1EALA 3VG6A 3EBKA 4KIIA 4XMHA 1D3SA 1A2DA 3U9PC 4AW8A 2AT0X 1D2UA 3FA9A 4A1YA 1OPBA 4CK4A 4YBPA 4HFOA 3KFGA 4BOEA 1A57A 4TKJA 2POAA 1CBRA 1G5WA 1Z24A 3CR6A 4YCHA 2G78A 1DZMA 1JBHA 1FENA 1GT5A 4ES7A 1CBQA 1PBOA 2IFBA 3NQ9A 5HTDA 4I3DA 5EPQA 2WR6A 3ELZA 1FELA 5HTEA 4HPDA 4Y0QA 5D4AA 3TF6A 2RCQA 3EYCA 1SXWA 3P6GA 3F9DA 5HZ8A 1GT4A 1BWYA 1ALBA 1SY0A 2WEWA 4ZR2A 5HCEC 1CBIA 2L5PA 3NX2A 4TLJA 2AT8X 2F73A 1EIOA 2MO5A 1MX7A 1BRPA 5LJGA 4ORUA 4ZHCA 5AQ6A 3T1DA 2CZTA 4DQ4A 1QQSA 4XMCA 1U17A 3WJBA 4I3BA 1KZWA 1DZKA 1ZNDA 4UU2A 1TVQA 4EDEA 3P6FA 4GNYA 1SY3A 4QYNA 3FR5A 1TOWA 3P6CA 2AH7X 2MM3A 1CJ5A 4ORWA 2HZRA 1H91A 1KT5A 1X8PA 4R0BA 2WQAE 3HWDA 1QFTA 5EDBA 2RA6A 1QFVA 3NQ3A 4HPAA 2WWPA 3Q6LA 1SY1A 5CE4A 3AKNA 1I4UA 5H9NA 5HZQA 2CBSA 3JSQA 1X8QA 2DM5A 1MVGA 3TGBA 1HMSA 3I0AA 4YGZA 2W2FA 4QYPA 3HWFA 2CZUA 4IMNA 3FIQA 3APWA 1YWAA 4OMXA 3AKMA 2LKKA 2LBAA 1LIDA 1P6PA 3NADA 1ADLA 3CBCA 5F6ZA 1KOIA 2O62A 2W2BA 4A8ZA 2QM9A 3FW4A 5EEDA 2RQ0A 1HN2A 1LIBA 5D8JA 3IA8A 2Q4NA 2ANSA 4NYRA 4Y0SA 4ZHFA 2QOSC 2EU7X 2OVAA 1LFOA 2ACOA 1IFBA 1X8NA 4OMWA 3VG4A 1S2PA 1ZNEA 4BVMA 1U0XA 4ZGUA 1IW2A 1I06A 1FDQA 3BX8A 4I9RA 4WFUA 2Q39A 4ZHGA 2E4JA 1JYJA 5D47A 5LKEA 4IMOA 4AYHA 1E06A 3BU9A 3P6HA 2NNEA 4ZJ0A 3PH5A 4HPBA 4QGWA 5L8IA 1B4MA 1U18A 2A0AA 3DSZA 2K23A 4IAXA 5JR8A 5D48A 3FEPA 2OFMX 1EQDA 2LBVA 3ZUIA 3O2YA 3NR3A 1YIVA 4NNSA 4OS3A 2P8GA 4A1HA 4QGXA 4Y0RA 3D96A 4QAEA 1B0OA 3NX1A 4DQ3A 3IFBA 2AT3X 2HLVA 1T0VA 1ACDA 3D97A 2FRSA 1ZNKA 2AMMX 2GTFX 1SXYA 2G79A 2R74A 3PPTA 2YG2A 1OEEA 4LKTA 4PSQA 1ERXA 3P6DA 1E5PA 3P6EA 5KICA 2A3FX 1DC9A 4TNNA 3G7XA 1LF7A 1LKEA 5LJBA 3APVA 1SY2A 1AELA 1R0UA 1YP6A 3SAOA 3UEXA 1DV9A 3CBSA 1PM1X 4ZH9A 2HNXA 3FA7A 1CBSA 3BY0A 5HCDC 3WVMA 3O19A 4MVLA 1X8UA 1FEMA 4BQUA 4N7CA 4YFRA 2Q9SA 5BVTA 1ICMA 3CMPA 2L67A 3UEWA 1QWDA 1JV4A 1X8OA 1JYDA 4D6AA 4TJZA 2MJIA 3STKA 1ICNA 3ZUOA 4AZQA 4XMEA 1BRQA 4EFGA 2OZQA 1NP4A 1KT3A 1ZNGA 2NNQA 1DZPA 4NYQA 1EIIA 4XMDA 1BM5A 1BEBA 1TOUA 2CM4A 4M6SA 2FS7A 1KQWA 3STNA 4D6BA 4LKPA 1HMRA 2KT4B 2RCTA 1HBPA 4AZOA 3TGCA 5HZ6A 3DTQA 5DPQA 3VG5A 5IO7A 3FW5A 2ALLX 1SA8A 1HMTA 4NNTA 4YMYA 1S7DA 5LJDA 1O1UA 2G7BA 5HZ9A 3U0DA 1I05A 2A13A 1ML7A 2AT6X 2A2UA 3VG3A 4AZPA 1E02A 3STMX 3FEKA 1LICA 1DZJA 1OEKA 2GJ5A 3PECA 4YKOA 3ZQ3A 1UREA 3VG7A 2Q2PA 3B2KA 3BSZE 3KFIA 4IB6A 1BSOA 2KTDA 3BRNA 3WJDA 5FFHA 5HBSA 3CQRA 4IB9A 2Q2MA 5EZ2A 2WEXA 4IBAA 2BLGA 3RZYA 5L8OA 1KZXA 2RD7C 4RUNA 5DG4A 3PP6A 4I3CA 1VYGA 1XKIA 4UU3A 4IB8A 4ZHDA 1SXXA 4YDAA 3U03A 3WJGA 4AZNA 3KFHA 1BSYA 3VG2A 1KQXA 1B56A 5F6BA 1BJ7A 1EW3A 3TGAA 3FMZA 3K3LA 2ASNX 3FA6A 5H9KA 2GC9A 4XMGA 2NNDA 2WSJA 3PEDA 1OBQA 4ZH6A 1PEEA 2FR2A 2W2AA 3WBGA 3TZSA 3PH6A 1T68X 1BLRA 3F8AA 2OVDA 1YWDA 5D45A 3C78X 4LZUA 1QY0A 1A18A 4EEJA 4YH0A 5BVSA 5HA1A 4ZHHA 4MVKA 5HAEA 4WBKA 1LNMA 1GX9A 3FELA 4YGGA 1IFCA 3APUA 3FLLA 1NGLA 5HCCC 2ACPX 1EXSA 1BBPA 1OBUA 5EEEA 3RSWA 1GM6A 4TQ2A 2XSTA 1HQPA 3B2JA 1TW4A 2A2GA 3I17A 4XMFA 5HWZA 5L8NA 4A60A 1QY2A 2AKQA 4WFVA 4QGVA 4AZRA 2NP1A 4AZMA 3KZAA 3MVFA 1MUPA 2AL0X 4QZTA 2JU3A 4YGHA 4YFPA 3APXA 1EPBA 4O9SA 1X71A 1OEJA 1IKEA
chains in the Genus database with same CATH superfamily
1SWKA 2AVIA 1SWJA 1STSB 5LJCA 1PTSA 1GT3A 1ZRYA 4GE1A 4IRWA 1B8EA 4O3XB 4COTA 3WZOA 1KT6A 5LJEA 1OBPA 2L68A 1UZ2X 4JNJA 1G7NA 1K24A 4ZFXA 2DJFA 1LCWA 3JQOA 4Y5DA 1BSQA 2JN3A 4GJSA 3SZJA 4IB7A 1N0SA 5AJBA 1S44A 5LJKA 1TXLA 4MISA 4GDZA 2X45A 2FR3A 3LV4A 1Y0GA 5LJHA 3C77X 1ZNHA 1Y52X 2AT5X 1RAVA 2C1QA 4MEEA 4NP1A 2XKLA 1FTPA 5F1EA 3VHHA 5F7GA 2FWVA 5F2BA 2QO4A 2FTBA 1VWEB 5HA0A 1MDCA 4O3YA 2CAMA 1FE3A 2RTQB 3E3CA 4QZUA 5IRUA 3KFFA 5C0NA 4I9SA 4ZCBA 2R73A 3D95A 3S26A 3VE2A 2HMBA 4CPIA 5HZ5A 1G74A 1L6MA 2JU7A 5B3MO 1LIFA 1SRFA 1SWFA 1YP7A 4GRJA 4YFQA 1VYFA 3UEUA 2IZEB 3VPJE 5F58A 1KGLA 2FLJA 4LZVA 2WQ9A 1GXAA 2OVEA 1LPJA 2VDFA 1SXUA 4YCEA 2IZLB 4BX7A 3H3IA 2IZCB 2IZHB 2GTLN 4YKMA 4ARHA 2BC3A 2BT9A 3JS1A 4GU8A 3SZHA 5B5FA 4Z6JA 2CBRA 4ALBA 1YWCA 1DFVA 2L9CA 3ZW0B 1GKAA 2OY7A 4KC7A 1JJXA 2QO6A 1EUOA 1YUPA 2X4MA 1NP1A 5CHKA 4GNWA 1N43A 4I60A 1SLDB 2N93A 4GH7A 5B29A 4QNIA 5IO5A 2Z4IA 1E00A 2Y3EA 2X46A 4BX7B 2OVSA 3GAQA 1X89A 3HOEA 4OKAA 1VWOB 2LFOA 4Y0PA 3BDRA 2HYSA 4TKBA 1GGLA 1GKAB 1AQBA 5KIDA 1QABE 2JOZA 2K62A 2R56A 3C76X 3OJYC 5B27A 1IKJA 1VWKB 3BS2A 3CWKA 3NPOA 4ORYA 1T8VA 5FAZA 1GT1A 1QG5A 5LKFA 4B55A 2HZQA 1VWPB 4N7DA 1MX8A 2QO5A 3EM0A 4Z27A 2F09A 2X34A 3HK1A 1AB0A 3O22A 4EXZA 1K3BA 1SLEB 3WJEA 4C5PA 1SWSA 2RTGB 3HWEA 4GETA 5EDCA 3FR4A 1SWPA 1JMZA 1I04A 1VPRA 5KHPA 5BVQA 3T2XA 4L3RA 1JZUA 4NLIA 3WJCA 2G5LA 4RUUA 3WJFA 1JJJA 4YVBA 3UEVA 2JU8A 1KFFA 2WPUA 3KQ0A 1SLGB 5IO6A 4IAWA 2I5VO 1VWQB 2FT9A 1LIEA 2MF6A 4K19A 1OPAA 1VWRB 2OF9A 4M7MA 4OS8A 4ALOA 4BX5A 3RE6A 3BLGA 3FIDA 4OS0A 1SWDA 1HBQA 2RTEB 4YBUA 1QY1A 3QQ2A 5H9LA 1O8VA 4ZGFA 1O1VA 1ZNLA 1RBPA 1RLBE 4FGIB 3WXQA 2KTSA 4GKCA 5H8TA 1AVGI 1LDQA 5B11O 2FS6A 4NLJA 2IZGB 4WHIA 4BX5B 4HPCA 3FENA 3EBWA 1SWHA 2IZKA 2CM9A 4ORSA 3B2HA 5H9AA 2OFBA 3B2LA 1KL3A 2X32A 2KW1A 3ELXA 3MBTA 3RY2A 1GX8A 1XCAA 3L4RA 1A3YA 3V8UA 1KT7A 2RTOB 1SWLA 4YDBA 3FR2A 2QCBA 3D9WA 1SRHA 3BU1A 3MG5A 3CQNA 5FENA 2LB6A 5K06A 1SWTA 1VWNB 1IIUA 3BX7A 3FA8A 4ORRA 2OFRX 4PJ2A 4TKHA 3RY1A 5K68A 3EMMA 4Z2PA 1AVEA 2HKDA 4ODDA 