1YWBA

0.9 a structure of np4 from rhodnius prolixus complexed with no at ph 5.6
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein, blood clotting
molecule keywords nitrophorin 4
publication title Ultrahigh Resolution Structures of Nitrophorin 4: Heme Distortion in Ferrous CO and NO Complexes
pubmed doi rcsb
source organism Rhodnius prolixus
total genus 49
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ywbA00
1HBQA 3FENA 1NP4A 1PM1X 3MVFA 4NLIA 3CQRA 1GXAA 3BY0A 1NGLA 1LF7A 1FTPA 1YUPA 4YFPA 1RLBE 3P6FA 1QWDA 3D97A 2CZTA 3FEKA 3CWKA 1MVGA 1HQPA 2EU7X 2L68A 4UU3A 2KTDA 2WSJA 2W2FA 1YWDA 1FELA 4WFVA 3RZYA 1A57A 2A2GA 3G7XA 2GTFX 3F9DA 4ZJ0A 3TZSA 2FRSA 1B0OA 3NR3A 1YWCA 1MDCA 4MVLA 5D47A 1S2PA 3O19A 5HZ8A 2RQ0A 5HCCC 1DC9A 2RCTA 1O8VA 2WQ9A 4LKTA 5DG4A 2BLGA 5L8IA 2AT5X 4YMYA 5HWZA 1BRPA 3FA7A 3KQ0A 1OPBA 2RD7C 5EDCA 3FA9A 1SY1A 4O9SA 5HAEA 1OEEA 1G74A 3UEXA 1QABE 1OBQA 4Y0RA 4YDBA 5HZ5A 3CQNA 4ODDA 5BVTA 2FT9A 4N7CA 4XMCA 3WJBA 3SAOA 2XKLA 4OS0A 5H8TA 1YIVA 3OJYC 3F8AA 4ORXA 1ZNGA 2K62A 2NNDA 1P6PA 4Y0SA 4XMFA 5HCEC 1AELA 1CBIA 2QO4A 5IO5A 3CBSA 3JSQA 3Q6LA 3UEVA 4NNSA 5C0NA 1RBPA 3NX1A 1BSOA 3KFHA 1IFCA 4LZUA 4ES7A 4D6AA 2X46A 2JU8A 4AZQA 3FW5A 3WXQA 1IW2A 5H9NA 1GT3A 1QG5A 4AW8A 2YG2A 5D4AA 3PH6A 4BQUA 1GT1A 1G85A 4ARHA 2HMBA 4YDAA 2A2UA 3NQ9A 1ML7A 1CBQA 5KHPA 4AZPA 1ACDA 3ELZA 3NQ3A 1EUOA 5JR8A 3KFIA 4WFUA 4ORUA 1B56A 1DF3A 4XMHA 4ZHFA 1GKAA 3C78X 1A2DA 5CE4A 2AKQA 3WJFA 3WJDA 1TW4A 2DM5A 2FR2A 1U18A 4ORYA 1ZNEA 3EM0A 4NLJA 4AZNA 4TNNA 2NNEA 4YH0A 2QO5A 1KT5A 3AKMA 3CBCA 1CBSA 1OPAA 4ZH6A 4M6SA 3HWFA 1HMTA 2O62A 4LZVA 3TGAA 1XKIA 2Q4NA 1JYDA 1X8QA 2QM9A 1EXSA 2WQAE 