4TJZA

The 0.87 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with capric acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, heart
publication title Water-mediated recognition of simple alkyl chains by heart-type Fatty-Acid-binding protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tjzA00
1DZKA 3ELXA 4YBUA 3BY0A 4GRJA 2FWVA 2F73A 2OVAA 1X89A 3WJDA 1LNMA 3I17A 5KIDA 1QFTA 5IO7A 2OFRX 3PECA 2CBRA 1O8VA 4GNYA 1OBUA 5H8TA 5K06A 5EEEA 1IFCA 5B27A 1I4UA 3U0DA 2AT8X 3QKGA 4IBAA 2Q39A 4TKHA 3VG6A 1KQXA 1YUPA 1B0OA 4TKJA 4TKBA 4TQ2A 1EUOA 5EEDA 1VYGA 2FTBA 3SAOA 3APUA 1DZMA 1ZNGA 3F8AA 4BOEA 1OPAA 3BRNA 4YKMA 5F58A 4I9SA 2X46A 5HTEA 2AH7X 5LJBA 1YP7A 3B2KA 3WVMA 1GX9A 4YCEA 2QO5A 4YDAA 1FENA 5F1EA 2HMBA 1ERBA 2A13A 3FELA 3FEKA 5LJEA 3FENA 3EM0A 3C78X 4Y0SA 1AELA 2OFMX 5IO6A 3MBTA 1YWCA 4XMFA 3UEUA 1HQPA 5EZ2A 1TVQA 4YFPA 5HZ5A 4LZUA 1BBPA 2HLVA 2OVDA 1D2UA 3UEWA 3D97A 5EDCA 4ZFXA 1BWYA 2NNEA 4ORRA 1DV9A 3B2IA 3CQRA 1VPRA 3I0AA 2RD7C 3PPTA 1QABE 2A0AA 1KT6A 4OS3A 3HWFA 1U17A 1NP4A 1SY2A 2JN3A 5F7GA 3FR2A 2AT3X 4OMXA 3WJFA 5D45A 4UU3A 2EU7X 4A1HA 1JZUA 1QG5A 2FRSA 4NLJA 1TXLA 4NP1A 2L9CA 2BLGA 4YGHA 4ORXA 2HZQA 5DG4A 4YFQA 2CZUA 1X8QA 2MM3A 5B29A 1IIUA 4XMDA 3FA8A 3BLGA 3TGAA 2GC9A 1KGLA 3KQ0A 5HZ8A 3FA6A 1GX8A 3FA7A 1B4MA 1JJJA 1BSOA 2NNDA 2E4JA 4RUNA 3KFFA 4GKCA 3TF6A 2AT5X 3KZAA 4QAEA 5HTDA 5LKFA 1B8EA 3FMZA 3O2YA 1IKJA 1BEBA 1X8OA 4IB7A 2HZRA 3HWDA 1GKAA 1T0VA 1MDCA 5HCEC 1X8PA 4QZUA 1JV4A 2PY1A 4Y0PA 5H9LA 1KXOA 5HCCC 1BRPA 2HYSA 4AZMA 4ALBA 2GTFX 3IA8A 3UEVA 1ADLA 1KOIA 3BU1A 1GGLA 3RZYA 5EPQA 1A2DA 1RLBE 4AYHA 4NYQA 1KT4A 4WFVA 5CE4A 1H91A 1CBIA 2AT6X 2JOZA 3VG2A 1KQWA 4YH0A 3TGCA 2ANSA 1LFOA 1ERXA 1T8VA 1XCAA 3U03A 1BSQA 1LPJA 3NX2A 2K62A 4KIIA 4GETA 4Y0QA 1TW4A 1EALA 3STMX 1I04A 1MX8A 5EDBA 4YFRA 4ZHCA 2AMMX 2LBVA 4WFUA 3WJCA 3CBSA 3BX8A 1GXAA 4N7DA 1LIFA 2QOSC 2KTDA 4XMHA 4QYPA 2AKQA 4YMYA 3EBKA 4BQUA 2Q4NA 1SXYA 3AKNA 1FTPA 5HZ9A 4HPDA 1VYFA 4AZPA 1IW2A 4ZHGA 1PMPA 1CBQA 2AL0X 3WBGA 4IB6A 5KICA 3Q6LA 4AZNA 1LKEA 2N93A 5F6ZA 1G5WA 2CBSA 1R0UA 1ZNDA 3P6DA 1GKAB 1A3YA 3C76X 5HWZA 1L6MA 3KFGA 3PP6A 3BX7A 1SY3A 3STNA 1RBPA 4GNWA 1UZ2X 1BM5A 1ICMA 2RCTA 1YWAA 4A60A 3FR5A 1HMTA 1PBOA 1U18A 3BDRA 1OEEA 2G78A 4A8ZA 1ACDA 4IAWA 2QM9A 2O62A 4ZH9A 1XKIA 3G7XA 5HZ6A 4ORWA 5C0NA 4OMWA 3VG7A 4AW8A 3MVFA 3P6FA 3KFIA 5BVTA 3CMPA 5FENA 1X71A 4QZTA 4ORYA 4A1YA 5D4AA 3FW5A 1OPBA 1FDQA 1DFVA 3BU9A 3P6GA 3D95A 2FS6A 3CR6A 3JS1A 2P8GA 3BS2A 2WUTA 2QO6A 3APXA 1Z24A 1E00A 4AZRA 1CJ5A 2R74A 2IFBA 1GM6A 3NP1A 1PM1X 4NNTA 1X8UA 5HZQA 1E06A 2G7BA 4TJZA 4MVLA 1GT5A 1S7DA 1SXWA 3VG5A 4TLJA 4NYRA 4DQ4A 4ORSA 5LJHA 3B2LA 3APWA 1MVGA 3WJEA 1LIEA 4BVMA 2WQ9A 1JBHA 1FEMA 4O9SA 2MO5A 1KT7A 4YCHA 1E02A 4YBPA 4RUUA 4UU2A 1CRBA 2HNXA 4EDEA 4XMCA 1B56A 3FW4A 4I3BA 2A2GA 3S26A 1P6PA 3RSWA 5BVQA 4OS8A 3F9DA 4K19A 2G79A 1S44A 4OS0A 4AZOA 3EMMA 2XKLA 2FT9A 1QWDA 4ODDA 5D47A 1O1VA 4YDBA 4EEJA 4IB9A 4Y0RA 4WBKA 3IFBA 3AKMA 3HK1A 3BSZE 4D6AA 3P6CA 1FELA 4XMGA 1I06A 4ZHHA 1ZNKA 3D96A 1E5PA 5D48A 2ASNX 1X8NA 5KHPA 2WEXA 2X45A 1EW3A 1I05A 4NLIA 3NX1A 4YGZA 1HBQA 2CM4A 2Q2PA 2OZQA 1IFBA 2W2FA 5AQ6A 1N0SA 4IAXA 1QY2A 3VG4A 5H9NA 1OEJA 1HBPA 1HMRA 4LKTA 1EIOA 2CZTA 5F6BA 3TGBA 4ZJ0A 1EPAA 1S2PA 2JU3A 3NR3A 1JYJA 1DF3A 1KT5A 2Q9SA 1YIVA 2LBAA 4MVIA 3DSZA 1IKEA 1QQSA 4QGWA 1ZNHA 3P6HA 2JU8A 2FR3A 5LJGA 2ACOA 3FEPA 1EQDA 4XMEA 1GT3A 4IB8A 4HPCA 3NQ9A 1AB0A 5H9KA 5JR8A 1ML7A 4GH7A 1OBPA 3WJGA 2W2AA 4PSQA 2DM5A 2FR2A 3EBWA 3UEXA 2A3FX 3CWKA 2GJ5A 2ACPX 1CBSA 3K3LA 1T68X 3PH6A 2R73A 2WWPA 5FFHA 5HAEA 1O1UA 2FS7A 5IO5A 1LIBA 4HFOA 4NNSA 3NQ3A 4I9RA 2POAA 4ZHDA 3O22A 4QGVA 1YWBA 1EXSA 1PEEA 1QFVA 4GE1A 1BRQA 1TOWA 4TNNA 2LFOA 3CQNA 2NNQA 5L8NA 3APVA 1BSYA 5L8IA 5HA1A 1D3SA 1JYDA 4ES7A 4ORUA 1LICA 1MUPA 1SY1A 2A2UA 5H9AA 2WR6A 1KZWA 3C77X 1G7NA 3TZSA 4DQ3A 1ALBA 4AZQA 1AVGI 1TOUA 3PEDA 4IMOA 3FR4A 1AQBA 4I3CA 2WEWA 1YWDA 1FE3A 4EFGA 4ZCBA 1BLRA 3HWGA 1LIDA 2LKKA 3T1DA 1DZJA 2AT0X 3OJYC 1MX7A 5BVSA 2MJIA 4ZGUA 3ZUIA 1U0XA 3CBCA 5HBSA 4D6BA 3JSQA 2RQ0A 4QGXA 3FLLA 1ZNLA 2L68A 2KT4B 1GT1A 1ICNA 1SXXA 1KZXA 3NPOA 5DPQA 5L8OA 3L4RA 1SXUA 2RCQA 2WQAE 3HWEA 1ZRYA 5LJKA 3B2HA 4HPAA 3FA9A 3VG3A 4M6SA 3ZUOA 2ALLX 5LJDA 1G85A 3ZQ3A 1DZPA 4ARHA 2WSJA 3PH5A 1UREA 1GT4A 1LF7A 4I3DA 1CBRA 1OEKA 4LZVA 4ZH6A 1QY1A 4R0BA 1EPBA 3STKA 3WXQA 3WJBA 5HCDC 3KFHA 1ZNEA 1HMSA 3DTQA 1NP1A 2Q2MA 3GAQA 2R56A 1A57A 2LB6A 1YP6A 4CK4A 4IMNA 2W2BA 3B2JA 3O19A 1KT3A 1JJXA 4QYNA 2FLJA 4LKPA 2K23A 5FAZA 1SY0A 2L5PA 4ZR2A 3ELZA 4YKOA 5LJCA 1A18A 4N7CA 1QY0A 1NGLA 1HN2A 3U9PC 1OBQA 2YG2A 4M7MA 5HA0A 5LKEA 2XSTA 3EYCA 4EXZA 1EIIA 1SA8A 2QO4A 2JU7A 4YGGA 1DC9A 2L67A 2NP1A 4HPBA 4ALOA 2CM9A 4ZHFA 2OVEA 2RA6A 4MVKA 5D8JA 1BJ7A 3FIQA 3P6EA 3NADA 1G74A
chains in the Genus database with same CATH superfamily