1KT4A 2WUTA 1CRBA 4GK9A 3RBYA 4U8UN 3VGWA 1STPA 4ORXA 1KXOA 1PMPA 1YWBA 2PY1A 1Y9LA 4GD9A 1EPAA 1ERBA 1DF3A 2YMSA 2A8GA 2OY8A 1G85A 3HWGA 4ON1A 4BX6B 3QKGA 2IZDB 2RTCB 3B2IA 4MVIA 2BSZA 3NP1A 1EALA 3VG6A 3EBKA 4KIIA 4XMHA 1D3SA 1A2DA 3NQKA 1SWQA 4Z28A 3U9PC 2AT0X 1D2UA 1SMPI 1W5RA 2IZJA 1SWAA 4KT5A 3WZPA 1LDOA 3FA9A 4ML7B 4OEMA 4A1YA 1OPBA 4CK4A 3ZW1A 4YBPA 4HFOA 3KFGA 4BOEA 3EC5A 2FGSA 2POAA 1CBRA 4TKJA 5JD2A 3T6FA 1Z24A 3S5XA 1G5WA 1RSUB 3CR6A 4YCHA 2G78A 3X00A 1DZMA 1JBHA 3LHNA 1FENA 1GT5A 3S5VA 4ES7A 1CBQA 1PBOA 2IFBA 2UYWA 3NQ9A 5HTDA 4I3DA 5EPQA 2WR6A 2QOMA 2QMIA 3ELZA 1FELA 2A5CA 5HTEA 4HPDA 4Y0QA 5D4AA 1STRB 4NV8A 1LCZA 4CPFA 3TF6A 4CDCA 2RCQA 3EYCA 1SXWA 3P6GA 4BGFA 1KL4A 1I78A 3F9DA 5HZ8A 1GT4A 1BWYA 1ALBA 4DNEA 1SY0A 2WEWA 4ZR2A 3VHIA 5HCEC 1LELA 3PDFA 1CBIA 1HXLA 2L5PA 4MIRA 3NX2A 1MM9A 2AT8X 4TLJA 2F73A 1EIOA 2MO5A 4FBOA 1MX7A 1BRPA 1Y53X 1SWGA 5LJGA 4ORUA 4CDDA 4ZHCA 5AQ6A 2GTLM 2CZTA 3T1DA 4DQ4A 1QQSA 1JMXA 5B5GA 2RTNB 1NQNA 1U17A 1KL5A 4I3BA 4XMCA 3WJBA 2BS6A 1W4TA 1W6FA 2RTIB 1KZWA 1DZKA 1ZNDA 4UU2A 1UYNX 1TVQA 4EDEA 3P6FA 1N7YA 3MM0A 4GNYA 1RXKA 1SY3A 4QYNA 3FR5A 1TOWA 2MHDA 2X8TA 2PI3O 3P6CA 2AH7X 2MM3A 1CJ5A 4ORWA 1VWCB 2HZRA 1H91A 2LA7A 4U3QA 4DCBA 1KT5A 1X8PA 1SRJA 4O3WA 4R0BA 4JGLA 2AF5A 2RTKA 2WQAE 1VWFB 1QFTA 2FHNX 3HWDA 5EDBA 2RA6A 1QFVA 3NQ3A 4HPAA 2WWPA 1IJ8A 3Q6LA 1SRGA 1SY1A 1SWNA 5CE4A 3AKNA 1I4UA 5H9NA 2C1SA 1JQPA 1VWIB 5HZQA 1HY2A 2CBSA 3JSQA 1X8QA 2DM5A 1MVGA 2M4LA 3TGBA 1HMSA 2RTPB 3I0AA 4YGZA 1MEPA 3WOVA 3WZQA 2W2FA 1SWBA 4QYPA 4MVEA 3HWFA 3MX7A 3SZIA 2CZUA 4IMNA 5FQ8E 3FIQA 3APWA 5K67A 2OL8O 2F01A 2KD2A 2MWHA 1YWAA 4O49A 5FQ7E 4OMXA 4ZHDA 3AKMA 3HPEA 2LKKA 4KH8A 2LBAA 4Z2OA 3T2WA 1LIDA 2IZIA 1P6PA 3NADA 1ADLA 3CBCA 1NBXA 1LUQA 3KVNA 1DF8A 1KOIA 3OD9A 4U9CA 5F6ZA 5FQ6E 3SLOA 4QQ1A 3ZI8A 2O62A 2W2BA 1VWHB 2I5ZO 3RE5A 4A8ZA 5CSEA 2QM9A 3FW4A 3OE3A 2RQ0A 5EEDA 1HN2A 1LIBA 5D8JA 3IA8A 3SOTA 2Q4NA 2ANSA 4NYRA 4Y0SA 4ZHFA 2QOSC 2EU7X 2OVAA 1LFOA 4GGTA 4CV7A 2ACOA 1IFBA 1N4JA 4CSBA 1X8NA 4OMWA 5B2AO 1S2PA 3UAQA 3VG4A 1ZNEA 4BVMA 1U0XA 3ZWEA 4ZGUA 1IW2A 4BBOA 1I06A 3RDXA 1FDQA 3BX8A 4I9RA 2BHVA 2OF8A 4WFUA 4CPHA 2Q39A 4ZHGA 2E4JA 1JYJA 5IRWA 5D47A 5LKEA 4IMOA 4FQBB 4AYHA 3EW2A 4EKVA 3N91A 1E06A 2RTLA 3BU9A 3P6HA 2NNEA 4ZJ0A 3FYFA 3PH5A 4BJ8A 4HPBA 4QGWA 2X8FA 2ZSCA 5L8IA 4CDFA 1B4MA 1U18A 3VU1A 2A0AA 4KCAA 3DSZA 2K23A 4CPHB 4IAXA 5JR8A 5D48A 3FEPA 2IZBA 2OFMX 1EQDA 2LBVA 3ZUIA 3O2YA 3NR3A 1WBIA 1YIVA 4GJVA 2Z4HA 4NNSA 4O4XA 1A57A 4OS3A 2P8GA 4U8UM 4A1HA 4QGXA 4Y0RA 3D96A 4QAEA 1B0OA 3NX1A 4DQ3A 2RTFB 3IFBA 2AT3X 2HLVA 3WYQA 4BCSA 1T0VA 1ACDA 3WZNA 3D97A 2FRSA 1ZNKA 2AMMX 2GTFX 1SXYA 2G79A 1HXZA 2R74A 3PPTA 2OL7A 2YG2A 4U46A 1OEEA 4LKTA 4PSQA 1NDJA 1N9MA 5BYPA 1ERXA 3P6DA 1E5PA 1JJUA 1SWCA 1VWJB 2A3FX 2GH7A 1DC9A 3P6EA 4TNNA 3G7XA 5AEOA 5KICA 1LF7A 1LKEA 5LJBA 1PBYA 3APVA 1SY2A 1AELA 2VFCA 1R0UA 2OL6O 1YP6A 3SAOA 3UEXA 1DV9A 3CBSA 1PM1X 4ZH9A 2HNXA 3FA7A 1CBSA 2GTLO 3BY0A 3RDSA 5HCDC 3WVMA 3O19A 4MVLA 3ZW1B 1MK5A 2JW1A 2Y3FA 1X8UA 1FEMA 4BQUA 2JGSA 4N7CA 2G8CO 2Q9SA 4YFRA 5BVTA 1ICMA 3CMPA 2L67A 4EQAC 4I95A 3UEWA 4O3ZA 4CDEA 1QWDA 1JV4A 2BS5A 1X8OA 1JYDA 4D6AA 4TJZA 2MJIA 3D4RA 3STKA 1ICNA 3ZUOA 4AZQA 2DJGA 4XMEA 1VWBB 1BRQA 4Z2VA 2OFAA 4EFGA 2OZQA 1NP4A 2VFBA 2IZAA 2ZAIA 1KT3A 1ZNGA 2NNQA 1DZPA 4NW4A 4NYQA 1EI5A 4XMDA 1EIIA 1BM5A 1BEBA 1TOUA 4ID2A 2CM4A 4M6SA 1GX3A 2FS7A 1KQWA 2RTHB 3STNA 4D6BA 1SWUA 4LKPA 1HMRA 1VWDB 2KT4B 2RCTA 1HBPA 1WUBA 4AZOA 5L3YA 1VYOA 1VWAB 4FBRA 3TGCA 3ZW0A 5HZ6A 3VE1A 4HWMA 1I9HA 1FJ1E 3DTQA 5DPQA 2FKGA 4L1NA 2X56A 1JIWI 4GUZA 4Y59A 3VG5A 5IO7A 3FW5A 2FKJA 2RTMA 1Y9TA 2ALLX 1SA8A 1HMTA 4NNTA 2OY5O 4YMYA 1S7DA 5LJDA 1O1UA 2G7BA 5HZ9A 3U0DA 2JMBA 1I05A 2A13A 4I6SA 4GGZA 1ML7A 3T6LA 2AT6X 2A2UA 3VG3A 4AZPA 1E02A 1LCVA 3STMX 1RXJA 3EW1A 3FEKA 2OY1O 1LICA 1DZJA 1OEKA 1OSPO 2GJ5A 3PECA 4YKOA 3SLJA 3ZQ3A 1UREA 3CKFA 3VG7A 2Q2PA 3B2KA 3BSZE 3KFIA 4O4OA 3P02A 1RXHA 5B10O 3Q34A 4FBVA 4IB6A 1BSOA 1SWRA 3VHMA 2RTAA 2KTDA 3BRNA 4GDAA 4LQZA 3WJDA 5FFHA 3P24A 5HBSA 3CQRA 2Y32A 4IB9A 2Q2MA 5EZ2A 1SRIA 3AUMO 4O4SA 2WEXA 3RKGA 1SWEA 4IBAA 2BLGA 1SWOA 3RZYA 5L8OA 1KZXA 2RD7C 5AJCA 2C4IA 3RWXA 4RUNA 5DG4A 3PP6A 3PQUA 1MOYA 2OYBO 3OBLA 1VYGA 1XKIA 2FHLA 4I3CA 4UU3A 2IZFB 2ZAGA 4IB8A 1SXXA 3PK2A 4OELA 4U8UO 4YDAA 3WJGA 3KFHA 4AZNA 3U03A 1BSYA 2A5BA 2RTBB 3VG2A 4CPEA 2RTRB 1KQXA 1B56A 3RDMA 5F6BA 1BJ7A 2RN4A 2RTDB 1EW3A 4JHQA 3TGAA 4NV7A 3FMZA 3FDCA 1HQQA 3K3LA 1SREA 3LTWA 2ASNX 3FA6A 4IABA 3WYPA 5H9KA 2GC9A 3HOLA 4XMGA 2NNDA 2WSJA 3PEDA 1OBQA 4ZH6A 1RSTB 4KC8A 1PEEA 1VWMB 2FR2A 2W2AA 1VWGB 3WBGA 3TZSA 3PH6A 2RTJA 1T68X 4JO6A 1BLRA 3F8AA 2UZ2A 3AEHA 1E2TA 2OVDA 3GE2A 4GZVA 1YWDA 5D45A 3C78X 4LZUA 4QRLA 3SLTA 1QY0A 3PQSA 5CYBA 3NBXX 1UYOX 1A18A 1VWLB 4EEJA 1NC9A 5IXGA 3CKGA 4YH0A 5BVSA 5HA1A 4ZHHA 4MVKA 1N9YA 5HAEA 4GGRA 4WBKA 1LNMA 1GX9A 3FELA 4YGGA 1IFCA 4BX6A 1Y55X 3APUA 3RDOA 3FLLA 1NGLA 3RDQA 5HCCC 2ACPX 1NQMA 1EXSA 1BBPA 4AW8A 3F6ZB 1OBUA 2X55A 5EEEA 3RSWA 1GM6A 4TQ2A 2X8SA 2XSTA 1HQPA 5IRAA 3ZZVA 3B2JA 1TW4A 4INNA 1AVDA 2A2GA 3I17A 4XMFA 3S60A 3RDUA 5HWZA 5L8NA 4A60A 3ZW2A 1QY2A 2AKQA 4WFVA 4QGVA 4AZRA 2NP1A 4AZMA 3KZAA 3MVFA 1MUPA 2AL0X 4QZTA 2JU3A 4YGHA 4YFPA 1SLFB 1EPBA 3APXA 4O4UA 4O9SA 3HTYA 1X71A 1OEJA 1IKEA