2OVAA 3BX8A 2JU3A 4QGVA 1MX7A 3GAQA 3KZAA 5HBSA 5IO7A 4I9SA 2L9CA 2WUTA 4LKPA 3IFBA 4YGGA 5HA0A 4ORSA 1KQXA 1JJXA 3BRNA 1IKEA 3JS1A 5HCDC 1PEEA 2WEWA 4MVIA 1U17A 2ACPX 1JBHA 1HN2A 1X8NA 2LFOA 2HZRA 5FFHA 3WJEA 1T68X 1YP6A 5LJBA 4IB9A 3EBWA 3D96A 5F58A 4I3DA 1O1VA 4YCEA 4IAXA 4TKBA 5L8OA 4I9RA 1JZUA 3FW4A 1UZ2X 4TLJA 4CK4A 1ZNLA 4QAEA 3APUA 3BLGA 1EPAA 3L4RA 1A18A 1KOIA 3NADA 2LBVA 2GJ5A 1LIDA 4ALBA 2OVDA 3HWGA 1BJ7A 1KT7A 5EEEA 1CJ5A 1OBUA 4GNYA 2FWVA 1D2UA 3AKNA 1ZNKA 1XCAA 5KICA 4ZCBA 3BU9A 1BSYA 3EMMA 3PP6A 1I4UA 1ERBA 2R73A 3PH5A 2AMMX 5BVSA 4TQ2A 1FDQA 3D95A 4EFGA 3VG3A 4EXZA 2FS6A 3STKA 1SXUA 2CBRA 2L67A 1BBPA 1E00A 4IB6A 4NYQA 4AZRA 4YKOA 2KT4B 1PMPA 2AL0X 1BM5A 5LJHA 4M7MA 3EBKA 1T8VA 4HPAA 1U0XA 3VG2A 1TVQA 3FIQA 3NP1A 1E02A 2ANSA 2MJIA 1SA8A 1EIOA 3HWEA 1IKJA 4PSQA 3QKGA 1E5PA 4GNWA 4GE1A 5HZQA 3DSZA 5B27A 2HZQA 5LJDA 1OEKA 1X8PA 1TOWA 1GT5A 2A0AA 4YGHA 3EYCA 2AT6X 1QFTA 3CMPA 3WBGA 2NP1A 1X8OA 4GRJA 3BS2A 5EEDA 4MVKA 4NNTA 1JYJA 3O22A 1GGLA 1I05A 1QY0A 3BDRA 2Q9SA 1QFVA 3C76X 4AZMA 2W2BA 1DV9A 4QYNA 1GM6A 4ZGUA 1B8EA 4ORWA 3T1DA 1I04A 4IMOA 1IFBA 2G7BA 3P6HA 1Z24A 2MO5A 3FLLA 4Y0PA 4TKHA 2AT0X 3STNA 2CBSA 4YGZA 2LB6A 1PBOA 5LJKA 1S44A 1YWAA 3STMX 5HZ6A 1IIUA 3WJGA 1BLRA 1VPRA 3KFFA 4K19A 1SXWA 4QGWA 2W2AA 1A3YA 1AVGI 1YWBA 2LKKA 4ZH9A 4QZUA 3C77X 1OBPA 2RA6A 3TGCA 1GX8A 4A1HA 4ZHGA 1I06A 4QYPA 1LIEA 4GKCA 4XMDA 3NPOA 5H9AA 3APXA 5EDBA 4Y0QA 5AQ6A 4HPDA 1AB0A 1KXOA 4ORRA 4QGXA 1MX8A 4EDEA 1LIBA 5F6ZA 1FENA 3NX2A 1LNMA 3BSZE 5H9LA 1BWYA 2JU7A 3B2LA 4ALOA 2L5PA 1FE3A 3FA6A 3PECA 4YFQA 1ZRYA 3ELXA 3VG7A 4DQ3A 5HZ9A 4A60A 2FTBA 2HNXA 4AZOA 1S7DA 3FR5A 1CBRA 5HTEA 2OZQA 4EEJA 