2C1SA 1DZKA 4BX6A 3ELXA 4YBUA 4GDAA 3HPEA 4JHQA 3SZJA 3BY0A 2VDFA 2IZCB 4GRJA 2FWVA 4NV7A 2F73A 2OVAA 1X89A 3WJDA 1LNMA 3I17A 1N4JA 4FQBB 1QFTA 5KIDA 2CAMA 5IO7A 2OFRX 3PECA 1VWRB 2CBRA 1O8VA 4GNYA 1OBUA 1Y52X 5H8TA 5EEEA 1IFCA 1VWIB 1I4UA 2Z4HA 5B27A 3SLJA 3T2XA 3U0DA 2RTQB 2RTBB 2AT8X 2RTNB 3QKGA 4O49A 4IBAA 2A5CA 2Q39A 4TKHA 3VG6A 1AVEA 3PQSA 3S60A 1KQXA 1YUPA 2IZFB 3RDMA 1B0OA 4TKJA 1VWAB 4TKBA 4TQ2A 1EUOA 3VHMA 5EEDA 1VYGA 2FTBA 3SAOA 3APUA 2OF8A 1E2TA 1DZMA 1ZNGA 2YMSA 3F8AA 5B5GA 4BOEA 1OPAA 3BRNA 1STRB 4YKMA 1VWOB 2RTLA 5F58A 4I9SA 2X46A 5HTEA 2AH7X 5LJBA 4NV8A 1YP7A 3B2KA 4O4SA 3WVMA 1GX9A 2OL6O 1SWQA 4YCEA 2QO5A 3D4RA 3MM0A 3OD9A 4YDAA 1FENA 5F1EA 2HMBA 1ERBA 2A13A 3FELA 2RTAA 3VGWA 1VWFB 3FEKA 5LJEA 3FENA 2X8SA 2IZBA 2RTGB 3EM0A 3C78X 4Y0SA 1AELA 3ZW1A 1EIOA 4JNJA 2RTPB 2Z4IA 2OFMX 5IO6A 3MBTA 3T6LA 1YWCA 3OBLA 4XMFA 3UEUA 1HQPA 5EZ2A 1TVQA 2X34A 2OY7A 4MIRA 4YFPA 2BC3A 5HZ5A 4GD9A 2A5BA 1VWBB 4LZUA 1BBPA 2HLVA 2OVDA 1D2UA 3UEWA 3D97A 1SWJA 5EDCA 4ZFXA 2GTLO 3RDXA 1BWYA 2NNEA 4ORRA 3VHIA 4BX6B 1DV9A 2I5VO 4GU8A 4IRWA 4EKVA 2G8CO 2DJGA 4C5PA 3B2IA 3CQRA 1N43A 1VPRA 3I0AA 2RD7C 3KVNA 3PPTA 1QABE 2A0AA 2OYBO 3RE6A 1KT6A 1MM9A 3S5VA 4OS3A 3ZW0B 1RXHA 1Y9LA 3HWFA 4Z2PA 1U17A 1EI5A 1NP4A 1SY2A 4CPHA 4BCSA 4U9CA 2JN3A 5F7GA 3FR2A 2AT3X 3RDSA 2GTLN 4OMXA 1SRFA 3WJFA 5D45A 4UU3A 4O3WA 5L3YA 2EU7X 4A1HA 1JZUA 1PTSA 1QG5A 3VU1A 1NDJA 2FRSA 2VFCA 1TXLA 4NLJA 2L9CA 3AUMO 2BLGA 4NP1A 4YGHA 4ORXA 4BJ8A 3P02A 2FHNX 2HZQA 5DG4A 1STSB 2G5LA 4YFQA 2C4IA 4Z6JA 2CZUA 5IRUA 4CPIA 1NBXA 1X8QA 2MM3A 2Y32A 1RXKA 4MISA 5B29A 5CYBA 1I78A 1IIUA 4XMDA 3FA8A 3BLGA 3TGAA 2GC9A 1KGLA 3KQ0A 3VE2A 5HZ8A 3FA6A 1SWGA 1GX8A 3FA7A 1B4MA 1JJJA 3ZI8A 1BSOA 2NNDA 2BT9A 5IXGA 2E4JA 3Q34A 1KFFA 3WBGA 4RUNA 3KFFA 4GKCA 3LHNA 3ZW1B 3TF6A 2AT5X 2FKGA 3KZAA 4QAEA 5HTDA 5LKFA 1B8EA 2X4MA 3FMZA 3O2YA 1IKJA 1BEBA 1X8OA 4GUZA 4IB7A 2HZRA 3HWDA 1GKAA 4I6SA 1T0VA 2RTMA 5B5FA 4BGFA 1MDCA 5CHKA 1X8PA 5HCEC 4QZUA 1JV4A 1IJ8A 2PY1A 4Y0PA 5H9LA 1KXOA 5HCCC 1Y9TA 1NQNA 1BRPA 4KC7A 4ZGFA 2HYSA 5IRWA 4AZMA 4ALBA 2GTFX 3IA8A 3UEVA 1ADLA 1KOIA 3BU1A 1GGLA 3LV4A 4O3XB 5EPQA 3RZYA 1A2DA 1RLBE 4AYHA 2X8TA 3AEHA 4NYQA 3RY2A 2PI3O 1KT4A 1SLGB 4WFVA 5CE4A 3RY1A 1H91A 1CBIA 2AT6X 2JOZA 3VG2A 1KQWA 4BBOA 4YH0A 4YVBA 2UYWA 3TGCA 3RE5A 3WOVA 1VWCB 2X56A 2ANSA 1LFOA 1ERXA 1LCZA 1T8VA 1XCAA 2RTEB 4QQ1A 3U03A 1BSQA 1LPJA 2A8GA 3NX2A 4OEMA 4CDDA 2K62A 4KIIA 4GETA 4Y0QA 2WPUA 1TW4A 3VHHA 3ZW0A 2BSZA 1EALA 1SRHA 3STMX 1I04A 1MX8A 5EDBA 4YFRA 4DCBA 4ZHCA 2AMMX 4O4UA 1JJUA 2LBVA 4U8UO 4WFUA 4QRLA 3WJCA 1K24A 3CBSA 4Z2VA 3BX8A 3RDOA 1GXAA 4N7DA 1LIFA 4GZVA 1FJ1E 2DJFA 1STPA 2KTDA 2QOSC 3F6ZB 4JO6A 4XMHA 4QYPA 2AKQA 4I60A 4YMYA 3EBKA 4LQZA 5CSEA 2Q4NA 4BQUA 1SXYA 3AKNA 1FTPA 1VWQB 5HZ9A 4HPDA 1VYFA 4AZPA 1IW2A 4ZHGA 1RXJA 1HXZA 1CBQA 1PMPA 2AL0X 2OL8O 3CKFA 3H3IA 1SWCA 3E3CA 3Q6LA 4IB6A 4L1NA 1LKEA 4U8UN 2N93A 1KL4A 3RKGA 5F6ZA 4AZNA 2CBSA 1G5WA 1R0UA 1ZNDA 3P6DA 2OY1O 1GKAB 1A3YA 3C76X 4MEEA 1L6MA 3KFGA 3PP6A 5HWZA 3P24A 3BX7A 1SY3A 3STNA 1RBPA 4FBOA 4GNWA 1UZ2X 4MVEA 1BM5A 1ICMA 2RCTA 1YWAA 2RTOB 4A60A 3FR5A 1HMTA 1PBOA 3SLTA 2JMBA 2AF5A 1U18A 2IZKA 1OEEA 3BDRA 2G78A 4Z28A 4A8ZA 1ACDA 4IAWA 2JGSA 4L3RA 2QM9A 2O62A 4ZH9A 1SWNA 1SWUA 1XKIA 3G7XA 4ORWA 5B11O 5C0NA 2F09A 2KW1A 4OMWA 5HZ6A 3NBXX 3VG7A 4AW8A 2Y3FA 3MVFA 3KFIA 3P6FA 4KT5A 3CMPA 5BVTA 5FENA 1N7YA 1X71A 1SWLA 2BHVA 2ZSCA 4ORYA 4QZTA 5FQ7E 3VPJE 4NW4A 4A1YA 5D4AA 3FW5A 1OPBA 3SOTA 1FDQA 4ON1A 4KC8A 1DFVA 3BU9A 3RDUA 2BS5A 3D95A 3EW2A 3P6GA 1MOYA 4GJVA 2FS6A 3CR6A 3JS1A 1AVDA 1WBIA 4O3YA 4Z2OA 2P8GA 3BS2A 4I95A 2WUTA 4HWMA 2QO6A 3APXA 1Z24A 4WHIA 1E00A 4AZRA 1NC9A 2RTCB 1VWNB 2RTRB 4CDFA 2R74A 2IFBA 1GM6A 1CJ5A 3NP1A 1PM1X 1VWPB 4NNTA 5K06A 1X8UA 2OVSA 2QOMA 1E06A 1JMZA 2G7BA 1SWEA 2IZJA 4TJZA 5HZQA 3X00A 3WZNA 4MVLA 1SWTA 4CPEA 1GT5A 1S7DA 4ID2A 4O4OA 5K67A 1SXWA 3VG5A 4TLJA 2OY8A 4Y5DA 2I5ZO 2C1QA 4NYRA 4DQ4A 4ORSA 1MEPA 3B2LA 3APWA 1MVGA 1VWDB 2KD2A 3WJEA 5LJHA 1LIEA 1SWSA 3FYFA 1SWBA 2GH7A 4BVMA 2WQ9A 4FBVA 4INNA 3QQ2A 1JBHA 1FEMA 3CKGA 4O9SA 2MO5A 1KT7A 1NQMA 1W4TA 2RTHB 4YCHA 2MWHA 1E02A 1KL5A 4YBPA 4RUUA 4UU2A 1CRBA 2HNXA 4EDEA 4XMCA 4KCAA 1B56A 3FW4A 4GGTA 1JIWI 4I3BA 2A2GA 3PQUA 3S26A 1P6PA 1VWEB 2X55A 3RSWA 5BVQA 4BX5A 3S5XA 3WZPA 4OS8A 5B3MO 3F9DA 4BX7A 4K19A 1LDQA 2G79A 2GTLM 1S44A 3GE2A 4OS0A 4AZOA 3EMMA 1VWLB 2XKLA 2FT9A 4GGZA 4QNIA 1QWDA 4ODDA 1WUBA 5D47A 2QMIA 1O1VA 4YDBA 4O4XA 1Y0GA 4IB9A 4EEJA 2IZEB 2JW1A 4Y0RA 4WBKA 2ZAGA 3IFBA 5K68A 3AKMA 1N9MA 3FDCA 3HK1A 2RTFB 3BSZE 3OE3A 1VWMB 4D6AA 4DNEA 4FBRA 1W6FA 3P6CA 3ZWEA 1FELA 5JD2A 4XMGA 2RTJA 1I06A 1SWPA 1Y53X 4ZHHA 1ZNKA 3D96A 1E5PA 5D48A 2ASNX 1X8NA 5KHPA 1KL3A 2WEXA 2Y3EA 5AJBA 3ZW2A 2X45A 1EW3A 1I05A 2RN4A 3NX1A 4NLIA 4YGZA 2IZDB 1HBQA 2OL7A 3PK2A 2CM4A 2Q2PA 2OZQA 1SRJA 1IFBA 2W2FA 5AQ6A 1LELA 1N0SA 4IAXA 3HOEA 1QY2A 1SWDA 3VG4A 2FGSA 4O3ZA 5H9NA 1OEJA 2BS6A 1HBPA 1HMRA 4LKTA 2FKJA 2CZTA 2LA7A 5F6BA 4ZJ0A 4CV7A 3TGBA 1EPAA 1S2PA 1VWKB 4CSBA 2JU3A 4CPFA 2X8FA 3NR3A 1JYJA 1DF3A 1DF8A 1KT5A 3N91A 2Q9SA 1YIVA 2MF6A 4GDZA 1SWOA 2LBAA 5FQ6E 4MVIA 4PJ2A 3DSZA 1IKEA 1QQSA 4QGWA 2M4LA 1ZNHA 4FGIB 1SLEB 3P6HA 2JU8A 2FR3A 5LJGA 2ACOA 3FEPA 1EQDA 4XMEA 3WYPA 1GT3A 4IB8A 4HPCA 3NQ9A 1RSUB 1AB0A 2IZHB 5H9KA 5JR8A 1ML7A 4JGLA 4GH7A 1OBPA 3WJGA 2W2AA 1HXLA 1PBYA 4PSQA 2DM5A 2FR2A 3EBWA 4BX5B 3UEXA 2A3FX 3CWKA 2GJ5A 2ACPX 1CBSA 3K3LA 1T68X 1SWAA 3PH6A 2R73A 4BX7B 2F01A 2WWPA 5FFHA 5HAEA 1O1UA 3WZOA 3SZIA 4GK9A 2FS7A 5IO5A 1LIBA 1SRGA 4HFOA 3V8UA 4NNSA 3NQ3A 4I9RA 2IZIA 2POAA 3RBYA 3SZHA 4ZHDA 3O22A 4QGVA 4KH8A 1YWBA 1LDOA 1EXSA 1PEEA 2MHDA 1QFVA 4GE1A 3WZQA 1BRQA 1TOWA 4TNNA 2LFOA 3CQNA 2NNQA 2OFBA 3APVA 1BSYA 5L8IA 5HA1A 5L8NA 1D3SA 1JYDA 2IZGB 3FIDA 3VE1A 4ES7A 4ORUA 1LICA 1MUPA 4Z27A 3ZZVA 1SY1A 2A2UA 2QCBA 5H9AA 2WR6A 1KZWA 3C77X 1G7NA 4GGRA 5B10O 4DQ3A 1ALBA 4AZQA 3TZSA 2RTIB 1AVGI 1TOUA 2OF9A 3PEDA 1RAVA 4IMOA 4EQAC 3FR4A 3PDFA 3HOLA 1AQBA 2RTDB 3NQKA 4I3CA 2WEWA 2ZAIA 4Y59A 4CDEA 1YWDA 1FE3A 3T2WA 4ZCBA 