chains in the Genus database with same CATH topology
5LJCA 4GE1A 1GT3A 1ZRYA 4COTA 1B8EA 4O3XB 1KT6A 5LJEA 1OBPA 2L68A 1UZ2X 1G7NA 4ZFXA 3JQOA 1BSQA 2JN3A 5LJKA 4IB7A 1N0SA 5AJBA 1S44A 1TXLA 4MISA 4GDZA 2X45A 2FR3A 3LV4A 5LJHA 3C77X 1ZNHA 2AT5X 4NP1A 2XKLA 1FTPA 5F1EA 5F7GA 2FWVA 2QO4A 2FTBA 5HA0A 1MDCA 4O3YA 1FE3A 3E3CA 4QZUA 3KFFA 5C0NA 4I9SA 4ZCBA 2R73A 3D95A 3S26A 3VE2A 2HMBA 5HZ5A 1G74A 1L6MA 2JU7A 1LIFA 1YP7A 4GRJA 4YFQA 1VYFA 3UEUA 3VPJE 5F58A 1KGLA 2FLJA 4LZVA 2WQ9A 1GXAA 2OVEA 1LPJA 1SXUA 4YCEA 3H3IA 4YKMA 4ARHA 2GTLN 2BT9A 3JS1A 4GU8A 2CBRA 4ALBA 1YWCA 1DFVA 2L9CA 3ZW0B 1GKAA 4KC7A 1JJXA 2QO6A 1EUOA 1YUPA 1NP1A 4GNWA 2N93A 4GH7A 5B29A 4QNIA 5IO5A 2Z4IA 1E00A 2X46A 2OVSA 3GAQA 1X89A 3HOEA 2LFOA 4Y0PA 3BDRA 2HYSA 4TKBA 1GGLA 1GKAB 1AQBA 5KIDA 1QABE 2JOZA 2K62A 2R56A 3C76X 3OJYC 5B27A 1IKJA 3BS2A 3CWKA 3NPOA 4ORYA 1T8VA 5FAZA 1GT1A 1QG5A 5LKFA 2HZQA 4N7DA 1MX8A 2QO5A 3EM0A 2F09A 3HK1A 3O22A 1AB0A 4EXZA 3WJEA 4GETA 3HWEA 5EDCA 3FR4A 1I04A 1VPRA 5KHPA 5BVQA 4L3RA 1JZUA 4NLIA 3WJCA 3WJFA 4RUUA 1JJJA 3UEVA 2JU8A 3KQ0A 5IO6A 4IAWA 2FT9A 1LIEA 4K19A 1OPAA 4M7MA 4OS8A 4ALOA 3BLGA 4OS0A 4YBUA 1HBQA 1QY1A 5H9LA 1O8VA 4ZGFA 1O1VA 1ZNLA 1RBPA 1RLBE 4FGIB 3WXQA 2KTSA 4GKCA 5H8TA 1AVGI 2FS6A 4NLJA 4WHIA 4HPCA 3FENA 3EBWA 2CM9A 4ORSA 3B2HA 5H9AA 3B2LA 3MBTA 2KW1A 3ELXA 3V8UA 1GX8A 1XCAA 3L4RA 1A3YA 1KT7A 4YDBA 3FR2A 5K06A 3BU1A 3CQNA 5FENA 2LB6A 1IIUA 3BX7A 3FA8A 4ORRA 2OFRX 4PJ2A 4TKHA 3EMMA 4ODDA 1KT4A 2WUTA 1CRBA 4GK9A 3RBYA 4U8UN 4ORXA 1KXOA 1PMPA 1YWBA 2PY1A 1Y9LA 1EPAA 1ERBA 1DF3A 2YMSA 1G85A 3HWGA 4ON1A 3QKGA 3B2IA 4MVIA 3NP1A 1EALA 3VG6A 3EBKA 4KIIA 4XMHA 1D3SA 1A2DA 3NQKA 3U9PC 4AW8A 2AT0X 1D2UA 1SMPI 4KT5A 4ML7B 3FA9A 4A1YA 1OPBA 4CK4A 3ZW1A 4YBPA 4HFOA 3KFGA 4BOEA 1A57A 4TKJA 2POAA 1CBRA 1G5WA 1Z24A 3S5XA 3CR6A 4YCHA 2G78A 1DZMA 1JBHA 3LHNA 1FENA 1GT5A 3S5VA 4ES7A 1CBQA 1PBOA 2IFBA 3NQ9A 5HTDA 4I3DA 5EPQA 2WR6A 2QMIA 3ELZA 1FELA 5HTEA 4HPDA 4Y0QA 5D4AA 3TF6A 2RCQA 3EYCA 1SXWA 3P6GA 3F9DA 5HZ8A 1GT4A 1BWYA 1ALBA 1SY0A 2WEWA 4ZR2A 5HCEC 1CBIA 2L5PA 4MIRA 3NX2A 4TLJA 2AT8X 2F73A 1EIOA 2MO5A 4FBOA 1MX7A 1BRPA 5LJGA 4ORUA 4ZHCA 5AQ6A 2GTLM 2CZTA 3T1DA 4DQ4A 1QQSA 4XMCA 1U17A 3WJBA 4I3BA 2BS6A 1KZWA 1DZKA 1ZNDA 4UU2A 1TVQA 4EDEA 3P6FA 4GNYA 1SY3A 4QYNA 3FR5A 1TOWA 2MHDA 2X8TA 3P6CA 2AH7X 2MM3A 1CJ5A 4ORWA 4U3QA 2HZRA 1H91A 2LA7A 1KT5A 1X8PA 4O3WA 4R0BA 4JGLA 2WQAE 3HWDA 1QFTA 5EDBA 2RA6A 1QFVA 3NQ3A 4HPAA 2WWPA 3Q6LA 1SY1A 5CE4A 3AKNA 1I4UA 5H9NA 5HZQA 2CBSA 3JSQA 1X8QA 2M4LA 1MVGA 2DM5A 3TGBA 1HMSA 3I0AA 4YGZA 3WOVA 2W2FA 4QYPA 4MVEA 3HWFA 3MX7A 2CZUA 4IMNA 5FQ8E 3FIQA 3APWA 2KD2A 2MWHA 4O49A 1YWAA 5FQ7E 4OMXA 3AKMA 2LKKA 4KH8A 2LBAA 1LIDA 1P6PA 3NADA 1ADLA 3CBCA 4U9CA 5F6ZA 1KOIA 3OD9A 5FQ6E 4QQ1A 3ZI8A 2O62A 2W2BA 4A8ZA 2QM9A 3FW4A 3OE3A 2RQ0A 5EEDA 1HN2A 1LIBA 5D8JA 3IA8A 3SOTA 2Q4NA 2ANSA 4NYRA 4Y0SA 4ZHFA 2QOSC 2EU7X 2OVAA 1LFOA 4CV7A 2ACOA 1IFBA 4CSBA 1X8NA 4OMWA 3UAQA 1S2PA 3VG4A 1ZNEA 4BVMA 1U0XA 3ZWEA 4ZGUA 1IW2A 1I06A 1FDQA 3BX8A 4I9RA 2BHVA 4WFUA 2Q39A 4ZHGA 2E4JA 1JYJA 5D47A 5LKEA 4IMOA 4FQBB 4AYHA 3N91A 1E06A 3BU9A 3P6HA 2NNEA 4ZJ0A 3FYFA 3PH5A 4HPBA 4QGWA 2X8FA 5L8IA 1B4MA 1U18A 3VU1A 2A0AA 4KCAA 3DSZA 2K23A 4IAXA 5JR8A 5D48A 3FEPA 2OFMX 1EQDA 2LBVA 3ZUIA 3O2YA 3NR3A 4O4XA 1YIVA 4NNSA 2Z4HA 4OS3A 2P8GA 4U8UM 4A1HA 4QGXA 4Y0RA 3D96A 4QAEA 1B0OA 3NX1A 4DQ3A 3IFBA 2AT3X 2HLVA 1T0VA 1ACDA 3D97A 2FRSA 1ZNKA 2AMMX 2GTFX 1SXYA 2G79A 2R74A 3PPTA 2YG2A 1OEEA 4LKTA 4PSQA 5BYPA 1ERXA 3P6DA 1E5PA 3P6EA 5AEOA 2A3FX 5KICA 1DC9A 4TNNA 3G7XA 1LF7A 1LKEA 5LJBA 3APVA 1SY2A 1AELA 1R0UA 1YP6A 3SAOA 3UEXA 1DV9A 3CBSA 1PM1X 4ZH9A 2HNXA 3FA7A 1CBSA 2GTLO 3BY0A 5HCDC 3WVMA 3O19A 4MVLA 3ZW1B 2JW1A 1X8UA 1FEMA 4BQUA 4N7CA 4YFRA 2Q9SA 5BVTA 1ICMA 3CMPA 2L67A 4EQAC 4I95A 3UEWA 4O3ZA 1QWDA 1JV4A 2BS5A 1X8OA 1JYDA 4D6AA 4TJZA 2MJIA 3D4RA 3STKA 1ICNA 3ZUOA 4AZQA 4XMEA 1BRQA 4EFGA 2OZQA 1NP4A 2ZAIA 1KT3A 2NNQA 1ZNGA 1DZPA 4NW4A 4NYQA 1EI5A 4XMDA 1EIIA 1BM5A 1BEBA 1TOUA 4ID2A 2CM4A 4M6SA 2FS7A 1KQWA 3STNA 4D6BA 4LKPA 1HMRA 2KT4B 2RCTA 1HBPA 4AZOA 4FBRA 3TGCA 3ZW0A 5HZ6A 3VE1A 4HWMA 3DTQA 5DPQA 4L1NA 1JIWI 3VG5A 5IO7A 3FW5A 1Y9TA 2ALLX 1SA8A 1HMTA 4NNTA 4YMYA 1S7DA 5LJDA 1O1UA 2G7BA 5HZ9A 3U0DA 2JMBA 1I05A 2A13A 4I6SA 1ML7A 2AT6X 2A2UA 3VG3A 4AZPA 1E02A 3STMX 3FEKA 1LICA 1DZJA 1OEKA 2GJ5A 3PECA 4YKOA 3ZQ3A 1UREA 3VG7A 2Q2PA 3B2KA 3BSZE 3KFIA 4O4OA 3P02A 4IB6A 4FBVA 1BSOA 2KTDA 3BRNA 4LQZA 3WJDA 5FFHA 3P24A 5HBSA 3CQRA 4IB9A 2Q2MA 5EZ2A 4O4SA 2WEXA 3RKGA 4IBAA 2BLGA 3RZYA 5L8OA 1KZXA 2RD7C 5AJCA 3RWXA 4RUNA 5DG4A 3PP6A 3PQUA 3OBLA 1VYGA 1XKIA 4I3CA 4UU3A 2ZAGA 4IB8A 4U8UO 1SXXA 4YDAA 4ZHDA 3WJGA 4AZNA 3U03A 3KFHA 1BSYA 3VG2A 1KQXA 1B56A 5F6BA 1BJ7A 2RN4A 1EW3A 3TGAA 3FMZA 4IABA 3K3LA 2ASNX 3FA6A 5H9KA 2GC9A 3HOLA 4XMGA 2NNDA 2WSJA 3PEDA 1OBQA 4ZH6A 1PEEA 4KC8A 2FR2A 2W2AA 3WBGA 3TZSA 3PH6A 1T68X 1BLRA 3F8AA 2OVDA 3GE2A 4GZVA 1YWDA 5D45A 3C78X 4LZUA 4QRLA 1QY0A 3PQSA 5CYBA 3NBXX 1A18A 4EEJA 4YH0A 5BVSA 5HA1A 4ZHHA 4MVKA 5HAEA 4WBKA 1LNMA 1GX9A 3FELA 4YGGA 1IFCA 3APUA 3FLLA 1NGLA 5HCCC 2ACPX 1EXSA 1BBPA 3F6ZB 1OBUA 5EEEA 3RSWA 1GM6A 4TQ2A 2X8SA 2XSTA 1HQPA 