1H91A 4WBKA 3BX7A 1B4MA 1X71A 3FR4A 2WR6A 3I0AA 3K3LA 4YBPA 3UEWA 4ZHDA 2FLJA 2LBAA 3P6EA 3APWA 2N93A 1X8UA 4D6BA 1HMSA 5FENA 2CM4A 1QY2A 1EPBA 1KZXA 5DPQA 1OEJA 1G5WA 4ZFXA 5BVQA 1KT4A 2RCQA 2P8GA 1E06A 3DTQA 3HWDA 3I17A 4YKMA 3UEUA 4BVMA 2X45A 4GH7A 5D8JA 2JN3A 2Q2MA 5IO6A 5H9KA 4DQ4A 1HBPA 2E4JA 2FR3A 4ZR2A 1KT3A 3CR6A 5D45A 4RUUA 2Q2PA 2WEXA 3PPTA 3VG5A 1DZJA 2JOZA 1LKEA 3FEPA 1MUPA 1TXLA 1EALA 5EZ2A 2K23A 1ADLA 1R0UA 4IMNA 2ACOA 2GC9A 1X89A 4I3CA 1ZNHA 4BOEA 3MBTA 4RUNA 3U9PC 5EPQA 1ALBA 5LJEA 4YCHA 4XMEA 4YBUA 2Q39A 1KQWA 1SY3A 2ASNX 3U0DA 1SXXA 4YFRA 5LKEA 1KT6A 5F6BA 2IFBA 3KFGA 5HTDA 1QQSA 1VYGA 2AT3X 4QZTA 1ICMA 2WWPA 1TOUA 2FS7A 5F7GA 5LJCA 2CZUA 3O2YA 1DZPA 3APVA 5B29A 2XSTA 1N0SA 1AQBA 2POAA 1LFOA 1BRQA 4IB7A 2NNQA 3FR2A 3ZUIA 2F73A 4UU2A 4XMGA 1O1UA 4TKJA 1UREA 1GX9A 2OVEA 4HPBA 3HK1A 1JJJA 3ZUOA 1KGLA 5D48A 1LIFA 3TGBA 2QOSC 3FELA 2OFRX 1D3SA 4OMWA 1LICA 2A3FX 2HYSA 4TJZA 1SY0A 1QY1A 1NP1A 2AT8X 1ERXA 3B2IA 1DZKA 2G79A 3WJCA 1JV4A 1SY2A 1VYFA 2ALLX 3IA8A 1DFVA 4NYRA 2R74A 2MM3A 3B2JA 3VG6A 1BEBA 4A1YA 2R56A 1DZMA 1HMRA 1BSQA 4HPCA 1KZWA 4IB8A 5LJGA 3B2KA 3FMZA 4IBAA 5F1EA 2HLVA 4HFOA 3BU1A 3WVMA 3P6DA 2AH7X 1EW3A 1GT4A 1YP7A 1T0VA 3B2HA 4A8ZA 2G78A 4R0BA 3FA8A 4ZHCA 1LPJA 2OFMX 5K06A 4OMXA 3P6CA 4NP1A 1ZNDA 4I3BA 1EIIA 3VG4A 3ZQ3A 5LKFA 4IAWA 2PY1A 3P6GA 1ICNA 3U03A 1CRBA 5L8NA 1L6MA 4OS3A 5KIDA 1GKAB 3PEDA 5HA1A 1EQDA 1SXYA 1G7NA 5FAZA 4OS8A 2A13A 2QO6A 4GETA 4KIIA 1FEMA 4N7DA 3S26A 2CM9A 3RSWA 3TF6A 4ZHHA 4AYHA
chains in the Genus database with same CATH superfamily