4EFGA 1BLRA 1SRIA 3HWGA 1LIDA 2LKKA 3T1DA 1SWKA 1SLDB 3MG5A 4U8UM 1DZJA 1LCWA 5BYPA 2AT0X 1VYOA 1Y55X 3OJYC 1I9HA 3WYQA 1GX3A 3RDQA 1MX7A 3MX7A 5BVSA 2MJIA 4ZGUA 4OELA 1U0XA 3CBCA 5HBSA 3ZUIA 4D6BA 3JSQA 2RQ0A 4QGXA 3FLLA 1SWFA 1ZNLA 2L68A 2HKDA 4GJSA 1HY2A 2KT4B 5AJCA 1GT1A 1ICNA 1SXXA 4ML7B 1JMXA 1KZXA 3NPOA 1UYNX 5DPQA 5L8OA 3L4RA 4U46A 3RWXA 4COTA 1SXUA 2RCQA 2WQAE 5FQ8E 4CDCA 3HWEA 5AEOA 1SMPI 1VWHB 3T6FA 1ZRYA 2UZ2A 1VWJB 5LJKA 3B2HA 3EW1A 4HPAA 3FA9A 3VG3A 2RTKA 3UAQA 1OSPO 2OFAA 4M6SA 2ALLX 3ZUOA 5LJDA 1G85A 3ZQ3A 1DZPA 1JQPA 4ARHA 2WSJA 1SLFB 3PH5A 1UREA 1GT4A 1LF7A 4I3DA 1CBRA 1OEKA 4LZVA 4ZH6A 4B55A 1HQQA 1QY1A 1LCVA 4R0BA 3HTYA 1EPBA 4OKAA 3STKA 3WXQA 1K3BA 3WJBA 5HCDC 2IZLB 3KFHA 2X32A 1ZNEA 1HMSA 1LUQA 1NP1A 1SREA 1SWRA 2Q2MA 2R56A 3DTQA 3GAQA 2LB6A 1YP6A 2OY5O 5IRAA 4CK4A 1A57A 4IMNA 2W2BA 3EC5A 2IZAA 3B2JA 3O19A 3D9WA 3SLOA 1KT3A 1JJXA 4IABA 2FLJA 4QYNA 4LKPA 2K23A 5KICA 1SWHA 3LTWA 5FAZA 1SY0A 2L5PA 2VFBA 4ZR2A 3ELZA 4YKOA 5LJCA 1A18A 1W5RA 2KTSA 4N7CA 1QY0A 2FHLA 1NGLA 1HN2A 3U9PC 1OBQA 2YG2A 4M7MA 5HA0A 5LKEA 2XSTA 5B2AO 3EYCA 1UYOX 4EXZA 1EIIA 1SA8A 2QO4A 2JU7A 4YGGA 1DC9A 2L67A 2NP1A 3JQOA 4HPBA 1N9YA 5F2BA 4U3QA 1RSTB 4ALOA 2CM9A 1MK5A 4ZHFA 2OVEA 2RA6A 4MVKA 5D8JA 4CPHB 1BJ7A 2AVIA 3FIQA 3P6EA 3NADA 1VWGB 1G74A
chains in the Genus database with same CATH topology
1DZKA 3ELXA 4YBUA 3BY0A 4GRJA 2FWVA 2F73A 2OVAA 1X89A 3WJDA 1LNMA 3I17A 4FQBB 5KIDA 1QFTA 5IO7A 2OFRX 3PECA 2CBRA 1O8VA 4GNYA 1OBUA 5H8TA 5K06A 5EEEA 1IFCA 5B27A 1I4UA 2Z4HA 3U0DA 2AT8X 3QKGA 4O49A 4IBAA 2Q39A 4TKHA 3VG6A 3PQSA 3S60A 1KQXA 1YUPA 1B0OA 4TKJA 4TKBA 4TQ2A 1EUOA 5EEDA 1VYGA 2FTBA 3SAOA 3APUA 2YMSA 1DZMA 1ZNGA 3F8AA 4BOEA 1OPAA 3BRNA 4YKMA 5F58A 4I9SA 2X46A 5HTEA 2AH7X 5LJBA 1YP7A 3B2KA 4O4SA 3WVMA 1GX9A 4YCEA 2QO5A 3D4RA 3OD9A 4YDAA 1FENA 5F1EA 2HMBA 1ERBA 2A13A 3FELA 3FEKA 5LJEA 3FENA 2X8SA 3EM0A 3C78X 4Y0SA 1AELA 3ZW1A 2Z4IA 2OFMX 5IO6A 3MBTA 1YWCA 3OBLA 4XMFA 3UEUA 1HQPA 5EZ2A 1TVQA 4MIRA 4YFPA 5HZ5A 4LZUA 1BBPA 2HLVA 2OVDA 1D2UA 3UEWA 3D97A 5EDCA 4ZFXA 2GTLO 1BWYA 2NNEA 4ORRA 1DV9A 4GU8A 3B2IA 3CQRA 1VPRA 3I0AA 2RD7C 3PPTA 1QABE 2A0AA 3S5VA 3ZW0B 1KT6A 4OS3A 3HWFA 1Y9LA 1U17A 1EI5A 1NP4A 1SY2A 4U9CA 2JN3A 5F7GA 3FR2A 2AT3X 2GTLN 4OMXA 3WJFA 5D45A 4UU3A 4O3WA 2EU7X 4A1HA 1JZUA 1QG5A 3VU1A 2FRSA 4NLJA 1TXLA 4NP1A 2L9CA 2BLGA 4YGHA 4ORXA 3P02A 2HZQA 5DG4A 4YFQA 2CZUA 1X8QA 2MM3A 4MISA 5B29A 5CYBA 1IIUA 4XMDA 3FA8A 3BLGA 3TGAA 2GC9A 1KGLA 3KQ0A 3VE2A 5HZ8A 3FA6A 1GX8A 3FA7A 1B4MA 1JJJA 3ZI8A 1BSOA 2NNDA 2BT9A 2E4JA 4RUNA 3KFFA 4GKCA 3LHNA 3ZW1B 3TF6A 2AT5X 3KZAA 4QAEA 5HTDA 5LKFA 1B8EA 3FMZA 3O2YA 1IKJA 1BEBA 1X8OA 4IB7A 2HZRA 3HWDA 1GKAA 4I6SA 1T0VA 1MDCA 5HCEC 1X8PA 4QZUA 1JV4A 2PY1A 4Y0PA 5H9LA 1KXOA 5HCCC 1Y9TA 4KC7A 1BRPA 4ZGFA 2HYSA 4AZMA 4ALBA 2GTFX 3IA8A 3UEVA 1ADLA 1KOIA 3BU1A 1GGLA 3LV4A 4O3XB 5EPQA 3RZYA 1A2DA 1RLBE 4AYHA 2X8TA 4NYQA 1KT4A 4WFVA 5CE4A 1H91A 1CBIA 2AT6X 2JOZA 3VG2A 1KQWA 4YH0A 3TGCA 3WOVA 2ANSA 1LFOA 1ERXA 1T8VA 1XCAA 4QQ1A 3U03A 1BSQA 1LPJA 3NX2A 2K62A 4KIIA 4GETA 4Y0QA 1TW4A 3ZW0A 1EALA 3STMX 1I04A 1MX8A 5EDBA 4YFRA 4ZHCA 2AMMX 4O4UA 2LBVA 4U8UO 4WFUA 4QRLA 3WJCA 3CBSA 3BX8A 1GXAA 4N7DA 1LIFA 4GZVA 2QOSC 3F6ZB 2KTDA 4XMHA 4QYPA 2AKQA 4YMYA 3EBKA 4LQZA 4BQUA 2Q4NA 1SXYA 3AKNA 1FTPA 5HZ9A 4HPDA 1VYFA 4AZPA 1IW2A 4ZHGA 1PMPA 1CBQA 2AL0X 3WBGA 3H3IA 4IB6A 3E3CA 3RKGA 3Q6LA 4L1NA 4U8UN 1LKEA 4AZNA 2N93A 5F6ZA 1G5WA 2CBSA 1R0UA 1ZNDA 3P6DA 1GKAB 1A3YA 3C76X 5HWZA 1L6MA 3KFGA 3PP6A 3P24A 3BX7A 1SY3A 3STNA 1RBPA 4FBOA 4GNWA 1UZ2X 4MVEA 1BM5A 1ICMA 2RCTA 1YWAA 4A60A 3FR5A 1HMTA 1PBOA 2JMBA 1U18A 3BDRA 1OEEA 2G78A 4A8ZA 1ACDA 4IAWA 4L3RA 2QM9A 2O62A 4ZH9A 1XKIA 3G7XA 5HZ6A 4ORWA 5C0NA 2F09A 2KW1A 4OMWA 3NBXX 3VG7A 4AW8A 3MVFA 3P6FA 3KFIA 4KT5A 5BVTA 3CMPA 5FENA 2BHVA 1X71A 4QZTA 4ORYA 5FQ7E 3VPJE 4A1YA 4NW4A 5D4AA 3FW5A 1OPBA 3SOTA 1FDQA 4ON1A 4KC8A 1DFVA 3BU9A 2BS5A 3D95A 3P6GA 2FS6A 3CR6A 3JS1A 4O3YA 2P8GA 3BS2A 4I95A 2WUTA 4HWMA 2QO6A 3APXA 1Z24A 4WHIA 1E00A 4AZRA 1CJ5A 2R74A 2IFBA 1GM6A 3NP1A 1PM1X 4NNTA 1X8UA 2OVSA 5HZQA 1E06A 2G7BA 4TJZA 4MVLA 1GT5A 1S7DA 4ID2A 4O4OA 1SXWA 3VG5A 4TLJA 4NYRA 4DQ4A 4ORSA 5LJHA 3B2LA 3APWA 1MVGA 2KD2A 3WJEA 1LIEA 3FYFA 4BVMA 2WQ9A 4FBVA 4INNA 1JBHA 1FEMA 4O9SA 2MO5A 1KT7A 4YCHA 2MWHA 1E02A 4YBPA 4RUUA 4UU2A 1CRBA 2HNXA 4EDEA 4XMCA 4KCAA 1B56A 3FW4A 1JIWI 4I3BA 2A2GA 3PQUA 3S26A 1P6PA 3RSWA 5BVQA 3S5XA 4OS8A 3F9DA 4K19A 2G79A 2GTLM 1S44A 3GE2A 4OS0A 4AZOA 3EMMA 2XKLA 2FT9A 4QNIA 1QWDA 4ODDA 5D47A 2QMIA 1O1VA 4YDBA 4O4XA 4EEJA 4IB9A 2JW1A 4Y0RA 4WBKA 2ZAGA 3IFBA 3AKMA 3HK1A 3BSZE 3OE3A 4D6AA 4FBRA 3P6CA 3ZWEA 1FELA 4XMGA 1I06A 4ZHHA 1ZNKA 3D96A 1E5PA 5D48A 2ASNX 1X8NA 5KHPA 5AJBA 2WEXA 3ZW2A 2X45A 1EW3A 1I05A 2RN4A 3NX1A 4NLIA 4YGZA 1HBQA 2CM4A 2Q2PA 2OZQA 1IFBA 2W2FA 5AQ6A 1N0SA 4IAXA 3HOEA 1QY2A 3VG4A 5H9NA 4O3ZA 1OEJA 2BS6A 1HBPA 1HMRA 4LKTA 1EIOA 2CZTA 2LA7A 5F6BA 4ZJ0A 4CV7A 3TGBA 1EPAA 1S2PA 4CSBA 2JU3A 2X8FA 3NR3A 1JYJA 1DF3A 1KT5A 3N91A 2Q9SA 1YIVA 4GDZA 2LBAA 5FQ6E 4MVIA 4PJ2A 3DSZA 1IKEA 1QQSA 4QGWA 2M4LA 1ZNHA 4FGIB 3P6HA 2JU8A 2FR3A 5LJGA 2ACOA 3FEPA 1EQDA 4XMEA 1GT3A 4IB8A 4HPCA 3NQ9A 1AB0A 5H9KA 5JR8A 1ML7A 4JGLA 4GH7A 1OBPA 3WJGA 2W2AA 4PSQA 2DM5A 2FR2A 3EBWA 3UEXA 2A3FX 3CWKA 2GJ5A 2ACPX 1CBSA 3K3LA 1T68X 3PH6A 2R73A 2WWPA 5FFHA 5HAEA 1O1UA 4GK9A 2FS7A 5IO5A 1LIBA 4HFOA 3V8UA 4NNSA 3NQ3A 4I9RA 2POAA 3RBYA 4ZHDA 3O22A 4QGVA 