3ZZVA 3B2JA 1TW4A 4INNA 2A2GA 3I17A 4XMFA 3S60A 5HWZA 5L8NA 4A60A 3ZW2A 1QY2A 2AKQA 4WFVA 4QGVA 4AZRA 2NP1A 4AZMA 3KZAA 3MVFA 1MUPA 2AL0X 4QZTA 2JU3A 4YGHA 4YFPA 3APXA 1EPBA 4O4UA 4O9SA 3HTYA 1X71A 1OEJA 1IKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJC A;  4GE1 A;  1GT3 A;  1ZRY A;  1B8E A;  1KT6 A;  5LJE A;  1OBP A;  2L68 A;  1UZ2 X;  1G7N A;  4ZFX A;  1BSQ A;  2JN3 A;  5LJK A;  4IB7 A;  1N0S A;  1S44 A;  1TXL A;  2X45 A;  2FR3 A;  5LJH A;  3C77 X;  1ZNH A;  2AT5 X;  4NP1 A;  2XKL A;  1FTP A;  5F1E A;  5F7G A;  2FWV A;  2QO4 A;  2FTB A;  5HA0 A;  1MDC A;  1FE3 A;  4QZU A;  3KFF A;  5C0N A;  4I9S A;  4ZCB A;  2R73 A;  3D95 A;  3S26 A;  2HMB A;  5HZ5 A;  1G74 A;  1L6M A;  2JU7 A;  1LIF A;  1YP7 A;  4GRJ A;  4YFQ A;  1VYF A;  3UEU A;  5F58 A;  1KGL A;  2FLJ A;  4LZV A;  2WQ9 A;  1GXA A;  2OVE A;  1LPJ A;  1SXU A;  4YCE A;  4ARH A;  4YKM A;  3JS1 A;  2CBR A;  4ALB A;  1YWC A;  1DFV A;  2L9C A;  1GKA A;  1JJX A;  2QO6 A;  1EUO A;  1YUP A;  1NP1 A;  4GNW A;  2N93 A;  4GH7 A;  5B29 A;  5IO5 A;  1E00 A;  2X46 A;  3GAQ A;  1X89 A;  2LFO A;  4Y0P A;  3BDR A;  2HYS A;  4TKB A;  1GGL A;  1GKA B;  1AQB A;  5KID A;  1QAB E;  2JOZ A;  2K62 A;  2R56 A;  3C76 X;  3OJY C;  5B27 A;  1IKJ A;  3BS2 A;  3CWK A;  3NPO A;  4ORY A;  1T8V A;  5FAZ A;  1GT1 A;  1QG5 A;  5LKF A;  2HZQ A;  4N7D A;  1MX8 A;  2QO5 A;  3EM0 A;  3O22 A;  3HK1 A;  4EXZ A;  1AB0 A;  3WJE A;  4GET A;  3HWE A;  5EDC A;  3FR4 A;  1I04 A;  1VPR A;  5KHP A;  5BVQ A;  1JZU A;  4NLI A;  3WJC A;  3WJF A;  4RUU A;  1JJJ A;  3UEV A;  2JU8 A;  3KQ0 A;  5IO6 A;  4IAW A;  2FT9 A;  1LIE A;  4K19 A;  1OPA A;  4M7M A;  4OS8 A;  4ALO A;  3BLG A;  4OS0 A;  4YBU A;  1HBQ A;  1QY1 A;  5H9L A;  1O8V A;  1O1V A;  1ZNL A;  1RBP A;  1RLB E;  3WXQ A;  4GKC A;  5H8T A;  1AVG I;  2FS6 A;  4NLJ A;  4HPC A;  3FEN A;  3EBW A;  2CM9 A;  4ORS A;  3B2H A;  5H9A A;  3B2L A;  3MBT A;  3ELX A;  1GX8 A;  1XCA A;  3L4R A;  1A3Y A;  1KT7 A;  4YDB A;  3FR2 A;  5K06 A;  3BU1 A;  3CQN A;  5FEN A;  2LB6 A;  1IIU A;  3BX7 A;  3FA8 A;  4ORR A;  2OFR X;  4TKH A;  3EMM A;  4ODD A;  1KT4 A;  2WUT A;  1CRB A;  4ORX A;  1KXO A;  1PMP A;  1YWB A;  2PY1 A;  1EPA A;  1ERB A;  1DF3 A;  1G85 A;  3HWG A;  3QKG A;  3B2I A;  4MVI A;  3NP1 A;  1EAL A;  3VG6 A;  3EBK A;  4KII A;  4XMH A;  1D3S A;  1A2D A;  3U9P C;  4AW8 A;  2AT0 X;  1D2U A;  3FA9 A;  4A1Y A;  1OPB A;  4CK4 A;  4YBP A;  4HFO A;  3KFG A;  4BOE A;  1A57 A;  4TKJ A;  2POA A;  1CBR A;  1G5W A;  1Z24 A;  3CR6 A;  4YCH A;  2G78 A;  1DZM A;  1JBH A;  1FEN A;  1GT5 A;  4ES7 A;  1CBQ A;  1PBO A;  2IFB A;  3NQ9 A;  5HTD A;  4I3D A;  5EPQ A;  2WR6 A;  3ELZ A;  1FEL A;  5HTE A;  4HPD A;  4Y0Q A;  5D4A A;  3TF6 A;  2RCQ A;  3EYC A;  1SXW A;  3P6G A;  3F9D A;  5HZ8 A;  1GT4 A;  1BWY A;  1ALB A;  1SY0 A;  2WEW A;  4ZR2 A;  5HCE C;  1CBI A;  2L5P A;  3NX2 A;  4TLJ A;  2AT8 X;  2F73 A;  1EIO A;  2MO5 A;  1MX7 A;  1BRP A;  5LJG A;  4ORU A;  4ZHC A;  5AQ6 A;  3T1D A;  2CZT A;  4DQ4 A;  1QQS A;  4XMC A;  1U17 A;  3WJB A;  4I3B A;  1KZW A;  1DZK A;  1ZND A;  4UU2 A;  1TVQ A;  4EDE A;  3P6F A;  4GNY A;  1SY3 A;  4QYN A;  3FR5 A;  1TOW A;  3P6C A;  2AH7 X;  2MM3 A;  1CJ5 A;  4ORW A;  2HZR A;  1H91 A;  1KT5 A;  1X8P A;  4R0B A;  2WQA E;  3HWD A;  1QFT A;  5EDB A;  2RA6 A;  1QFV A;  3NQ3 A;  4HPA A;  2WWP A;  3Q6L A;  1SY1 A;  5CE4 A;  3AKN A;  1I4U A;  5H9N A;  5HZQ A;  2CBS A;  3JSQ A;  1X8Q A;  2DM5 A;  1MVG A;  3TGB A;  1HMS A;  3I0A A;  4YGZ A;  2W2F A;  4QYP A;  3HWF A;  2CZU A;  4IMN A;  3FIQ A;  3APW A;  1YWA A;  4OMX A;  3AKM A;  2LKK A;  2LBA A;  1LID A;  1P6P A;  3NAD A;  1ADL A;  3CBC A;  5F6Z A;  1KOI A;  2O62 A;  2W2B A;  4A8Z A;  2QM9 A;  3FW4 A;  5EED A;  2RQ0 A;  1HN2 A;  1LIB A;  5D8J A;  3IA8 A;  2Q4N A;  2ANS A;  4NYR A;  4Y0S A;  4ZHF A;  2QOS C;  2EU7 X;  2OVA A;  1LFO A;  2ACO A;  1IFB A;  1X8N A;  4OMW A;  3VG4 A;  1S2P A;  1ZNE A;  4BVM A;  1U0X A;  4ZGU A;  1IW2 A;  1I06 A;  1FDQ A;  3BX8 A;  4I9R A;  4WFU A;  2Q39 A;  4ZHG A;  2E4J A;  1JYJ A;  5D47 A;  5LKE A;  4IMO A;  4AYH A;  1E06 A;  3BU9 A;  3P6H A;  2NNE A;  4ZJ0 A;  3PH5 A;  4HPB A;  4QGW A;  5L8I A;  1B4M A;  1U18 A;  2A0A A;  3DSZ A;  2K23 A;  4IAX A;  5JR8 A;  5D48 A;  3FEP A;  2OFM X;  1EQD A;  2LBV A;  3ZUI A;  3O2Y A;  3NR3 A;  1YIV A;  4NNS A;  4OS3 A;  2P8G A;  4A1H A;  4QGX A;  4Y0R A;  3D96 A;  4QAE A;  1B0O A;  3NX1 A;  4DQ3 A;  3IFB A;  2AT3 X;  2HLV A;  1T0V A;  1ACD A;  3D97 A;  2FRS A;  1ZNK A;  2AMM X;  2GTF X;  1SXY A;  2G79 A;  2R74 A;  3PPT A;  2YG2 A;  1OEE A;  4LKT A;  4PSQ A;  1ERX A;  3P6D A;  1E5P A;  3P6E A;  5KIC A;  2A3F X;  1DC9 A;  4TNN A;  3G7X A;  1LF7 A;  1LKE A;  5LJB A;  3APV A;  1SY2 A;  1AEL A;  1R0U A;  1YP6 A;  3SAO A;  3UEX A;  1DV9 A;  3CBS A;  1PM1 X;  4ZH9 A;  2HNX A;  3FA7 A;  1CBS A;  3BY0 A;  5HCD C;  3WVM A;  3O19 A;  4MVL A;  1X8U A;  1FEM A;  4BQU A;  4N7C A;  4YFR A;  2Q9S A;  5BVT A;  1ICM A;  3CMP A;  2L67 A;  3UEW A;  1QWD A;  1JV4 A;  1X8O A;  1JYD A;  4D6A A;  4TJZ A;  2MJI A;  3STK A;  1ICN A;  3ZUO A;  4AZQ A;  4XME A;  1BRQ A;  4EFG A;  2OZQ A;  1NP4 A;  1KT3 A;  1ZNG A;  2NNQ A;  1DZP A;  4NYQ A;  1EII A;  4XMD A;  1BM5 A;  1BEB A;  1TOU A;  2CM4 A;  4M6S A;  2FS7 A;  1KQW A;  3STN A;  4D6B A;  4LKP A;  1HMR A;  2KT4 B;  2RCT A;  1HBP A;  4AZO A;  3TGC A;  5HZ6 A;  3DTQ A;  5DPQ A;  3VG5 A;  5IO7 A;  3FW5 A;  2ALL X;  1SA8 A;  1HMT A;  4NNT A;  4YMY A;  1S7D A;  5LJD A;  1O1U A;  2G7B A;  5HZ9 A;  3U0D A;  1I05 A;  2A13 A;  1ML7 A;  2AT6 X;  2A2U A;  3VG3 A;  4AZP A;  1E02 A;  3STM X;  3FEK A;  1LIC A;  1DZJ A;  1OEK A;  2GJ5 A;  3PEC A;  4YKO A;  3ZQ3 A;  1URE A;  3VG7 A;  2Q2P A;  3B2K A;  3BSZ E;  3KFI A;  4IB6 A;  1BSO A;  2KTD A;  3BRN A;  3WJD A;  5FFH A;  5HBS A;  3CQR A;  4IB9 A;  2Q2M A;  5EZ2 A;  2WEX A;  4IBA A;  2BLG A;  3RZY A;  5L8O A;  1KZX A;  2RD7 C;  4RUN A;  5DG4 A;  3PP6 A;  4I3C A;  1VYG A;  1XKI A;  4UU3 A;  4IB8 A;  4ZHD A;  1SXX A;  4YDA A;  3U03 A;  3WJG A;  4AZN A;  3KFH A;  1BSY A;  3VG2 A;  1KQX A;  1B56 A;  5F6B A;  1BJ7 A;  1EW3 A;  3TGA A;  3FMZ A;  3K3L A;  2ASN X;  3FA6 A;  5H9K A;  2GC9 A;  4XMG A;  2NND A;  2WSJ A;  3PED A;  1OBQ A;  4ZH6 A;  1PEE A;  2FR2 A;  2W2A A;  3WBG A;  3TZS A;  3PH6 A;  1T68 X;  1BLR A;  3F8A A;  2OVD A;  1YWD A;  5D45 A;  3C78 X;  4LZU A;  1QY0 A;  1A18 A;  4EEJ A;  4YH0 A;  5BVS A;  5HA1 A;  4ZHH A;  4MVK A;  5HAE A;  4WBK A;  1LNM A;  1GX9 A;  3FEL A;  4YGG A;  1IFC A;  3APU A;  3FLL A;  1NGL A;  5HCC C;  2ACP X;  1EXS A;  1BBP A;  1OBU A;  5EEE A;  3RSW A;  1GM6 A;  4TQ2 A;  2XST A;  1HQP A;  3B2J A;  1TW4 A;  2A2G A;  3I17 A;  4XMF A;  5HWZ A;  5L8N A;  4A60 A;  1QY2 A;  2AKQ A;  4WFV A;  4QGV A;  4AZR A;  2NP1 A;  4AZM A;  3KZA A;  3MVF A;  1MUP A;  2AL0 X;  4QZT A;  2JU3 A;  4YGH A;  4YFP A;  3APX A;  1EPB A;  4O9S A;  1X71 A;  1OEJ A;  1IKE A; 
#chains in the Genus database with same CATH topology
 1SWK A;  2AVI A;  1SWJ A;  1STS B;  5LJC A;  1PTS A;  1GT3 A;  1ZRY A;  4GE1 A;  4IRW A;  1B8E A;  4O3X B;  4COT A;  3WZO A;  1KT6 A;  5LJE A;  1OBP A;  2L68 A;  1UZ2 X;  4JNJ A;  1G7N A;  1K24 A;  4ZFX A;  2DJF A;  1LCW A;  3JQO A;  4Y5D A;  1BSQ A;  2JN3 A;  4GJS A;  3SZJ A;  4IB7 A;  1N0S A;  5AJB A;  1S44 A;  5LJK A;  1TXL A;  4MIS A;  4GDZ A;  2X45 A;  2FR3 A;  3LV4 A;  1Y0G A;  5LJH A;  3C77 X;  1ZNH A;  1Y52 X;  2AT5 X;  1RAV A;  2C1Q A;  4MEE A;  4NP1 A;  2XKL A;  1FTP A;  5F1E A;  3VHH A;  5F7G A;  2FWV A;  5F2B A;  2QO4 A;  2FTB A;  1VWE B;  5HA0 A;  1MDC A;  4O3Y A;  2CAM A;  1FE3 A;  2RTQ B;  3E3C A;  4QZU A;  5IRU A;  3KFF A;  5C0N A;  4I9S A;  4ZCB A;  2R73 A;  3D95 A;  3S26 A;  3VE2 A;  2HMB A;  4CPI A;  5HZ5 A;  1G74 A;  1L6M A;  2JU7 A;  5B3M O;  1LIF A;  1SRF A;  1SWF A;  1YP7 A;  4GRJ A;  4YFQ A;  1VYF A;  3UEU A;  2IZE B;  3VPJ E;  5F58 A;  1KGL A;  2FLJ A;  4LZV A;  2WQ9 A;  1GXA A;  2OVE A;  1LPJ A;  2VDF A;  1SXU A;  4YCE A;  2IZL B;  4BX7 A;  3H3I A;  2IZC B;  2IZH B;  2GTL N;  4YKM A;  4ARH A;  2BC3 A;  2BT9 A;  3JS1 A;  4GU8 A;  3SZH A;  5B5F A;  4Z6J A;  2CBR A;  4ALB A;  1YWC A;  1DFV A;  2L9C A;  3ZW0 B;  1GKA A;  2OY7 A;  4KC7 A;  1JJX A;  2QO6 A;  1EUO A;  1YUP A;  2X4M A;  1NP1 A;  5CHK A;  4GNW A;  1N43 A;  4I60 A;  1SLD B;  2N93 A;  4GH7 A;  5B29 A;  4QNI A;  5IO5 A;  2Z4I A;  1E00 A;  2Y3E A;  2X46 A;  4BX7 B;  2OVS A;  3GAQ A;  1X89 A;  3HOE A;  4OKA A;  1VWO B;  2LFO A;  4Y0P A;  3BDR A;  2HYS A;  4TKB A;  1GGL A;  1GKA B;  1AQB A;  5KID A;  1QAB E;  2JOZ A;  2K62 A;  2R56 A;  3C76 X;  3OJY C;  5B27 A;  1IKJ A;  1VWK B;  3BS2 A;  3CWK A;  3NPO A;  4ORY A;  1T8V A;  5FAZ A;  1GT1 A;  1QG5 A;  5LKF A;  4B55 A;  2HZQ A;  1VWP B;  4N7D A;  1MX8 A;  2QO5 A;  3EM0 A;  4Z27 A;  2F09 A;  2X34 A;  3HK1 A;  1AB0 A;  3O22 A;  4EXZ A;  1K3B A;  1SLE B;  3WJE A;  4C5P A;  1SWS A;  2RTG B;  3HWE A;  4GET A;  5EDC A;  3FR4 A;  1SWP A;  1JMZ A;  1I04 A;  1VPR A;  5KHP A;  5BVQ A;  3T2X A;  4L3R A;  1JZU A;  4NLI A;  3WJC A;  2G5L A;  4RUU A;  3WJF A;  1JJJ A;  4YVB A;  3UEV A;  2JU8 A;  1KFF A;  2WPU A;  3KQ0 A;  1SLG B;  5IO6 A;  4IAW A;  2I5V O;  1VWQ B;  2FT9 A;  1LIE A;  2MF6 A;  4K19 A;  1OPA A;  1VWR B;  2OF9 A;  4M7M A;  4OS8 A;  4ALO A;  4BX5 A;  3RE6 A;  3BLG A;  3FID A;  4OS0 A;  1SWD A;  1HBQ A;  2RTE B;  4YBU A;  1QY1 A;  3QQ2 A;  5H9L A;  1O8V A;  4ZGF A;  1O1V A;  1ZNL A;  1RBP A;  1RLB E;  4FGI B;  3WXQ A;  2KTS A;  4GKC A;  5H8T A;  1AVG I;  1LDQ A;  5B11 O;  2FS6 A;  4NLJ A;  2IZG B;  4WHI A;  4BX5 B;  4HPC A;  3FEN A;  3EBW A;  1SWH A;  2IZK A;  2CM9 A;  4ORS A;  3B2H A;  5H9A A;  2OFB A;  3B2L A;  1KL3 A;  2X32 A;  2KW1 A;  3ELX A;  3MBT A;  3RY2 A;  1GX8 A;  1XCA A;  3L4R A;  1A3Y A;  3V8U A;  1KT7 A;  2RTO B;  1SWL A;  4YDB A;  3FR2 A;  2QCB A;  3D9W A;  1SRH A;  3BU1 A;  3MG5 A;  3CQN A;  5FEN A;  2LB6 A;  5K06 A;  1SWT A;  1VWN B;  1IIU A;  3BX7 A;  3FA8 A;  4ORR A;  2OFR X;  4PJ2 A;  4TKH A;  3RY1 A;  5K68 A;  3EMM A;  4Z2P A;  1AVE A;  2HKD A;  4ODD A;  1KT4 A;  2WUT A;  1CRB A;  4GK9 A;  3RBY A;  4U8U N;  3VGW A;  1STP A;  4ORX A;  1KXO A;  1PMP A;  1YWB A;  2PY1 A;  1Y9L A;  4GD9 A;  1EPA A;  1ERB A;  1DF3 A;  2YMS A;  2A8G A;  2OY8 A;  1G85 A;  3HWG A;  4ON1 A;  4BX6 B;  3QKG A;  2IZD B;  2RTC B;  3B2I A;  4MVI A;  2BSZ A;  3NP1 A;  1EAL A;  3VG6 A;  3EBK A;  4KII A;  4XMH A;  1D3S A;  