1N9MA 1HBQA 3N91A 4CV7A 3FENA 1NP4A 3SZIA 1PM1X 4CDFA 3MVFA 4NLIA 3CQRA 1GXAA 2RN4A 2IZLB 3BY0A 1NGLA 5IRWA 1LF7A 4FGIB 1FTPA 1YUPA 2JMBA 3FDCA 4GD9A 4YFPA 1RLBE 3P6FA 1K24A 1SRGA 3SOTA 1QWDA 3D97A 5B11O 1WBIA 4KC8A 3VU1A 2CZTA 3FEKA 5K67A 3CWKA 3X00A 1VWOB 4MVEA 3PK2A 3VE2A 1MVGA 4U8UM 4Z2OA 1STSB 2IZFB 1HQPA 2EU7X 2C1QA 1N4JA 2L68A 2OFAA 4UU3A 2KTDA 5F2BA 2WSJA 2W2FA 1YWDA 1FELA 4WFVA 4CDDA 5L3YA 1SMPI 3RZYA 2A2GA 4ZHFA 1A57A 4JHQA 3G7XA 2GTFX 3F9DA 4ZJ0A 3TZSA 2IZAA 2FRSA 1B0OA 2OL6O 1YWCA 1MDCA 3NR3A 4MVLA 5D47A 1S2PA 3O19A 4BX7A 4YVBA 2RQ0A 5HCCC 5HZ8A 1DC9A 2RCTA 1O8VA 2WQ9A 4LKTA 5DG4A 2BLGA 4BCSA 2IZIA 2AT5X 5L8IA 4JO6A 5CHKA 4YMYA 5HWZA 3S5VA 1BRPA 4GGRA 1SWSA 3FA7A 2RTNB 2GTLM 2IZHB 2YMSA 3KQ0A 2KTSA 1DF8A 2HKDA 5IXGA 1OPBA 1VWJB 2RD7C 5EDCA 3FA9A 4U3QA 1SY1A 4O9SA 2I5ZO 2OY5O 1OEEA 1G74A 1SWOA 5HAEA 3UEXA 1QABE 3P24A 4O3WA 1OBQA 1RAVA 3VE1A 4Y0RA 4YDBA 5HZ5A 3CQNA 4ODDA 3RDMA 3CKGA 5FQ8E 5BVTA 2FT9A 4N7CA 4XMCA 3WJBA 3SAOA 1I78A 2XKLA 4L3RA 4OS0A 5H8TA 1YIVA 3OJYC 3F8AA 4ORXA 1ZNGA 2K62A 4B55A 4FBRA 4I60A 2BS5A 1P6PA 1NQNA 2NNDA 4XMFA 4Y0SA 5HCEC 1SLFB 1AELA 4CSBA 1CBIA 2IZJA 2QO4A 5IO5A 3CBSA 1UYOX 3JSQA 1SWTA 3Q6LA 4NNSA 4OELA 3UEVA 5C0NA 4FQBB 1RBPA 3NX1A 1PTSA 1BSOA 3KFHA 1IFCA 4LZUA 4ES7A 4D6AA 2X46A 5B2AO 2JU8A 4AZQA 2QCBA 3FW5A 3WXQA 1IW2A 5H9NA 1GT3A 1QG5A 2WPUA 3WYPA 4CPEA 3NQKA 4AW8A 2YG2A 5D4AA 1HQQA 3PH6A 4BQUA 1GT1A 1G85A 3E3CA 2FKGA 4ARHA 2HMBA 4YDAA 2A2UA 3NQ9A 1ML7A 1CBQA 1STRB 4AZPA 4COTA 5KHPA 1ACDA 1VWBB 1NDJA 3ELZA 1EUOA 3LTWA 3NQ3A 4CPHA 5JR8A 3KFIA 4WFUA 4ORUA 4BX5B 1B56A 1LELA 1LDQA 4XMHA 1LCZA 2G5LA 2RTEB 2RTRB 5JD2A 2FHNX 2Y3FA 1GKAA 2Z4IA 3C78X 3PQUA 1A2DA 5CE4A 3ZI8A 2AKQA 3MM0A 4O4SA 3WJFA 3WJDA 1TW4A 2DM5A 2FR2A 1U18A 4ORYA 1ZNEA 3EM0A 