4KH8A 1YWBA 1EXSA 1PEEA 2MHDA 1QFVA 4GE1A 1BRQA 1TOWA 4TNNA 2LFOA 3CQNA 2NNQA 5L8NA 3APVA 1BSYA 5L8IA 5HA1A 1D3SA 1JYDA 4ES7A 3VE1A 4ORUA 1LICA 1MUPA 3ZZVA 1SY1A 2A2UA 5H9AA 2WR6A 1KZWA 3C77X 1G7NA 3TZSA 4DQ3A 1ALBA 4AZQA 1AVGI 1TOUA 3PEDA 4IMOA 4EQAC 3FR4A 3HOLA 1AQBA 3NQKA 4I3CA 2WEWA 2ZAIA 1YWDA 1FE3A 4EFGA 4ZCBA 1BLRA 3HWGA 1LIDA 2LKKA 3T1DA 4U8UM 1DZJA 5BYPA 2AT0X 3OJYC 1MX7A 3MX7A 5BVSA 2MJIA 4ZGUA 3ZUIA 1U0XA 3CBCA 5HBSA 4D6BA 3JSQA 2RQ0A 4QGXA 3FLLA 1ZNLA 2L68A 2KT4B 5AJCA 1GT1A 1ICNA 1SXXA 4ML7B 1KZXA 3NPOA 5DPQA 5L8OA 3L4RA 3RWXA 4COTA 1SXUA 2RCQA 2WQAE 5FQ8E 5AEOA 3HWEA 1SMPI 1ZRYA 5LJKA 3B2HA 4HPAA 3FA9A 3VG3A 3UAQA 4M6SA 3ZUOA 2ALLX 5LJDA 1G85A 3ZQ3A 1DZPA 4ARHA 2WSJA 3PH5A 1UREA 1GT4A 1LF7A 4I3DA 1CBRA 1OEKA 4LZVA 4ZH6A 1QY1A 4R0BA 3HTYA 1EPBA 3STKA 3WXQA 3WJBA 5HCDC 3KFHA 1ZNEA 1HMSA 3DTQA 1NP1A 2Q2MA 3GAQA 2R56A 1A57A 2LB6A 1YP6A 4CK4A 4IMNA 2W2BA 3B2JA 3O19A 1KT3A 1JJXA 4IABA 2FLJA 4QYNA 4LKPA 2K23A 5KICA 5FAZA 1SY0A 2L5PA 4ZR2A 3ELZA 4YKOA 5LJCA 1A18A 2KTSA 4N7CA 1QY0A 1NGLA 1HN2A 3U9PC 1OBQA 2YG2A 4M7MA 5HA0A 5LKEA 2XSTA 3EYCA 4EXZA 1EIIA 1SA8A 2QO4A 2JU7A 4YGGA 1DC9A 2L67A 2NP1A 3JQOA 4HPBA 4ALOA 4U3QA 2CM9A 4ZHFA 2OVEA 2RA6A 4MVKA 5D8JA 1BJ7A 3FIQA 3P6EA 3NADA 1G74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZK A;  3ELX A;  4YBU A;  3BY0 A;  4GRJ A;  2FWV A;  2F73 A;  2OVA A;  1X89 A;  3WJD A;  1LNM A;  3I17 A;  5KID A;  1QFT A;  5IO7 A;  2OFR X;  3PEC A;  2CBR A;  1O8V A;  4GNY A;  1OBU A;  5H8T A;  5K06 A;  5EEE A;  1IFC A;  5B27 A;  1I4U A;  3U0D A;  2AT8 X;  3QKG A;  4IBA A;  2Q39 A;  4TKH A;  3VG6 A;  1KQX A;  1YUP A;  1B0O A;  4TKJ A;  4TKB A;  4TQ2 A;  1EUO A;  5EED A;  1VYG A;  2FTB A;  3SAO A;  3APU A;  1DZM A;  1ZNG A;  3F8A A;  4BOE A;  1OPA A;  3BRN A;  4YKM A;  5F58 A;  4I9S A;  2X46 A;  5HTE A;  2AH7 X;  5LJB A;  1YP7 A;  3B2K A;  3WVM A;  1GX9 A;  4YCE A;  2QO5 A;  4YDA A;  1FEN A;  5F1E A;  2HMB A;  1ERB A;  2A13 A;  3FEL A;  3FEK A;  5LJE A;  3FEN A;  3EM0 A;  3C78 X;  4Y0S A;  1AEL A;  2OFM X;  5IO6 A;  3MBT A;  1YWC A;  4XMF A;  3UEU A;  1HQP A;  5EZ2 A;  1TVQ A;  4YFP A;  5HZ5 A;  4LZU A;  1BBP A;  2HLV A;  2OVD A;  1D2U A;  3UEW A;  3D97 A;  5EDC A;  4ZFX A;  1BWY A;  2NNE A;  4ORR A;  1DV9 A;  3B2I A;  3CQR A;  1VPR A;  3I0A A;  2RD7 C;  3PPT A;  1QAB E;  2A0A A;  1KT6 A;  4OS3 A;  3HWF A;  1U17 A;  1NP4 A;  1SY2 A;  2JN3 A;  5F7G A;  3FR2 A;  2AT3 X;  4OMX A;  3WJF A;  5D45 A;  4UU3 A;  2EU7 X;  4A1H A;  1JZU A;  1QG5 A;  2FRS A;  4NLJ A;  1TXL A;  4NP1 A;  2L9C A;  2BLG A;  4YGH A;  4ORX A;  2HZQ A;  5DG4 A;  4YFQ A;  2CZU A;  1X8Q A;  2MM3 A;  5B29 A;  1IIU A;  4XMD A;  3FA8 A;  3BLG A;  3TGA A;  2GC9 A;  1KGL A;  3KQ0 A;  5HZ8 A;  3FA6 A;  1GX8 A;  3FA7 A;  1B4M A;  1JJJ A;  1BSO A;  2NND A;  2E4J A;  4RUN A;  3KFF A;  4GKC A;  3TF6 A;  2AT5 X;  3KZA A;  4QAE A;  5HTD A;  5LKF A;  1B8E A;  3FMZ A;  3O2Y A;  1IKJ A;  1BEB A;  1X8O A;  4IB7 A;  2HZR A;  3HWD A;  1GKA A;  1T0V A;  1MDC A;  5HCE C;  1X8P A;  4QZU A;  1JV4 A;  2PY1 A;  4Y0P A;  5H9L A;  1KXO A;  5HCC C;  1BRP A;  2HYS A;  4AZM A;  4ALB A;  2GTF X;  3IA8 A;  3UEV A;  1ADL A;  1KOI A;  3BU1 A;  1GGL A;  3RZY A;  5EPQ A;  1A2D A;  1RLB E;  4AYH A;  4NYQ A;  1KT4 A;  4WFV A;  5CE4 A;  1H91 A;  1CBI A;  2AT6 X;  2JOZ A;  3VG2 A;  1KQW A;  4YH0 A;  3TGC A;  2ANS A;  1LFO A;  1ERX A;  1T8V A;  1XCA A;  3U03 A;  1BSQ A;  1LPJ A;  3NX2 A;  2K62 A;  4KII A;  4GET A;  4Y0Q A;  1TW4 A;  1EAL A;  3STM X;  1I04 A;  1MX8 A;  5EDB A;  4YFR A;  4ZHC A;  2AMM X;  2LBV A;  4WFU A;  3WJC A;  3CBS A;  3BX8 A;  1GXA A;  4N7D A;  1LIF A;  2QOS C;  2KTD A;  4XMH A;  4QYP A;  2AKQ A;  4YMY A;  3EBK A;  4BQU A;  2Q4N A;  1SXY A;  3AKN A;  1FTP A;  5HZ9 A;  4HPD A;  1VYF A;  4AZP A;  1IW2 A;  4ZHG A;  1PMP A;  1CBQ A;  2AL0 X;  3WBG A;  4IB6 A;  5KIC A;  3Q6L A;  4AZN A;  1LKE A;  2N93 A;  5F6Z A;  1G5W A;  2CBS A;  1R0U A;  1ZND A;  3P6D A;  1GKA B;  1A3Y A;  3C76 X;  5HWZ A;  1L6M A;  3KFG A;  3PP6 A;  3BX7 A;  1SY3 A;  3STN A;  1RBP A;  4GNW A;  1UZ2 X;  1BM5 A;  1ICM A;  2RCT A;  1YWA A;  4A60 A;  3FR5 A;  1HMT A;  1PBO A;  1U18 A;  3BDR A;  1OEE A;  2G78 A;  4A8Z A;  1ACD A;  4IAW A;  2QM9 A;  2O62 A;  4ZH9 A;  1XKI A;  3G7X A;  5HZ6 A;  4ORW A;  5C0N A;  4OMW A;  3VG7 A;  4AW8 A;  3MVF A;  3P6F A;  3KFI A;  5BVT A;  3CMP A;  5FEN A;  1X71 A;  4QZT A;  4ORY A;  4A1Y A;  5D4A A;  3FW5 A;  1OPB A;  1FDQ A;  1DFV A;  3BU9 A;  3P6G A;  3D95 A;  2FS6 A;  3CR6 A;  3JS1 A;  2P8G A;  3BS2 A;  2WUT A;  2QO6 A;  3APX A;  1Z24 A;  1E00 A;  4AZR A;  1CJ5 A;  2R74 A;  2IFB A;  1GM6 A;  3NP1 A;  1PM1 X;  4NNT A;  1X8U A;  5HZQ A;  1E06 A;  2G7B A;  4TJZ A;  4MVL A;  1GT5 A;  1S7D A;  1SXW A;  3VG5 A;  4TLJ A;  4NYR A;  4DQ4 A;  4ORS A;  5LJH A;  3B2L A;  3APW A;  1MVG A;  3WJE A;  1LIE A;  4BVM A;  2WQ9 A;  1JBH A;  1FEM A;  4O9S A;  2MO5 A;  1KT7 A;  4YCH A;  1E02 A;  4YBP A;  4RUU A;  4UU2 A;  1CRB A;  2HNX A;  4EDE A;  4XMC A;  1B56 A;  3FW4 A;  4I3B A;  2A2G A;  3S26 A;  1P6P A;  3RSW A;  5BVQ A;  4OS8 A;  3F9D A;  4K19 A;  2G79 A;  1S44 A;  4OS0 A;  4AZO A;  3EMM A;  2XKL A;  2FT9 A;  1QWD A;  4ODD A;  5D47 A;  1O1V A;  4YDB A;  4EEJ A;  4IB9 A;  4Y0R A;  4WBK A;  3IFB A;  3AKM A;  3HK1 A;  3BSZ E;  4D6A A;  3P6C A;  1FEL A;  4XMG A;  1I06 A;  4ZHH A;  1ZNK A;  3D96 A;  1E5P A;  5D48 A;  2ASN X;  1X8N A;  