1A2D A;  3NQK A;  1SWQ A;  4Z28 A;  3U9P C;  2AT0 X;  1D2U A;  1SMP I;  1W5R A;  2IZJ A;  1SWA A;  4KT5 A;  3WZP A;  1LDO A;  3FA9 A;  4ML7 B;  4OEM A;  4A1Y A;  1OPB A;  4CK4 A;  3ZW1 A;  4YBP A;  4HFO A;  3KFG A;  4BOE A;  3EC5 A;  2FGS A;  2POA A;  1CBR A;  4TKJ A;  5JD2 A;  3T6F A;  1Z24 A;  3S5X A;  1G5W A;  1RSU B;  3CR6 A;  4YCH A;  2G78 A;  3X00 A;  1DZM A;  1JBH A;  3LHN A;  1FEN A;  1GT5 A;  3S5V A;  4ES7 A;  1CBQ A;  1PBO A;  2IFB A;  2UYW A;  3NQ9 A;  5HTD A;  4I3D A;  5EPQ A;  2WR6 A;  2QOM A;  2QMI A;  3ELZ A;  1FEL A;  2A5C A;  5HTE A;  4HPD A;  4Y0Q A;  5D4A A;  1STR B;  4NV8 A;  1LCZ A;  4CPF A;  3TF6 A;  4CDC A;  2RCQ A;  3EYC A;  1SXW A;  3P6G A;  4BGF A;  1KL4 A;  1I78 A;  3F9D A;  5HZ8 A;  1GT4 A;  1BWY A;  1ALB A;  4DNE A;  1SY0 A;  2WEW A;  4ZR2 A;  3VHI A;  5HCE C;  1LEL A;  3PDF A;  1CBI A;  1HXL A;  2L5P A;  4MIR A;  3NX2 A;  1MM9 A;  2AT8 X;  4TLJ A;  2F73 A;  1EIO A;  2MO5 A;  4FBO A;  1MX7 A;  1BRP A;  1Y53 X;  1SWG A;  5LJG A;  4ORU A;  4CDD A;  4ZHC A;  5AQ6 A;  2GTL M;  2CZT A;  3T1D A;  4DQ4 A;  1QQS A;  1JMX A;  5B5G A;  2RTN B;  1NQN A;  1U17 A;  1KL5 A;  4I3B A;  4XMC A;  3WJB A;  2BS6 A;  1W4T A;  1W6F A;  2RTI B;  1KZW A;  1DZK A;  1ZND A;  4UU2 A;  1UYN X;  1TVQ A;  4EDE A;  3P6F A;  1N7Y A;  3MM0 A;  4GNY A;  1RXK A;  1SY3 A;  4QYN A;  3FR5 A;  1TOW A;  2MHD A;  2X8T A;  2PI3 O;  3P6C A;  2AH7 X;  2MM3 A;  1CJ5 A;  4ORW A;  1VWC B;  2HZR A;  1H91 A;  2LA7 A;  4U3Q A;  4DCB A;  1KT5 A;  1X8P A;  1SRJ A;  4O3W A;  4R0B A;  4JGL A;  2AF5 A;  2RTK A;  2WQA E;  1VWF B;  1QFT A;  2FHN X;  3HWD A;  5EDB A;  2RA6 A;  1QFV A;  3NQ3 A;  4HPA A;  2WWP A;  1IJ8 A;  3Q6L A;  1SRG A;  1SY1 A;  1SWN A;  5CE4 A;  3AKN A;  1I4U A;  5H9N A;  2C1S A;  1JQP A;  1VWI B;  5HZQ A;  1HY2 A;  2CBS A;  3JSQ A;  1X8Q A;  2DM5 A;  1MVG A;  2M4L A;  3TGB A;  1HMS A;  2RTP B;  3I0A A;  4YGZ A;  1MEP A;  3WOV A;  3WZQ A;  2W2F A;  1SWB A;  4QYP A;  4MVE A;  3HWF A;  3MX7 A;  3SZI A;  2CZU A;  4IMN A;  5FQ8 E;  3FIQ A;  3APW A;  5K67 A;  2OL8 O;  2F01 A;  2KD2 A;  2MWH A;  1YWA A;  4O49 A;  5FQ7 E;  4OMX A;  4ZHD A;  3AKM A;  3HPE A;  2LKK A;  4KH8 A;  2LBA A;  4Z2O A;  3T2W A;  1LID A;  2IZI A;  1P6P A;  3NAD A;  1ADL A;  3CBC A;  1NBX A;  1LUQ A;  3KVN A;  1DF8 A;  1KOI A;  3OD9 A;  4U9C A;  5F6Z A;  5FQ6 E;  3SLO A;  4QQ1 A;  3ZI8 A;  2O62 A;  2W2B A;  1VWH B;  2I5Z O;  3RE5 A;  4A8Z A;  5CSE A;  2QM9 A;  3FW4 A;  3OE3 A;  2RQ0 A;  5EED A;  1HN2 A;  1LIB A;  5D8J A;  3IA8 A;  3SOT A;  2Q4N A;  2ANS A;  4NYR A;  4Y0S A;  4ZHF A;  2QOS C;  2EU7 X;  2OVA A;  1LFO A;  4GGT A;  4CV7 A;  2ACO A;  1IFB A;  1N4J A;  4CSB A;  1X8N A;  4OMW A;  5B2A O;  1S2P A;  3UAQ A;  3VG4 A;  1ZNE A;  4BVM A;  1U0X A;  3ZWE A;  4ZGU A;  1IW2 A;  4BBO A;  1I06 A;  3RDX A;  1FDQ A;  3BX8 A;  4I9R A;  2BHV A;  2OF8 A;  4WFU A;  4CPH A;  2Q39 A;  4ZHG A;  2E4J A;  1JYJ A;  5IRW A;  5D47 A;  5LKE A;  4IMO A;  4FQB B;  4AYH A;  3EW2 A;  4EKV A;  3N91 A;  1E06 A;  2RTL A;  3BU9 A;  3P6H A;  2NNE A;  4ZJ0 A;  3FYF A;  3PH5 A;  4BJ8 A;  4HPB A;  4QGW A;  2X8F A;  2ZSC A;  5L8I A;  4CDF A;  1B4M A;  1U18 A;  3VU1 A;  2A0A A;  4KCA A;  3DSZ A;  2K23 A;  4CPH B;  4IAX A;  5JR8 A;  5D48 A;  3FEP A;  2IZB A;  2OFM X;  1EQD A;  2LBV A;  3ZUI A;  3O2Y A;  3NR3 A;  1WBI A;  1YIV A;  4GJV A;  2Z4H A;  4NNS A;  4O4X A;  1A57 A;  4OS3 A;  2P8G A;  4U8U M;  4A1H A;  4QGX A;  4Y0R A;  3D96 A;  4QAE A;  1B0O A;  3NX1 A;  4DQ3 A;  2RTF B;  3IFB A;  2AT3 X;  2HLV A;  3WYQ A;  4BCS A;  1T0V A;  1ACD A;  3WZN A;  3D97 A;  2FRS A;  1ZNK A;  2AMM X;  2GTF X;  1SXY A;  2G79 A;  1HXZ A;  2R74 A;  3PPT A;  2OL7 A;  2YG2 A;  4U46 A;  1OEE A;  4LKT A;  4PSQ A;  1NDJ A;  1N9M A;  5BYP A;  1ERX A;  3P6D A;  1E5P A;  1JJU A;  1SWC A;  1VWJ B;  2A3F X;  2GH7 A;  1DC9 A;  3P6E A;  4TNN A;  3G7X A;  5AEO A;  5KIC A;  1LF7 A;  1LKE A;  5LJB A;  1PBY A;  3APV A;  1SY2 A;  1AEL A;  2VFC A;  1R0U A;  2OL6 O;  1YP6 A;  3SAO A;  3UEX A;  1DV9 A;  3CBS A;  1PM1 X;  4ZH9 A;  2HNX A;  3FA7 A;  1CBS A;  2GTL O;  3BY0 A;  3RDS A;  5HCD C;  3WVM A;  3O19 A;  4MVL A;  3ZW1 B;  1MK5 A;  2JW1 A;  2Y3F A;  1X8U A;  1FEM A;  4BQU A;  2JGS A;  4N7C A;  2G8C O;  2Q9S A;  4YFR A;  5BVT A;  1ICM A;  3CMP A;  2L67 A;  4EQA C;  4I95 A;  3UEW A;  4O3Z A;  4CDE A;  1QWD A;  1JV4 A;  2BS5 A;  1X8O A;  1JYD A;  4D6A A;  4TJZ A;  2MJI A;  3D4R A;  3STK A;  1ICN A;  3ZUO A;  4AZQ A;  2DJG A;  4XME A;  1VWB B;  1BRQ A;  4Z2V A;  2OFA A;  4EFG A;  2OZQ A;  1NP4 A;  2VFB A;  2IZA A;  2ZAI A;  1KT3 A;  1ZNG A;  2NNQ A;  1DZP A;  4NW4 A;  4NYQ A;  1EI5 A;  4XMD A;  1EII A;  1BM5 A;  1BEB A;  1TOU A;  4ID2 A;  2CM4 A;  4M6S A;  1GX3 A;  2FS7 A;  1KQW A;  2RTH B;  3STN A;  4D6B A;  1SWU A;  4LKP A;  1HMR A;  1VWD B;  2KT4 B;  2RCT A;  1HBP A;  1WUB A;  4AZO A;  5L3Y A;  1VYO A;  1VWA B;  4FBR A;  3TGC A;  3ZW0 A;  5HZ6 A;  3VE1 A;  4HWM A;  1I9H A;  1FJ1 E;  3DTQ A;  5DPQ A;  2FKG A;  4L1N A;  2X56 A;  1JIW I;  4GUZ A;  4Y59 A;  3VG5 A;  5IO7 A;  3FW5 A;  2FKJ A;  2RTM A;  1Y9T A;  2ALL X;  1SA8 A;  1HMT A;  4NNT A;  2OY5 O;  4YMY A;  1S7D A;  5LJD A;  1O1U A;  2G7B A;  5HZ9 A;  