4NLJA 4O4XA 4AZNA 4Z27A 4TNNA 2NNEA 4BX6B 4YH0A 2QO5A 1KT5A 3AKMA 2CAMA 3V8UA 3CBCA 1CBSA 1OPAA 4ZH6A 4M6SA 3HWFA 1HMTA 2O62A 4LZVA 2RTLA 4GU8A 3TGAA 1XKIA 2Q4NA 1JYDA 1X8QA 2QM9A 4JNJA 1EXSA 2WQAE 2OVAA 3OE3A 1E2TA 3JQOA 4KCAA 3BX8A 2JU3A 4CDCA 2A8GA 4QGVA 4ZGFA 3RY2A 1MX7A 3GAQA 2RTDB 3KZAA 5HBSA 5IO7A 3ZW1B 3T6LA 4O49A 4I9SA 2L9CA 2WUTA 4LKPA 3UAQA 3IFBA 4IRWA 4YGGA 5HA0A 1NQMA 1RXHA 2RTMA 3SLOA 4ORSA 1KQXA 2A5BA 1JJXA 1JJUA 3BRNA 4GJVA 1IKEA 3JS1A 5HCDC 2X56A 1PEEA 5BYPA 2WEWA 4MVIA 4GDAA 1U17A 3H3IA 4Z2PA 1FJ1E 2ACPX 1JBHA 1HN2A 3RE6A 2OL7A 3VGWA 1X8NA 2LFOA 1KFFA 2HZRA 4KT5A 5FFHA 3RDXA 3WJEA 4Z6JA 1T68X 1YP6A 5LJBA 4IB9A 3ZW2A 3EBWA 3D96A 5F58A 4I3DA 1O1VA 1SWUA 4YCEA 4CPFA 4IAXA 3HOLA 4TKBA 5L8OA 4I9RA 1JZUA 1HXLA 3FW4A 1UZ2X 4TLJA 4CK4A 2RTAA 2IZEB 4GZVA 1ZNLA 3PQSA 3F6ZB 3APUA 4QAEA 3BLGA 1EPAA 3L4RA 1A18A 1KOIA 1RSTB 3NADA 4GDZA 3WYQA 1VWMB 2OY8A 2LA7A 2LBVA 2GJ5A 1LIDA 4ALBA 2OVDA 3HWGA 2RTHB 3SLTA 3FYFA 1BJ7A 1KT7A 5EEEA 1CJ5A 1OBUA 4GNYA 2FWVA 1D2UA 3AKNA 1ZNKA 1XCAA 5KICA 1VWGB 4ZCBA 3BU9A 3WOVA 1BSYA 4HWMA 3EMMA 3PP6A 1I4UA 2JGSA 1ERBA 2R73A 3PH5A 2AMMX 4ON1A 5BVSA 3MG5A 4Z28A 4TQ2A 1KL4A 1K3BA 1FDQA 3D95A 5K68A 3VG3A 4EFGA 4EXZA 2FS6A 3STKA 1SXUA 2CBRA 2IZCB 2L67A 4U8UN 4Y59A 5B3MO 1BBPA 1SWKA 1SRIA 3PDFA 1E00A 4EQAC 4IB6A 4NYQA 2ZSCA 1VWQB 5IRAA 4YKOA 2KT4B 2X55A 4AZRA 1SRJA 5AEOA 3HTYA 1PMPA 2AL0X 1BM5A 3SLJA 5LJHA 4M7MA 3EBKA 1T8VA 3D9WA 4HPAA 1U0XA 3VG2A 4NV8A 2IZDB 2IZBA 1TVQA 3FIQA 2F09A 3NP1A 4GGZA 4BX5A 2RTJA 3ZZVA 1SWEA 2DJFA 1E02A 2IZKA 2ZAGA 4KC7A 2ANSA 1W6FA 2MJIA 1SA8A 1EIOA 5FQ7E 2GTLN 3HWEA 1IKJA 2G8CO 4L1NA 3QKGA 4PSQA 5FQ6E 1E5PA 4GNWA 4GE1A 5HZQA 