5KHP A;  2WEX A;  2X45 A;  1EW3 A;  1I05 A;  4NLI A;  3NX1 A;  4YGZ A;  1HBQ A;  2CM4 A;  2Q2P A;  2OZQ A;  1IFB A;  2W2F A;  5AQ6 A;  1N0S A;  4IAX A;  1QY2 A;  3VG4 A;  5H9N A;  1OEJ A;  1HBP A;  1HMR A;  4LKT A;  1EIO A;  2CZT A;  5F6B A;  3TGB A;  4ZJ0 A;  1EPA A;  1S2P A;  2JU3 A;  3NR3 A;  1JYJ A;  1DF3 A;  1KT5 A;  2Q9S A;  1YIV A;  2LBA A;  4MVI A;  3DSZ A;  1IKE A;  1QQS A;  4QGW A;  1ZNH A;  3P6H A;  2JU8 A;  2FR3 A;  5LJG A;  2ACO A;  3FEP A;  1EQD A;  4XME A;  1GT3 A;  4IB8 A;  4HPC A;  3NQ9 A;  1AB0 A;  5H9K A;  5JR8 A;  1ML7 A;  4GH7 A;  1OBP A;  3WJG A;  2W2A A;  4PSQ A;  2DM5 A;  2FR2 A;  3EBW A;  3UEX A;  2A3F X;  3CWK A;  2GJ5 A;  2ACP X;  1CBS A;  3K3L A;  1T68 X;  3PH6 A;  2R73 A;  2WWP A;  5FFH A;  5HAE A;  1O1U A;  2FS7 A;  5IO5 A;  1LIB A;  4HFO A;  4NNS A;  3NQ3 A;  4I9R A;  2POA A;  4ZHD A;  3O22 A;  4QGV A;  1YWB A;  1EXS A;  1PEE A;  1QFV A;  4GE1 A;  1BRQ A;  1TOW A;  4TNN A;  2LFO A;  3CQN A;  2NNQ A;  5L8N A;  3APV A;  1BSY A;  5L8I A;  5HA1 A;  1D3S A;  1JYD A;  4ES7 A;  4ORU A;  1LIC A;  1MUP A;  1SY1 A;  2A2U A;  5H9A A;  2WR6 A;  1KZW A;  3C77 X;  1G7N A;  3TZS A;  4DQ3 A;  1ALB A;  4AZQ A;  1AVG I;  1TOU A;  3PED A;  4IMO A;  3FR4 A;  1AQB A;  4I3C A;  2WEW A;  1YWD A;  1FE3 A;  4EFG A;  4ZCB A;  1BLR A;  3HWG A;  1LID A;  2LKK A;  3T1D A;  1DZJ A;  2AT0 X;  3OJY C;  1MX7 A;  5BVS A;  2MJI A;  4ZGU A;  3ZUI A;  1U0X A;  3CBC A;  5HBS A;  4D6B A;  3JSQ A;  2RQ0 A;  4QGX A;  3FLL A;  1ZNL A;  2L68 A;  2KT4 B;  1GT1 A;  1ICN A;  1SXX A;  1KZX A;  3NPO A;  5DPQ A;  5L8O A;  3L4R A;  1SXU A;  2RCQ A;  2WQA E;  3HWE A;  1ZRY A;  5LJK A;  3B2H A;  4HPA A;  3FA9 A;  3VG3 A;  4M6S A;  3ZUO A;  2ALL X;  5LJD A;  1G85 A;  3ZQ3 A;  1DZP A;  4ARH A;  2WSJ A;  3PH5 A;  1URE A;  1GT4 A;  1LF7 A;  4I3D A;  1CBR A;  1OEK A;  4LZV A;  4ZH6 A;  1QY1 A;  4R0B A;  1EPB A;  3STK A;  3WXQ A;  3WJB A;  5HCD C;  3KFH A;  1ZNE A;  1HMS A;  3DTQ A;  1NP1 A;  2Q2M A;  3GAQ A;  2R56 A;  1A57 A;  2LB6 A;  1YP6 A;  4CK4 A;  4IMN A;  2W2B A;  3B2J A;  3O19 A;  1KT3 A;  1JJX A;  4QYN A;  2FLJ A;  4LKP A;  2K23 A;  5FAZ A;  1SY0 A;  2L5P A;  4ZR2 A;  3ELZ A;  4YKO A;  5LJC A;  1A18 A;  4N7C A;  1QY0 A;  1NGL A;  1HN2 A;  3U9P C;  1OBQ A;  2YG2 A;  4M7M A;  5HA0 A;  5LKE A;  2XST A;  3EYC A;  4EXZ A;  1EII A;  1SA8 A;  2QO4 A;  2JU7 A;  4YGG A;  1DC9 A;  2L67 A;  2NP1 A;  4HPB A;  4ALO A;  2CM9 A;  4ZHF A;  2OVE A;  2RA6 A;  4MVK A;  5D8J A;  1BJ7 A;  3FIQ A;  3P6E A;  3NAD A;  1G74 A; 
#chains in the Genus database with same CATH topology
 2C1S A;  1DZK A;  4BX6 A;  3ELX A;  4YBU A;  4GDA A;  3HPE A;  4JHQ A;  3SZJ A;  3BY0 A;  2VDF A;  2IZC B;  4GRJ A;  2FWV A;  4NV7 A;  2F73 A;  2OVA A;  1X89 A;  3WJD A;  1LNM A;  3I17 A;  1N4J A;  4FQB B;  1QFT A;  5KID A;  2CAM A;  5IO7 A;  2OFR X;  3PEC A;  1VWR B;  2CBR A;  1O8V A;  4GNY A;  1OBU A;  1Y52 X;  5H8T A;  5EEE A;  1IFC A;  1VWI B;  1I4U A;  2Z4H A;  5B27 A;  3SLJ A;  3T2X A;  3U0D A;  2RTQ B;  2RTB B;  2AT8 X;  2RTN B;  3QKG A;  4O49 A;  4IBA A;  2A5C A;  2Q39 A;  4TKH A;  3VG6 A;  1AVE A;  3PQS A;  3S60 A;  1KQX A;  1YUP A;  2IZF B;  3RDM A;  1B0O A;  4TKJ A;  1VWA B;  4TKB A;  4TQ2 A;  1EUO A;  3VHM A;  5EED A;  1VYG A;  2FTB A;  3SAO A;  3APU A;  2OF8 A;  1E2T A;  1DZM A;  1ZNG A;  2YMS A;  3F8A A;  5B5G A;  4BOE A;  1OPA A;  3BRN A;  1STR B;  4YKM A;  1VWO B;  2RTL A;  5F58 A;  4I9S A;  2X46 A;  5HTE A;  2AH7 X;  5LJB A;  4NV8 A;  1YP7 A;  3B2K A;  4O4S A;  3WVM A;  1GX9 A;  2OL6 O;  1SWQ A;  4YCE A;  2QO5 A;  3D4R A;  3MM0 A;  3OD9 A;  4YDA A;  1FEN A;  5F1E A;  2HMB A;  1ERB A;  2A13 A;  3FEL A;  2RTA A;  3VGW A;  1VWF B;  3FEK A;  5LJE A;  3FEN A;  2X8S A;  2IZB A;  2RTG B;  3EM0 A;  3C78 X;  4Y0S A;  1AEL A;  3ZW1 A;  1EIO A;  4JNJ A;  2RTP B;  2Z4I A;  2OFM X;  5IO6 A;  3MBT A;  3T6L A;  1YWC A;  3OBL A;  4XMF A;  3UEU A;  1HQP A;  5EZ2 A;  1TVQ A;  2X34 A;  2OY7 A;  4MIR A;  4YFP A;  2BC3 A;  5HZ5 A;  4GD9 A;  2A5B A;  1VWB B;  4LZU A;  1BBP A;  2HLV A;  2OVD A;  1D2U A;  3UEW A;  3D97 A;  1SWJ A;  5EDC A;  4ZFX A;  2GTL O;  3RDX A;  1BWY A;  2NNE A;  4ORR A;  3VHI A;  4BX6 B;  1DV9 A;  2I5V O;  4GU8 A;  4IRW A;  4EKV A;  2G8C O;  2DJG A;  4C5P A;  3B2I A;  3CQR A;  1N43 A;  1VPR A;  3I0A A;  2RD7 C;  3KVN A;  3PPT A;  1QAB E;  2A0A A;  2OYB O;  3RE6 A;  1KT6 A;  1MM9 A;  3S5V A;  4OS3 A;  3ZW0 B;  1RXH A;  1Y9L A;  3HWF A;  4Z2P A;  1U17 A;  1EI5 A;  1NP4 A;  1SY2 A;  4CPH A;  4BCS A;  4U9C A;  2JN3 A;  5F7G A;  3FR2 A;  2AT3 X;  3RDS A;  2GTL N;  4OMX A;  1SRF A;  3WJF A;  5D45 A;  4UU3 A;  4O3W A;  5L3Y A;  2EU7 X;  4A1H A;  1JZU A;  1PTS A;  1QG5 A;  3VU1 A;  1NDJ A;  2FRS A;  2VFC A;  1TXL A;  4NLJ A;  2L9C A;  3AUM O;  2BLG A;  4NP1 A;  4YGH A;  4ORX A;  4BJ8 A;  3P02 A;  2FHN X;  2HZQ A;  5DG4 A;  1STS B;  2G5L A;  4YFQ A;  2C4I A;  4Z6J A;  2CZU A;  5IRU A;  4CPI A;  1NBX A;  1X8Q A;  2MM3 A;  2Y32 A;  1RXK A;  4MIS A;  5B29 A;  5CYB A;  1I78 A;  1IIU A;  4XMD A;  3FA8 A;  3BLG A;  3TGA A;  2GC9 A;  1KGL A;  3KQ0 A;  3VE2 A;  5HZ8 A;  3FA6 A;  1SWG A;  1GX8 A;  3FA7 A;  1B4M A;  1JJJ A;  3ZI8 A;  1BSO A;  2NND A;  2BT9 A;  5IXG A;  2E4J A;  3Q34 A;  1KFF A;  3WBG A;  4RUN A;  3KFF A;  4GKC A;  3LHN A;  3ZW1 B;  3TF6 A;  2AT5 X;  2FKG A;  3KZA A;  4QAE A;  5HTD A;  5LKF A;  1B8E A;  2X4M A;  3FMZ A;  3O2Y A;  1IKJ A;  1BEB A;  1X8O A;  4GUZ A;  4IB7 A;  2HZR A;  3HWD A;  1GKA A;  4I6S A;  1T0V A;  2RTM A;  5B5F A;  4BGF A;  1MDC A;  5CHK A;  1X8P A;  5HCE C;  4QZU A;  1JV4 A;  1IJ8 A;  2PY1 A;  4Y0P A;  5H9L A;  1KXO A;  5HCC C;  1Y9T A;  1NQN A;  1BRP A;  4KC7 A;  4ZGF A;  2HYS A;  5IRW A;  4AZM A;  4ALB A;  2GTF X;  3IA8 A;  3UEV A;  1ADL A;  1KOI A;  3BU1 A;  1GGL A;  3LV4 A;  4O3X B;  5EPQ A;  3RZY A;  1A2D A;  1RLB E;  4AYH A;  2X8T A;  3AEH A;  4NYQ A;  3RY2 A;  2PI3 O;  1KT4 A;  1SLG B;  4WFV A;  5CE4 A;  3RY1 A;  1H91 A;  1CBI A;  2AT6 X;  2JOZ A;  3VG2 A;  1KQW A;  4BBO A;  4YH0 A;  4YVB A;  2UYW A;  3TGC A;  3RE5 A;  3WOV A;  1VWC B;  2X56 A;  2ANS A;  1LFO A;  1ERX A;  1LCZ A;  1T8V A;  1XCA A;  2RTE B;  4QQ1 A;  3U03 A;  1BSQ A;  1LPJ A;  2A8G A;  3NX2 A;  4OEM A;  4CDD A;  2K62 A;  4KII A;  4GET A;  4Y0Q A;  2WPU A;  1TW4 A;  3VHH A;  3ZW0 A;  2BSZ A;  1EAL A;  1SRH A;  3STM X;  1I04 A;  1MX8 A;  5EDB A;  4YFR A;  4DCB A;  4ZHC A;  2AMM X;  4O4U A;  1JJU A;  2LBV A;  4U8U O;  4WFU A;  4QRL A;  3WJC A;  1K24 A;  3CBS A;  4Z2V A;  3BX8 A;  3RDO A;  1GXA A;  4N7D A;  1LIF A;  4GZV A;  1FJ1 E;  2DJF A;  1STP A;  2KTD A;  2QOS C;  3F6Z B;  4JO6 A;  4XMH A;  4QYP A;  2AKQ A;  4I60 A;  4YMY A;  3EBK A;  4LQZ A;  5CSE A;  2Q4N A;  4BQU A;  1SXY A;  3AKN A;  1FTP A;  1VWQ B;  5HZ9 A;  4HPD A;  1VYF A;  4AZP A;  1IW2 A;  4ZHG A;  1RXJ A;  1HXZ A;  1CBQ A;  1PMP A;  2AL0 X;  2OL8 O;  3CKF A;  3H3I A;  1SWC A;  3E3C A;  3Q6L A;  4IB6 A;  4L1N A;  1LKE A;  4U8U N;  2N93 A;  1KL4 A;  3RKG A;  5F6Z A;  4AZN A;  2CBS A;  1G5W A;  1R0U A;  1ZND A;  3P6D A;  2OY1 O;  1GKA B;  1A3Y A;  3C76 X;  4MEE A;  1L6M A;  3KFG A;  3PP6 A;  5HWZ A;  3P24 A;  3BX7 A;  1SY3 A;  3STN A;  1RBP A;  4FBO A;  4GNW A;  1UZ2 X;  4MVE A;  1BM5 A;  1ICM A;  2RCT A;  1YWA A;  2RTO B;  4A60 A;  3FR5 A;  1HMT A;  1PBO A;  3SLT A;  2JMB A;  2AF5 A;  1U18 A;  2IZK A;  1OEE A;  3BDR A;  2G78 A;  4Z28 A;  4A8Z A;  1ACD A;  4IAW A;  2JGS A;  4L3R A;  2QM9 A;  2O62 A;  4ZH9 A;  1SWN A;  1SWU A;  1XKI A;  3G7X A;  4ORW A;  5B11 O;  5C0N A;  2F09 A;  2KW1 A;  4OMW A;  5HZ6 A;  3NBX X;  3VG7 A;  4AW8 A;  2Y3F A;  3MVF A;  3KFI A;  3P6F A;  4KT5 A;  3CMP A;  5BVT A;  5FEN A;  1N7Y A;  1X71 A;  1SWL A;  2BHV A;  2ZSC A;  4ORY A;  4QZT A;  5FQ7 E;  3VPJ E;  4NW4 A;  4A1Y A;  5D4A A;  3FW5 A;  1OPB A;  3SOT A;  1FDQ A;  4ON1 A;  4KC8 A;  1DFV A;  3BU9 A;  3RDU A;  2BS5 A;  3D95 A;  3EW2 A;  3P6G A;  1MOY A;  4GJV A;  2FS6 A;  3CR6 A;  3JS1 A;  1AVD A;  1WBI A;  4O3Y A;  4Z2O A;  2P8G A;  3BS2 A;  4I95 A;  2WUT A;  4HWM A;  2QO6 A;  3APX A;  1Z24 A;  4WHI A;  1E00 A;  4AZR A;  1NC9 A;  2RTC B;  1VWN B;  2RTR B;  4CDF A;  2R74 A;  2IFB A;  1GM6 A;  1CJ5 A;  3NP1 A;  1PM1 X;  1VWP B;  4NNT A;  5K06 A;  1X8U A;  2OVS A;  2QOM A;  1E06 A;  1JMZ A;  2G7B A;  1SWE A;  2IZJ A;  4TJZ A;  5HZQ A;  3X00 A;  3WZN A;  4MVL A;  1SWT A;  4CPE A;  1GT5 A;  1S7D A;  4ID2 A;  4O4O A;  5K67 A;  1SXW A;  3VG5 A;  4TLJ A;  2OY8 A;  4Y5D A;  2I5Z O;  2C1Q A;  4NYR A;  4DQ4 A;  4ORS A;  1MEP A;  3B2L A;  3APW A;  1MVG A;  1VWD B;  2KD2 A;  3WJE A;  5LJH A;  1LIE A;  1SWS A;  3FYF A;  1SWB A;  2GH7 A;  4BVM A;  2WQ9 A;  4FBV A;  4INN A;  3QQ2 A;  1JBH A;  1FEM A;  3CKG A;  4O9S A;  2MO5 A;  1KT7 A;  1NQM A;  1W4T A;  2RTH B;  4YCH A;  2MWH A;  1E02 A;  1KL5 A;  4YBP A;  4RUU A;  4UU2 A;  1CRB A;  2HNX A;  4EDE A;  4XMC A;  4KCA A;  1B56 A;  3FW4 A;  4GGT A;  1JIW I;  4I3B A;  2A2G A;  3PQU A;  3S26 A;  1P6P A;  1VWE B;  2X55 A;  3RSW A;  5BVQ A;  4BX5 A;  3S5X A;  3WZP A;  4OS8 A;  5B3M O;  3F9D A;  4BX7 A;  4K19 A;  1LDQ A;  2G79 A;  2GTL M;  1S44 A;  3GE2 A;  4OS0 A;  4AZO A;  3EMM A;  1VWL B;  2XKL A;  2FT9 A;  4GGZ A;  4QNI A;  1QWD A;  4ODD A;  1WUB A;  5D47 A;  2QMI A;  1O1V A;  4YDB A;  4O4X A;  1Y0G A;  4IB9 A;  4EEJ A;  2IZE B;  2JW1 A;  4Y0R A;  4WBK A;  2ZAG A;  3IFB A;  5K68 A;  3AKM A;  1N9M A;  3FDC A;  3HK1 A;  2RTF B;  3BSZ E;  3OE3 A;  1VWM B;  4D6A A;  4DNE A;  4FBR A;  1W6F A;  3P6C A;  3ZWE A;  1FEL A;  5JD2 A;  4XMG A;  2RTJ A;  1I06 A;  1SWP A;  1Y53 X;  4ZHH A;  1ZNK A;  3D96 A;  1E5P A;  5D48 A;  2ASN X;  1X8N A;  5KHP A;  1KL3 A;  2WEX A;  2Y3E A;  5AJB A;  3ZW2 A;  2X45 A;  1EW3 A;  1I05 A;  2RN4 A;  3NX1 A;  4NLI A;  4YGZ A;  2IZD B;  1HBQ A;  2OL7 A;  3PK2 A;  2CM4 A;  2Q2P A;  2OZQ A;  1SRJ A;  1IFB A;  2W2F A;  5AQ6 A;  1LEL A;  1N0S A;  4IAX A;  3HOE A;  1QY2 A;  1SWD A;  3VG4 A;  2FGS A;  4O3Z A;  5H9N A;  1OEJ A;  2BS6 A;  1HBP A;  1HMR A;  4LKT A;  2FKJ A;  2CZT A;  2LA7 A;  5F6B A;  4ZJ0 A;  4CV7 A;  3TGB A;  1EPA A;  1S2P A;  1VWK B;  4CSB A;  2JU3 A;  4CPF A;  2X8F A;  3NR3 A;  1JYJ A;  1DF3 A;  1DF8 A;  1KT5 A;  3N91 A;  2Q9S A;  1YIV A;  2MF6 A;  4GDZ A;  1SWO A;  2LBA A;  5FQ6 E;  4MVI A;  4PJ2 A;  3DSZ A;  1IKE A;  1QQS A;  4QGW A;  2M4L A;  1ZNH A;  4FGI B;  1SLE B;  3P6H A;  2JU8 A;  2FR3 A;  5LJG A;  2ACO A;  3FEP A;  1EQD A;  4XME A;  3WYP A;  1GT3 A;  4IB8 A;  4HPC A;  3NQ9 A;  1RSU B;  1AB0 A;  2IZH B;  5H9K A;  5JR8 A;  1ML7 A;  4JGL A;  4GH7 A;  1OBP A;  3WJG A;  2W2A A;  1HXL A;  1PBY A;  4PSQ A;  2DM5 A;  2FR2 A;  3EBW A;  4BX5 B;  3UEX A;  2A3F X;  3CWK A;  2GJ5 A;  2ACP X;  1CBS A;  3K3L A;  1T68 X;  1SWA A;  3PH6 A;  2R73 A;  4BX7 B;  2F01 A;  2WWP A;  5FFH A;  5HAE A;  1O1U A;  3WZO A;  3SZI A;  4GK9 A;  2FS7 