3U0D A;  2JMB A;  1I05 A;  2A13 A;  4I6S A;  4GGZ A;  1ML7 A;  3T6L A;  2AT6 X;  2A2U A;  3VG3 A;  4AZP A;  1E02 A;  1LCV A;  3STM X;  1RXJ A;  3EW1 A;  3FEK A;  2OY1 O;  1LIC A;  1DZJ A;  1OEK A;  1OSP O;  2GJ5 A;  3PEC A;  4YKO A;  3SLJ A;  3ZQ3 A;  1URE A;  3CKF A;  3VG7 A;  2Q2P A;  3B2K A;  3BSZ E;  3KFI A;  4O4O A;  3P02 A;  1RXH A;  5B10 O;  3Q34 A;  4FBV A;  4IB6 A;  1BSO A;  1SWR A;  3VHM A;  2RTA A;  2KTD A;  3BRN A;  4GDA A;  4LQZ A;  3WJD A;  5FFH A;  3P24 A;  5HBS A;  3CQR A;  2Y32 A;  4IB9 A;  2Q2M A;  5EZ2 A;  1SRI A;  3AUM O;  4O4S A;  2WEX A;  3RKG A;  1SWE A;  4IBA A;  2BLG A;  1SWO A;  3RZY A;  5L8O A;  1KZX A;  2RD7 C;  5AJC A;  2C4I A;  3RWX A;  4RUN A;  5DG4 A;  3PP6 A;  3PQU A;  1MOY A;  2OYB O;  3OBL A;  1VYG A;  1XKI A;  2FHL A;  4I3C A;  4UU3 A;  2IZF B;  2ZAG A;  4IB8 A;  1SXX A;  3PK2 A;  4OEL A;  4U8U O;  4YDA A;  3WJG A;  3KFH A;  4AZN A;  3U03 A;  1BSY A;  2A5B A;  2RTB B;  3VG2 A;  4CPE A;  2RTR B;  1KQX A;  1B56 A;  3RDM A;  5F6B A;  1BJ7 A;  2RN4 A;  2RTD B;  1EW3 A;  4JHQ A;  3TGA A;  4NV7 A;  3FMZ A;  3FDC A;  1HQQ A;  3K3L A;  1SRE A;  3LTW A;  2ASN X;  3FA6 A;  4IAB A;  3WYP A;  5H9K A;  2GC9 A;  3HOL A;  4XMG A;  2NND A;  2WSJ A;  3PED A;  1OBQ A;  4ZH6 A;  1RST B;  4KC8 A;  1PEE A;  1VWM B;  2FR2 A;  2W2A A;  1VWG B;  3WBG A;  3TZS A;  3PH6 A;  2RTJ A;  1T68 X;  4JO6 A;  1BLR A;  3F8A A;  2UZ2 A;  3AEH A;  1E2T A;  2OVD A;  3GE2 A;  4GZV A;  1YWD A;  5D45 A;  3C78 X;  4LZU A;  4QRL A;  3SLT A;  1QY0 A;  3PQS A;  5CYB A;  3NBX X;  1UYO X;  1A18 A;  1VWL B;  4EEJ A;  1NC9 A;  5IXG A;  3CKG A;  4YH0 A;  5BVS A;  5HA1 A;  4ZHH A;  4MVK A;  1N9Y A;  5HAE A;  4GGR A;  4WBK A;  1LNM A;  1GX9 A;  3FEL A;  4YGG A;  1IFC A;  4BX6 A;  1Y55 X;  3APU A;  3RDO A;  3FLL A;  1NGL A;  3RDQ A;  5HCC C;  2ACP X;  1NQM A;  1EXS A;  1BBP A;  4AW8 A;  3F6Z B;  1OBU A;  2X55 A;  5EEE A;  3RSW A;  1GM6 A;  4TQ2 A;  2X8S A;  2XST A;  1HQP A;  5IRA A;  3ZZV A;  3B2J A;  1TW4 A;  4INN A;  1AVD A;  2A2G A;  3I17 A;  4XMF A;  3S60 A;  3RDU A;  5HWZ A;  5L8N A;  4A60 A;  3ZW2 A;  1QY2 A;  2AKQ A;  4WFV A;  4QGV A;  4AZR A;  2NP1 A;  4AZM A;  3KZA A;  3MVF A;  1MUP A;  2AL0 X;  4QZT A;  2JU3 A;  4YGH A;  4YFP A;  1SLF B;  1EPB A;  3APX A;  4O4U A;  4O9S A;  3HTY A;  1X71 A;  1OEJ A;  1IKE A; 
#chains in the Genus database with same CATH homology
 5LJC A;  4GE1 A;  1GT3 A;  1ZRY A;  4COT A;  1B8E A;  4O3X B;  1KT6 A;  5LJE A;  1OBP A;  2L68 A;  1UZ2 X;  1G7N A;  4ZFX A;  3JQO A;  1BSQ A;  2JN3 A;  5LJK A;  4IB7 A;  1N0S A;  5AJB A;  1S44 A;  1TXL A;  4MIS A;  4GDZ A;  2X45 A;  2FR3 A;  3LV4 A;  5LJH A;  3C77 X;  1ZNH A;  2AT5 X;  4NP1 A;  2XKL A;  1FTP A;  5F1E A;  5F7G A;  2FWV A;  2QO4 A;  2FTB A;  5HA0 A;  1MDC A;  4O3Y A;  1FE3 A;  3E3C A;  4QZU A;  3KFF A;  5C0N A;  4I9S A;  4ZCB A;  2R73 A;  3D95 A;  3S26 A;  3VE2 A;  2HMB A;  5HZ5 A;  1G74 A;  1L6M A;  2JU7 A;  1LIF A;  1YP7 A;  4GRJ A;  4YFQ A;  1VYF A;  3UEU A;  3VPJ E;  5F58 A;  1KGL A;  2FLJ A;  4LZV A;  2WQ9 A;  1GXA A;  2OVE A;  1LPJ A;  1SXU A;  4YCE A;  3H3I A;  4YKM A;  4ARH A;  2GTL N;  2BT9 A;  3JS1 A;  4GU8 A;  2CBR A;  4ALB A;  1YWC A;  1DFV A;  2L9C A;  3ZW0 B;  1GKA A;  4KC7 A;  1JJX A;  2QO6 A;  1EUO A;  1YUP A;  1NP1 A;  4GNW A;  2N93 A;  4GH7 A;  5B29 A;  4QNI A;  5IO5 A;  2Z4I A;  1E00 A;  2X46 A;  2OVS A;  3GAQ A;  1X89 A;  3HOE A;  2LFO A;  4Y0P A;  3BDR A;  2HYS A;  4TKB A;  1GGL A;  1GKA B;  1AQB A;  5KID A;  1QAB E;  2JOZ A;  2K62 A;  2R56 A;  3C76 X;  3OJY C;  5B27 A;  1IKJ A;  3BS2 A;  3CWK A;  3NPO A;  4ORY A;  1T8V A;  5FAZ A;  1GT1 A;  1QG5 A;  5LKF A;  2HZQ A;  4N7D A;  1MX8 A;  2QO5 A;  3EM0 A;  2F09 A;  3HK1 A;  3O22 A;  1AB0 A;  4EXZ A;  3WJE A;  4GET A;  3HWE A;  5EDC A;  3FR4 A;  1I04 A;  1VPR A;  5KHP A;  5BVQ A;  4L3R A;  1JZU A;  4NLI A;  3WJC A;  3WJF A;  4RUU A;  1JJJ A;  3UEV A;  2JU8 A;  3KQ0 A;  5IO6 A;  4IAW A;  2FT9 A;  1LIE A;  4K19 A;  1OPA A;  4M7M A;  4OS8 A;  4ALO A;  3BLG A;  4OS0 A;  4YBU A;  1HBQ A;  1QY1 A;  5H9L A;  1O8V A;  4ZGF A;  1O1V A;  1ZNL A;  1RBP A;  1RLB E;  4FGI B;  3WXQ A;  2KTS A;  4GKC A;  5H8T A;  1AVG I;  2FS6 A;  4NLJ A;  4WHI A;  4HPC A;  3FEN A;  3EBW A;  2CM9 A;  4ORS A;  3B2H A;  5H9A A;  3B2L A;  3MBT A;  2KW1 A;  3ELX A;  3V8U A;  1GX8 A;  1XCA A;  3L4R A;  1A3Y A;  1KT7 A;  4YDB A;  3FR2 A;  5K06 A;  3BU1 A;  3CQN A;  5FEN A;  2LB6 A;  1IIU A;  3BX7 A;  3FA8 A;  4ORR A;  2OFR X;  4PJ2 A;  4TKH A;  3EMM A;  4ODD A;  1KT4 A;  2WUT A;  1CRB A;  4GK9 A;  3RBY A;  4U8U N;  4ORX A;  1KXO A;  1PMP A;  1YWB A;  2PY1 A;  1Y9L A;  1EPA A;  1ERB A;  1DF3 A;  2YMS A;  1G85 A;  3HWG A;  4ON1 A;  3QKG A;  3B2I A;  4MVI A;  3NP1 A;  1EAL A;  3VG6 A;  3EBK A;  4KII A;  4XMH A;  1D3S A;  1A2D A;  3NQK A;  3U9P C;  4AW8 A;  2AT0 X;  1D2U A;  1SMP I;  4KT5 A;  4ML7 B;  3FA9 A;  4A1Y A;  1OPB A;  4CK4 A;  3ZW1 A;  4YBP A;  4HFO A;  3KFG A;  4BOE A;  1A57 A;  4TKJ A;  2POA A;  1CBR A;  1G5W A;  1Z24 A;  3S5X A;  3CR6 A;  4YCH A;  2G78 A;  1DZM A;  1JBH A;  3LHN A;  1FEN A;  1GT5 A;  3S5V A;  4ES7 A;  1CBQ A;  1PBO A;  2IFB A;  3NQ9 A;  5HTD A;  4I3D A;  5EPQ A;  2WR6 