3RDUA 3VHMA 3DSZA 5B27A 4A1YA 2C1SA 1WUBA 4GK9A 2HZQA 5LJDA 4BX6A 1KL5A 1OEKA 2JW1A 1X8PA 1STPA 1TOWA 1GT5A 2A0AA 4KH8A 2GH7A 4YGHA 3EYCA 2AT6X 2C4IA 4FBVA 1GX3A 3EC5A 2F01A 1QFTA 3CMPA 3WBGA 2NP1A 1X8OA 4GRJA 4O3ZA 3RDQA 4OEMA 3BS2A 4INNA 5EEDA 2OF9A 3LV4A 2MHDA 1LCWA 1JYJA 3O22A 4MVKA 4NNTA 1GGLA 1I05A 1QY0A 3BDRA 2Q9SA 3WZOA 2QMIA 3ZW0B 1SWJA 1QFVA 3C76X 4AZMA 2W2BA 2AVIA 4BBOA 1DV9A 1IJ8A 1SWRA 4GUZA 4QYNA 3S5XA 1GM6A 4ZGUA 1B8EA 4ORWA 3T1DA 1I04A 4IMOA 1IFBA 1SWBA 1MM9A 1VWKB 1SWNA 2G7BA 1Z24A 2MO5A 3P6HA 2OL8O 3FLLA 4Y0PA 2FHLA 4TKHA 2AT0X 2X8TA 3STNA 3RBYA 4QRLA 2CBSA 1LUQA 3T2XA 4YGZA 2LB6A 1I9HA 1PBOA 3WZNA 1S44A 1YWAA 3STMX 5LJKA 5HZ6A 1SWQA 1IIUA 3VPJE 1RXJA 3WJGA 1VPRA 3KFFA 4K19A 1SXWA 4QGWA 2W2AA 1BLRA 1A3YA 1AVGI 1YWBA 4QQ1A 2LKKA 2X4MA 3SZJA 3ZW1A 2X8FA 4ID2A 4QZUA 4ZH9A 3C77X 1OBPA 2RA6A 2OFBA 4QNIA 1GX8A 4A1HA 4ZHGA 3TGCA 1I06A 4QYPA 1LIEA 1VWPB 4GKCA 4XMDA 3NPOA 5H9AA 3APXA 5EDBA 1KL3A 3OBLA 4Y0QA 5AQ6A 4HPDA 1AB0A 3VG6A 1KXOA 4ORRA 4QGXA 1MX8A 4WHIA 1LIBA 3RE5A 5F6ZA 4EDEA 1KZWA 1FENA 3NX2A 1LNMA 2Z4HA 3BSZE 5H9LA 4MIRA 4CPIA 1BWYA 1SWLA 2JU7A 3B2LA 4ALOA 2L5PA 1EI5A 1FE3A 3FA6A 3PECA 4NW4A 4YFQA 4CDEA 1ZRYA 3ELXA 1OSPO 2DJGA 3VG7A 4DQ3A 4DCBA 5HZ9A 2BS6A 4A60A 2FTBA 2Y3EA 4GJSA 3RWXA 2HNXA 4O3YA 4U46A 4AZOA 3LHNA 4GGTA 1S7DA 2RTCB 3FR5A 1CBRA 2KD2A 1RXKA 3NBXX 1Y55X 5HTEA 1VWEB 3RY1A 2OF8A 2OZQA 4EEJA 1H91A 4WBKA 3BX7A 1B4MA 1X71A 3FR4A 3AEHA 1AVEA 1SRHA 2WR6A 5IRUA 3RDSA 3I0AA 3K3LA 4YBPA 3UEWA 4ZHDA 2X34A 2FLJA 2LBAA 3P6EA 3APWA 2N93A 3ZWEA 2PI3O 1X8UA 4D6BA 1HMSA 5FENA 2CM4A 4C5PA 1QY2A 1MK5A 1EPBA 1PBYA 1SLEB 1KZXA 5DPQA 3P02A 1OEJA 4BGFA 4ZFXA 1G5WA 1SWCA 