A;  5IO5 A;  1LIB A;  1SRG A;  4HFO A;  3V8U A;  4NNS A;  3NQ3 A;  4I9R A;  2IZI A;  2POA A;  3RBY A;  3SZH A;  4ZHD A;  3O22 A;  4QGV A;  4KH8 A;  1YWB A;  1LDO A;  1EXS A;  1PEE A;  2MHD A;  1QFV A;  4GE1 A;  3WZQ A;  1BRQ A;  1TOW A;  4TNN A;  2LFO A;  3CQN A;  2NNQ A;  2OFB A;  3APV A;  1BSY A;  5L8I A;  5HA1 A;  5L8N A;  1D3S A;  1JYD A;  2IZG B;  3FID A;  3VE1 A;  4ES7 A;  4ORU A;  1LIC A;  1MUP A;  4Z27 A;  3ZZV A;  1SY1 A;  2A2U A;  2QCB A;  5H9A A;  2WR6 A;  1KZW A;  3C77 X;  1G7N A;  4GGR A;  5B10 O;  4DQ3 A;  1ALB A;  4AZQ A;  3TZS A;  2RTI B;  1AVG I;  1TOU A;  2OF9 A;  3PED A;  1RAV A;  4IMO A;  4EQA C;  3FR4 A;  3PDF A;  3HOL A;  1AQB A;  2RTD B;  3NQK A;  4I3C A;  2WEW A;  2ZAI A;  4Y59 A;  4CDE A;  1YWD A;  1FE3 A;  3T2W A;  4ZCB A;  4EFG A;  1BLR A;  1SRI A;  3HWG A;  1LID A;  2LKK A;  3T1D A;  1SWK A;  1SLD B;  3MG5 A;  4U8U M;  1DZJ A;  1LCW A;  5BYP A;  2AT0 X;  1VYO A;  1Y55 X;  3OJY C;  1I9H A;  3WYQ A;  1GX3 A;  3RDQ A;  1MX7 A;  3MX7 A;  5BVS A;  2MJI A;  4ZGU A;  4OEL A;  1U0X A;  3CBC A;  5HBS A;  3ZUI A;  4D6B A;  3JSQ A;  2RQ0 A;  4QGX A;  3FLL A;  1SWF A;  1ZNL A;  2L68 A;  2HKD A;  4GJS A;  1HY2 A;  2KT4 B;  5AJC A;  1GT1 A;  1ICN A;  1SXX A;  4ML7 B;  1JMX A;  1KZX A;  3NPO A;  1UYN X;  5DPQ A;  5L8O A;  3L4R A;  4U46 A;  3RWX A;  4COT A;  1SXU A;  2RCQ A;  2WQA E;  5FQ8 E;  4CDC A;  3HWE A;  5AEO A;  1SMP I;  1VWH B;  3T6F A;  1ZRY A;  2UZ2 A;  1VWJ B;  5LJK A;  3B2H A;  3EW1 A;  4HPA A;  3FA9 A;  3VG3 A;  2RTK A;  3UAQ A;  1OSP O;  2OFA A;  4M6S A;  2ALL X;  3ZUO A;  5LJD A;  1G85 A;  3ZQ3 A;  1DZP A;  1JQP A;  4ARH A;  2WSJ A;  1SLF B;  3PH5 A;  1URE A;  1GT4 A;  1LF7 A;  4I3D A;  1CBR A;  1OEK A;  4LZV A;  4ZH6 A;  4B55 A;  1HQQ A;  1QY1 A;  1LCV A;  4R0B A;  3HTY A;  1EPB A;  4OKA A;  3STK A;  3WXQ A;  1K3B A;  3WJB A;  5HCD C;  2IZL B;  3KFH A;  2X32 A;  1ZNE A;  1HMS A;  1LUQ A;  1NP1 A;  1SRE A;  1SWR A;  2Q2M A;  2R56 A;  3DTQ A;  3GAQ A;  2LB6 A;  1YP6 A;  2OY5 O;  5IRA A;  4CK4 A;  1A57 A;  4IMN A;  2W2B A;  3EC5 A;  2IZA A;  3B2J A;  3O19 A;  3D9W A;  3SLO A;  1KT3 A;  1JJX A;  4IAB A;  2FLJ A;  4QYN A;  4LKP A;  2K23 A;  5KIC A;  1SWH A;  3LTW A;  5FAZ A;  1SY0 A;  2L5P A;  2VFB A;  4ZR2 A;  3ELZ A;  4YKO A;  5LJC A;  1A18 A;  1W5R A;  2KTS A;  4N7C A;  1QY0 A;  2FHL A;  1NGL A;  1HN2 A;  3U9P C;  1OBQ A;  2YG2 A;  4M7M A;  5HA0 A;  5LKE A;  2XST A;  5B2A O;  3EYC A;  1UYO X;  4EXZ A;  1EII A;  1SA8 A;  2QO4 A;  2JU7 A;  4YGG A;  1DC9 A;  2L67 A;  2NP1 A;  3JQO A;  4HPB A;  1N9Y A;  5F2B A;  4U3Q A;  1RST B;  4ALO A;  2CM9 A;  1MK5 A;  4ZHF A;  2OVE A;  2RA6 A;  4MVK A;  5D8J A;  4CPH B;  1BJ7 A;  2AVI A;  3FIQ A;  3P6E A;  3NAD A;  1VWG B;  1G74 A; 
#chains in the Genus database with same CATH homology
 1DZK A;  3ELX A;  4YBU A;  3BY0 A;  4GRJ A;  2FWV A;  2F73 A;  2OVA A;  1X89 A;  3WJD A;  1LNM A;  3I17 A;  4FQB B;  5KID A;  1QFT A;  5IO7 A;  2OFR X;  3PEC A;  2CBR A;  1O8V A;  4GNY A;  1OBU A;  5H8T A;  5K06 A;  5EEE A;  1IFC A;  5B27 A;  1I4U A;  2Z4H A;  3U0D A;  2AT8 X;  3QKG A;  4O49 A;  4IBA A;  2Q39 A;  4TKH A;  3VG6 A;  3PQS A;  3S60 A;  1KQX A;  1YUP A;  1B0O A;  4TKJ A;  4TKB A;  4TQ2 A;  1EUO A;  5EED A;  1VYG A;  2FTB A;  3SAO A;  3APU A;  2YMS A;  1DZM A;  1ZNG A;  3F8A A;  4BOE A;  1OPA A;  3BRN A;  4YKM A;  5F58 A;  4I9S A;  2X46 A;  5HTE A;  2AH7 X;  5LJB A;  1YP7 A;  3B2K A;  4O4S A;  3WVM A;  1GX9 A;  4YCE A;  2QO5 A;  3D4R A;  3OD9 A;  4YDA A;  1FEN A;  5F1E A;  2HMB A;  1ERB A;  2A13 A;  3FEL A;  3FEK A;  5LJE A;  3FEN A;  2X8S A;  3EM0 A;  3C78 X;  4Y0S A;  1AEL A;  3ZW1 A;  2Z4I A;  2OFM X;  5IO6 A;  3MBT A;  1YWC A;  3OBL A;  4XMF A;  3UEU A;  1HQP A;  5EZ2 A;  1TVQ A;  4MIR A;  4YFP A;  5HZ5 A;  4LZU A;  1BBP A;  2HLV A;  2OVD A;  1D2U A;  3UEW A;  3D97 A;  5EDC A;  4ZFX A;  2GTL O;  1BWY A;  2NNE A;  4ORR A;  1DV9 A;  4GU8 A;  3B2I A;  3CQR A;  1VPR A;  3I0A A;  2RD7 C;  3PPT A;  1QAB E;  2A0A A;  3S5V A;  3ZW0 B;  1KT6 A;  4OS3 A;  3HWF A;  1Y9L A;  1U17 A;  1EI5 A;  1NP4 A;  1SY2 A;  4U9C A;  2JN3 A;  5F7G A;  3FR2 A;  2AT3 X;  2GTL N;  4OMX A;  3WJF A;  5D45 A;  4UU3 A;  4O3W A;  2EU7 X;  4A1H A;  1JZU A;  1QG5 A;  3VU1 A;  2FRS A;  4NLJ A;  1TXL A;  4NP1 A;  2L9C A;  2BLG A;  4YGH A;  4ORX A;  3P02 A;  2HZQ A;  5DG4 A;  4YFQ A;  2CZU A;  1X8Q A;  2MM3 A;  4MIS A;  5B29 A;  5CYB A;  1IIU A;  4XMD A;  3FA8 A;  3BLG A;  3TGA A;  2GC9 A;  1KGL A;  3KQ0 A;  3VE2 A;  5HZ8 A;  3FA6 A;  1GX8 A;  3FA7 A;  1B4M A;  1JJJ A;  3ZI8 A;  1BSO A;  2NND A;  2BT9 A;  2E4J A;  4RUN A;  3KFF A;  4GKC A;  3LHN A;  3ZW1 B;  3TF6 A;  2AT5 X;  3KZA A;  4QAE A;  5HTD A;  5LKF A;  1B8E A;  3FMZ A;  3O2Y A;  1IKJ A;  1BEB A;  1X8O A;  4IB7 A;  2HZR A;  3HWD A;  1GKA A;  4I6S A;  1T0V A;  1MDC A;  5HCE C;  1X8P A;  4QZU A;  1JV4 A;  2PY1 A;  4Y0P A;  5H9L A;  1KXO A;  5HCC C;  1Y9T A;  4KC7 A;  1BRP A;  4ZGF A;  2HYS A;  4AZM A;  4ALB A;  2GTF X;  3IA8 A;  3UEV A;  1ADL A;  1KOI A;  3BU1 A;  1GGL A;  3LV4 A;  4O3X B;  5EPQ A;  3RZY A;  1A2D A;  1RLB E;  4AYH A;  2X8T A;  4NYQ A;  1KT4 A;  4WFV A;  5CE4 A;  1H91 A;  1CBI A;  2AT6 X;  2JOZ A;  3VG2 A;  1KQW A;  4YH0 A;  3TGC A;  3WOV A;  2ANS A;  1LFO A;  1ERX A;  1T8V A;  1XCA A;  4QQ1 A;  3U03 A;  1BSQ A;  1LPJ A;  3NX2 A;  2K62 A;  4KII A;  4GET A;  4Y0Q A;  1TW4 A;  3ZW0 A;  1EAL A;  3STM