A;  2QMI A;  3ELZ A;  1FEL A;  5HTE A;  4HPD A;  4Y0Q A;  5D4A A;  3TF6 A;  2RCQ A;  3EYC A;  1SXW A;  3P6G A;  3F9D A;  5HZ8 A;  1GT4 A;  1BWY A;  1ALB A;  1SY0 A;  2WEW A;  4ZR2 A;  5HCE C;  1CBI A;  2L5P A;  4MIR A;  3NX2 A;  4TLJ A;  2AT8 X;  2F73 A;  1EIO A;  2MO5 A;  4FBO A;  1MX7 A;  1BRP A;  5LJG A;  4ORU A;  4ZHC A;  5AQ6 A;  2GTL M;  2CZT A;  3T1D A;  4DQ4 A;  1QQS A;  4XMC A;  1U17 A;  3WJB A;  4I3B A;  2BS6 A;  1KZW A;  1DZK A;  1ZND A;  4UU2 A;  1TVQ A;  4EDE A;  3P6F A;  4GNY A;  1SY3 A;  4QYN A;  3FR5 A;  1TOW A;  2MHD A;  2X8T A;  3P6C A;  2AH7 X;  2MM3 A;  1CJ5 A;  4ORW A;  4U3Q A;  2HZR A;  1H91 A;  2LA7 A;  1KT5 A;  1X8P A;  4O3W A;  4R0B A;  4JGL A;  2WQA E;  3HWD A;  1QFT A;  5EDB A;  2RA6 A;  1QFV A;  3NQ3 A;  4HPA A;  2WWP A;  3Q6L A;  1SY1 A;  5CE4 A;  3AKN A;  1I4U A;  5H9N A;  5HZQ A;  2CBS A;  3JSQ A;  1X8Q A;  2M4L A;  1MVG A;  2DM5 A;  3TGB A;  1HMS A;  3I0A A;  4YGZ A;  3WOV A;  2W2F A;  4QYP A;  4MVE A;  3HWF A;  3MX7 A;  2CZU A;  4IMN A;  5FQ8 E;  3FIQ A;  3APW A;  2KD2 A;  2MWH A;  4O49 A;  1YWA A;  5FQ7 E;  4OMX A;  3AKM A;  2LKK A;  4KH8 A;  2LBA A;  1LID A;  1P6P A;  3NAD A;  1ADL A;  3CBC A;  4U9C A;  5F6Z A;  1KOI A;  3OD9 A;  5FQ6 E;  4QQ1 A;  3ZI8 A;  2O62 A;  2W2B A;  4A8Z A;  2QM9 A;  3FW4 A;  3OE3 A;  2RQ0 A;  5EED A;  1HN2 A;  1LIB A;  5D8J A;  3IA8 A;  3SOT A;  2Q4N A;  2ANS A;  4NYR A;  4Y0S A;  4ZHF A;  2QOS C;  2EU7 X;  2OVA A;  1LFO A;  4CV7 A;  2ACO A;  1IFB A;  4CSB A;  1X8N A;  4OMW A;  3UAQ A;  1S2P A;  3VG4 A;  1ZNE A;  4BVM A;  1U0X A;  3ZWE A;  4ZGU A;  1IW2 A;  1I06 A;  1FDQ A;  3BX8 A;  4I9R A;  2BHV A;  4WFU A;  2Q39 A;  4ZHG A;  2E4J A;  1JYJ A;  5D47 A;  5LKE A;  4IMO A;  4FQB B;  4AYH A;  3N91 A;  1E06 A;  3BU9 A;  3P6H A;  2NNE A;  4ZJ0 A;  3FYF A;  3PH5 A;  4HPB A;  4QGW A;  2X8F A;  5L8I A;  1B4M A;  1U18 A;  3VU1 A;  2A0A A;  4KCA A;  3DSZ A;  2K23 A;  4IAX A;  5JR8 A;  5D48 A;  3FEP A;  2OFM X;  1EQD A;  2LBV A;  3ZUI A;  3O2Y A;  3NR3 A;  4O4X A;  1YIV A;  4NNS A;  2Z4H A;  4OS3 A;  2P8G A;  4U8U M;  4A1H A;  4QGX A;  4Y0R A;  3D96 A;  4QAE A;  1B0O A;  3NX1 A;  4DQ3 A;  3IFB A;  2AT3 X;  2HLV A;  1T0V A;  1ACD A;  3D97 A;  2FRS A;  1ZNK A;  2AMM X;  2GTF X;  1SXY A;  2G79 A;  2R74 A;  3PPT A;  2YG2 A;  1OEE A;  4LKT A;  4PSQ A;  5BYP A;  1ERX A;  3P6D A;  1E5P A;  3P6E A;  5AEO A;  2A3F X;  5KIC A;  1DC9 A;  4TNN A;  3G7X A;  1LF7 A;  1LKE A;  5LJB A;  3APV A;  1SY2 A;  1AEL A;  1R0U A;  1YP6 A;  3SAO A;  3UEX A;  1DV9 A;  3CBS A;  1PM1 X;  4ZH9 A;  2HNX A;  3FA7 A;  1CBS A;  2GTL O;  3BY0 A;  5HCD C;  3WVM A;  3O19 A;  4MVL A;  3ZW1 B;  2JW1 A;  1X8U A;  1FEM A;  4BQU A;  4N7C A;  4YFR A;  2Q9S A;  5BVT A;  1ICM A;  3CMP A;  2L67 A;  4EQA C;  4I95 A;  3UEW A;  4O3Z A;  1QWD A;  1JV4 A;  2BS5 A;  1X8O A;  1JYD A;  4D6A A;  4TJZ A;  2MJI A;  3D4R A;  3STK A;  1ICN A;  3ZUO A;  4AZQ A;  4XME A;  1BRQ A;  4EFG A;  2OZQ A;  1NP4 A;  2ZAI A;  1KT3 A;  2NNQ A;  1ZNG A;  1DZP A;  4NW4 A;  4NYQ A;  1EI5 A;  4XMD A;  1EII A;  1BM5 A;  1BEB A;  1TOU A;  4ID2 A;  2CM4 A;  4M6S A;  2FS7 A;  1KQW A;  3STN A;  4D6B A;  4LKP A;  1HMR A;  2KT4 B;  2RCT A;  1HBP A;  4AZO A;  4FBR A;  3TGC A;  3ZW0 A;  5HZ6 A;  3VE1 A;  4HWM A;  3DTQ A;  5DPQ A;  4L1N A;  1JIW I;  3VG5 A;  5IO7 A;  3FW5 A;  1Y9T A;  2ALL X;  1SA8 A;  1HMT A;  4NNT A;  4YMY A;  1S7D A;  5LJD A;  1O1U A;  2G7B A;  5HZ9 A;  3U0D A;  2JMB A;  1I05 A;  2A13 A;  4I6S A;  1ML7 A;  2AT6 X;  2A2U A;  3VG3 A;  4AZP A;  1E02 A;  3STM X;  3FEK A;  1LIC A;  1DZJ A;  1OEK A;  2GJ5 A;  3PEC A;  4YKO A;  3ZQ3 A;  1URE A;  3VG7 A;  2Q2P A;  3B2K A;  3BSZ E;  3KFI A;  4O4O A;  3P02 A;  4IB6 A;  4FBV A;  1BSO A;  2KTD A;  3BRN A;  4LQZ A;  3WJD A;  5FFH A;  3P24 A;  5HBS A;  3CQR A;  4IB9 A;  2Q2M A;  5EZ2 A;  4O4S A;  2WEX A;  3RKG A;  4IBA A;  2BLG A;  3RZY A;  5L8O A;  1KZX A;  2RD7 C;  5AJC A;  3RWX A;  4RUN A;  5DG4 A;  3PP6 A;  3PQU A;  3OBL A;  1VYG A;  1XKI A;  4I3C A;  4UU3 A;  2ZAG A;  4IB8 A;  4U8U O;  1SXX A;  4YDA A;  4ZHD A;  3WJG A;  4AZN A;  3U03 A;  3KFH A;  1BSY A;  3VG2 A;  1KQX A;  1B56 A;  5F6B A;  1BJ7 A;  2RN4 A;  1EW3 A;  3TGA A;  3FMZ A;  4IAB A;  3K3L A;  2ASN X;  3FA6 A;  5H9K A;  2GC9 A;  3HOL A;  4XMG A;  2NND A;  2WSJ A;  3PED A;  1OBQ A;  4ZH6 A;  1PEE A;  4KC8 A;  2FR2 A;  2W2A A;  3WBG A;  3TZS A;  3PH6 A;  1T68 X;  1BLR A;  3F8A A;  2OVD A;  3GE2 A;  4GZV A;  1YWD A;  5D45 A;  3C78 X;  4LZU A;  4QRL A;  1QY0 A;  3PQS A;  5CYB A;  3NBX X;  1A18 A;  4EEJ A;  4YH0 A;  5BVS A;  5HA1 A;  4ZHH A;  4MVK A;  5HAE A;  4WBK A;  1LNM A;  1GX9 A;  3FEL A;  4YGG A;  1IFC A;  3APU A;  3FLL A;  1NGL A;  5HCC C;  2ACP X;  1EXS A;  1BBP A;  3F6Z B;  1OBU A;  5EEE A;  3RSW A;  1GM6 A;  4TQ2 A;  2X8S A;  2XST A;  1HQP A;  3ZZV A;  3B2J A;  1TW4 A;  4INN A;  2A2G A;  3I17 A;  4XMF A;  3S60 A;  5HWZ A;  5L8N A;  4A60 A;  3ZW2 A;  1QY2 A;  2AKQ A;  4WFV A;  4QGV A;  4AZR A;  2NP1 A;  4AZM A;  3KZA A;  3MVF A;  1MUP A;  2AL0 X;  4QZT A;  2JU3 A;  4YGH A;  4YFP A;  3APX A;  1EPB A;  4O4U A;  4O9S A;  3HTY A;  1X71 A;  1OEJ A;  1IKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...