5BVQA 2OY1O 1KT4A 2RCQA 1LCVA 1E06A 1SWAA 1VWFB 2P8GA 1SWHA 3DTQA 3HWDA 1VWRB 3I17A 4ML7B 4YKMA 5CSEA 2X45A 3UEUA 4BVMA 2OYBO 2FKJA 3HOEA 4GH7A 5D8JA 2FGSA 1SREA 2JN3A 2Q2MA 2QOMA 2RTKA 5H9KA 4I6SA 5IO6A 4DQ4A 5AJBA 1HBPA 2E4JA 2FR3A 4ZR2A 2BSZA 1KT3A 3MX7A 3CR6A 2VDFA 5D45A 4RUUA 2Q2PA 2RTOB 2BHVA 2WEXA 3Q34A 3PPTA 3ZW0A 3VG5A 1DZJA 2JOZA 4IABA 3HPEA 1MEPA 1LKEA 2VFBA 2IZGB 3FEPA 1MUPA 1TXLA 3VHIA 1EALA 5EZ2A 2K23A 3EW1A 4O4UA 1ADLA 2RTIB 1R0UA 4IMNA 2ACOA 2GC9A 4DNEA 4EKVA 1X89A 2X8SA 2UYWA 4U8UO 2I5VO 1LDOA 1HXZA 1N7YA 1ZNHA 4I3CA 3MBTA 4RUNA 4BOEA 3U9PC 5EPQA 4I95A 2KW1A 3QQ2A 1ALBA 5LJEA 4YCHA 4XMEA 4YBUA 2Q39A 4O3XB 1SWDA 2OY7A 1KQWA 1SLDB 1SY3A 2ASNX 3U0DA 2M4LA 1SXXA 3OD9A 1Y9TA 4YFRA 1KT6A 5LKEA 5F6BA 2IFBA 3KFGA 1HY2A 4BJ8A 5HTDA 1QQSA 4NV7A 1VYGA 2AT3X 4QZTA 1ICMA 2WWPA 1TOUA 2FS7A 2RTPB 5AJCA 5F7GA 2CZUA 5LJCA 4O4OA 2RTFB 3O2YA 1DZPA 3APVA 4OKAA 5B29A 2XSTA 1N0SA 1AQBA 1Y0GA 4BX7B 4U9CA 5B5FA 2POAA 1LFOA 1BRQA 1NBXA 4IB7A 1VWIB 1W4TA 2GTLO 3WZQA 2NNQA 3FR2A 1DF3A 2X32A 2MWHA 2F73A 3ZUIA 4UU2A 4FBOA 4LQZA 4XMGA 1O1UA 4TKJA 1UREA 1SRFA 3SZHA 1N9YA 2A5CA 1GX9A 2OVEA 3T2WA 4HPBA 3HK1A 1JJJA 2BT9A 3ZUOA 1KGLA 5D48A 1LIFA 3TGBA 2QOSC 3FELA 2OFRX 1SWFA 1D3SA 4OMWA 1LICA 2A3FX 2HYSA 1JIWI 3RDOA 4TJZA 1SY0A 2RTBB 1VWCB 1QY1A 1NP1A 2AT8X 4Y5DA 3WZPA 1ERXA 3B2IA 1Y9LA 1DZKA 2G79A 2Y32A 3WJCA 1JV4A 1SY2A 1VYFA 1Y53X 2ALLX 3AUMO 3IA8A 1DFVA 3VHHA 3EW2A 5B10O 4NYRA 2R74A 2VFCA 2MM3A 3B2JA 1SLGB 1BEBA 2AF5A 2R56A 1DZMA 1HMRA 1BSQA 3CKFA 3GE2A 1JMXA 4HPCA 4IB8A 5LJGA 4MISA 2BC3A 3B2KA 3FMZA 4IBAA 5F1EA 2HLVA 1NC9A 1VWHB 4HFOA 2OVSA 3BU1A 3WVMA 3P6DA 2AH7X 1SWGA 1EW3A 3D4RA 1GT4A 1YP7A 