X;  1I04 A;  1MX8 A;  5EDB A;  4YFR A;  4ZHC A;  2AMM X;  4O4U A;  2LBV A;  4U8U O;  4WFU A;  4QRL A;  3WJC A;  3CBS A;  3BX8 A;  1GXA A;  4N7D A;  1LIF A;  4GZV A;  2QOS C;  3F6Z B;  2KTD A;  4XMH A;  4QYP A;  2AKQ A;  4YMY A;  3EBK A;  4LQZ A;  4BQU A;  2Q4N A;  1SXY A;  3AKN A;  1FTP A;  5HZ9 A;  4HPD A;  1VYF A;  4AZP A;  1IW2 A;  4ZHG A;  1PMP A;  1CBQ A;  2AL0 X;  3WBG A;  3H3I A;  4IB6 A;  3E3C A;  3RKG A;  3Q6L A;  4L1N A;  4U8U N;  1LKE A;  4AZN A;  2N93 A;  5F6Z A;  1G5W A;  2CBS A;  1R0U A;  1ZND A;  3P6D A;  1GKA B;  1A3Y A;  3C76 X;  5HWZ A;  1L6M A;  3KFG A;  3PP6 A;  3P24 A;  3BX7 A;  1SY3 A;  3STN A;  1RBP A;  4FBO A;  4GNW A;  1UZ2 X;  4MVE A;  1BM5 A;  1ICM A;  2RCT A;  1YWA A;  4A60 A;  3FR5 A;  1HMT A;  1PBO A;  2JMB A;  1U18 A;  3BDR A;  1OEE A;  2G78 A;  4A8Z A;  1ACD A;  4IAW A;  4L3R A;  2QM9 A;  2O62 A;  4ZH9 A;  1XKI A;  3G7X A;  5HZ6 A;  4ORW A;  5C0N A;  2F09 A;  2KW1 A;  4OMW A;  3NBX X;  3VG7 A;  4AW8 A;  3MVF A;  3P6F A;  3KFI A;  4KT5 A;  5BVT A;  3CMP A;  5FEN A;  2BHV A;  1X71 A;  4QZT A;  4ORY A;  5FQ7 E;  3VPJ E;  4A1Y A;  4NW4 A;  5D4A A;  3FW5 A;  1OPB A;  3SOT A;  1FDQ A;  4ON1 A;  4KC8 A;  1DFV A;  3BU9 A;  2BS5 A;  3D95 A;  3P6G A;  2FS6 A;  3CR6 A;  3JS1 A;  4O3Y A;  2P8G A;  3BS2 A;  4I95 A;  2WUT A;  4HWM A;  2QO6 A;  3APX A;  1Z24 A;  4WHI A;  1E00 A;  4AZR A;  1CJ5 A;  2R74 A;  2IFB A;  1GM6 A;  3NP1 A;  1PM1 X;  4NNT A;  1X8U A;  2OVS A;  5HZQ A;  1E06 A;  2G7B A;  4TJZ A;  4MVL A;  1GT5 A;  1S7D A;  4ID2 A;  4O4O A;  1SXW A;  3VG5 A;  4TLJ A;  4NYR A;  4DQ4 A;  4ORS A;  5LJH A;  3B2L A;  3APW A;  1MVG A;  2KD2 A;  3WJE A;  1LIE A;  3FYF A;  4BVM A;  2WQ9 A;  4FBV A;  4INN A;  1JBH A;  1FEM A;  4O9S A;  2MO5 A;  1KT7 A;  4YCH A;  2MWH A;  1E02 A;  4YBP A;  4RUU A;  4UU2 A;  1CRB A;  2HNX A;  4EDE A;  4XMC A;  4KCA A;  1B56 A;  3FW4 A;  1JIW I;  4I3B A;  2A2G A;  3PQU A;  3S26 A;  1P6P A;  3RSW A;  5BVQ A;  3S5X A;  4OS8 A;  3F9D A;  4K19 A;  2G79 A;  2GTL M;  1S44 A;  3GE2 A;  4OS0 A;  4AZO A;  3EMM A;  2XKL A;  2FT9 A;  4QNI A;  1QWD A;  4ODD A;  5D47 A;  2QMI A;  1O1V A;  4YDB A;  4O4X A;  4EEJ A;  4IB9 A;  2JW1 A;  4Y0R A;  4WBK A;  2ZAG A;  3IFB A;  3AKM A;  3HK1 A;  3BSZ E;  3OE3 A;  4D6A A;  4FBR A;  3P6C A;  3ZWE A;  1FEL A;  4XMG A;  1I06 A;  4ZHH A;  1ZNK A;  3D96 A;  1E5P A;  5D48 A;  2ASN X;  1X8N A;  5KHP A;  5AJB A;  2WEX A;  3ZW2 A;  2X45 A;  1EW3 A;  1I05 A;  2RN4 A;  3NX1 A;  4NLI A;  4YGZ A;  1HBQ A;  2CM4 A;  2Q2P A;  2OZQ A;  1IFB A;  2W2F A;  5AQ6 A;  1N0S A;  4IAX A;  3HOE A;  1QY2 A;  3VG4 A;  5H9N A;  4O3Z A;  1OEJ A;  2BS6 A;  1HBP A;  1HMR A;  4LKT A;  1EIO A;  2CZT A;  2LA7 A;  5F6B A;  4ZJ0 A;  4CV7 A;  3TGB A;  1EPA A;  1S2P A;  4CSB A;  2JU3 A;  2X8F A;  3NR3 A;  1JYJ A;  1DF3 A;  1KT5 A;  3N91 A;  2Q9S A;  1YIV A;  4GDZ A;  2LBA A;  5FQ6 E;  4MVI A;  4PJ2 A;  3DSZ A;  1IKE A;  1QQS A;  4QGW A;  2M4L A;  1ZNH A;  4FGI B;  3P6H A;  2JU8 A;  2FR3 A;  5LJG A;  2ACO A;  3FEP A;  1EQD A;  4XME A;  1GT3 A;  4IB8 A;  4HPC A;  3NQ9 A;  1AB0 A;  5H9K A;  5JR8 A;  1ML7 A;  4JGL A;  4GH7 A;  1OBP A;  3WJG A;  2W2A A;  4PSQ A;  2DM5 A;  2FR2 A;  3EBW A;  3UEX A;  2A3F X;  3CWK A;  2GJ5 A;  2ACP X;  1CBS A;  3K3L A;  1T68 X;  3PH6 A;  2R73 A;  2WWP A;  5FFH A;  5HAE A;  1O1U A;  4GK9 A;  2FS7 A;  5IO5 A;  1LIB A;  4HFO A;  3V8U A;  4NNS A;  3NQ3 A;  4I9R A;  2POA A;  3RBY A;  4ZHD A;  3O22 A;  4QGV A;  4KH8 A;  1YWB A;  1EXS A;  1PEE A;  2MHD A;  1QFV A;  4GE1 A;  1BRQ A;  1TOW A;  4TNN A;  2LFO A;  3CQN A;  2NNQ A;  5L8N A;  3APV A;  1BSY A;  5L8I A;  5HA1 A;  1D3S A;  1JYD A;  4ES7 A;  3VE1 A;  4ORU A;  1LIC A;  1MUP A;  3ZZV A;  1SY1 A;  2A2U A;  5H9A A;  2WR6 A;  1KZW A;  3C77 X;  1G7N A;  3TZS A;  4DQ3 A;  1ALB A;  4AZQ A;  1AVG I;  1TOU A;  3PED A;  4IMO A;  4EQA C;  3FR4 A;  3HOL A;  1AQB A;  3NQK A;  4I3C A;  2WEW A;  2ZAI A;  1YWD A;  1FE3 A;  4EFG A;  4ZCB A;  1BLR A;  3HWG A;  1LID A;  2LKK A;  3T1D A;  4U8U M;  1DZJ A;  5BYP A;  2AT0 X;  3OJY C;  1MX7 A;  3MX7 A;  5BVS A;  2MJI A;  4ZGU A;  3ZUI A;  1U0X A;  3CBC A;  5HBS A;  4D6B A;  3JSQ A;  2RQ0 A;  4QGX A;  3FLL A;  1ZNL A;  2L68 A;  2KT4 B;  5AJC A;  1GT1 A;  1ICN A;  1SXX A;  4ML7 B;  1KZX A;  3NPO A;  5DPQ A;  5L8O A;  3L4R A;  3RWX A;  4COT A;  1SXU A;  2RCQ A;  2WQA E;  5FQ8 E;  5AEO A;  3HWE A;  1SMP I;  1ZRY A;  5LJK A;  3B2H A;  4HPA A;  3FA9 A;  3VG3 A;  3UAQ A;  4M6S A;  3ZUO A;  2ALL X;  5LJD A;  1G85 A;  3ZQ3 A;  1DZP A;  4ARH A;  2WSJ A;  3PH5 A;  1URE A;  1GT4 A;  1LF7 A;  4I3D A;  1CBR A;  1OEK A;  4LZV A;  4ZH6 A;  1QY1 A;  4R0B A;  3HTY A;  1EPB A;  3STK A;  3WXQ A;  3WJB A;  5HCD C;  3KFH A;  1ZNE A;  1HMS A;  3DTQ A;  1NP1 A;  2Q2M A;  3GAQ A;  2R56 A;  1A57 A;  2LB6 A;  1YP6 A;  4CK4 A;  4IMN A;  2W2B A;  3B2J A;  3O19 A;  1KT3 A;  1JJX A;  4IAB A;  2FLJ A;  4QYN A;  4LKP A;  2K23 A;  5KIC A;  5FAZ A;  1SY0 A;  2L5P A;  4ZR2 A;  3ELZ A;  4YKO A;  5LJC A;  1A18 A;  2KTS A;  4N7C A;  1QY0 A;  1NGL A;  1HN2 A;  3U9P C;  1OBQ A;  2YG2 A;  4M7M A;  5HA0 A;  5LKE A;  2XST A;  3EYC A;  4EXZ A;  1EII A;  1SA8 A;  2QO4 A;  2JU7 A;  4YGG A;  1DC9 A;  2L67 A;  2NP1 A;  3JQO A;  4HPB A;  4ALO A;  4U3Q A;  2CM9 A;  4ZHF A;  2OVE A;  2RA6 A;  4MVK A;  5D8J A;  1BJ7 A;  3FIQ A;  3P6E A;  3NAD A;  1G74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...