4Z2VA 1AVDA 1SWPA 1T0VA 4MEEA 3S60A 3B2HA 3RKGA 1N43A 3FIDA 2G78A 4R0BA 4A8ZA 2RTGB 3FA8A 4ZHCA 1LPJA 1UYNX 1Y52X 2OFMX 3P6CA 4OMXA 5K06A 4NP1A 1VWAB 1ZNDA 3T6FA 4I3BA 1EIIA 3VG4A 3ZQ3A 5LKFA 1JMZA 3KVNA 4IAWA 2PY1A 4CPHB 3P6GA 1ICNA 1JQPA 3U03A 1VYOA 2RTQB 4JGLA 2ZAIA 1CRBA 5L8NA 1L6MA 1RSUB 4OS3A 5KIDA 1GKAB 3PEDA 5HA1A 2MF6A 4PJ2A 1EQDA 1W5RA 1SXYA 2UZ2A 1G7NA 5FAZA 1VWDB 1VWNB 2A13A 2QO6A 4OS8A 5B5GA 4GETA 4KIIA 1FEMA 4N7DA 5CYBA 2CM9A 3RSWA 1MOYA 3S26A 3TF6A 4ZHHA 4AYHA 1VWLB
chains in the Genus database with same CATH topology
1HBQA 3N91A 4CV7A 3FENA 1NP4A 1PM1X 3MVFA 4NLIA 3CQRA 1GXAA 2RN4A 3BY0A 1NGLA 1LF7A 4FGIB 1FTPA 1YUPA 2JMBA 4YFPA 1RLBE 3P6FA 3SOTA 1QWDA 3D97A 4KC8A 3VU1A 2CZTA 3FEKA 3CWKA 4MVEA 3VE2A 1MVGA 4U8UM 1HQPA 2EU7X 2L68A 4UU3A 2KTDA 2WSJA 2W2FA 1YWDA 1FELA 4WFVA 1SMPI 3RZYA 2A2GA 1A57A 3G7XA 2GTFX 3F9DA 4ZJ0A 3TZSA 2FRSA 1B0OA 3NR3A 1YWCA 1MDCA 4MVLA 5D47A 1S2PA 3O19A 5HZ8A 2RQ0A 5HCCC 1DC9A 2RCTA 1O8VA 2WQ9A 4LKTA 5DG4A 2BLGA 5L8IA 2AT5X 4YMYA 5HWZA 3S5VA 1BRPA 3FA7A 2YMSA 2GTLM 3KQ0A 2KTSA 1OPBA 2RD7C 5EDCA 3FA9A 4U3QA 1SY1A 4O9SA 5HAEA 1OEEA 1G74A 3UEXA 1QABE 3P24A 4O3WA 1OBQA 3VE1A 4Y0RA 4YDBA 5HZ5A 3CQNA 4ODDA 5FQ8E 5BVTA 2FT9A 4N7CA 4XMCA 3WJBA 3SAOA 2XKLA 4L3RA 4OS0A 5H8TA 1YIVA 3OJYC 3F8AA 4ORXA 1ZNGA 2K62A 4FBRA 2BS5A 1P6PA 2NNDA 4XMFA 4Y0SA 5HCEC 1AELA 4CSBA 1CBIA 2QO4A 5IO5A 3CBSA 3JSQA 3Q6LA 3UEVA 4NNSA 5C0NA 4FQBB 1RBPA 3NX1A 1BSOA 3KFHA 1IFCA 4LZUA 4ES7A 4D6AA 2X46A 2JU8A 4AZQA 3FW5A 3WXQA 1IW2A 5H9NA 1GT3A 1QG5A 3NQKA 4AW8A 2YG2A 5D4AA 3PH6A 4BQUA 1GT1A 1G85A 3E3CA 4ARHA 2HMBA 4YDAA 2A2UA 3NQ9A 1ML7A 1CBQA 4COTA 4AZPA 5KHPA 1ACDA 3ELZA 3NQ3A 1EUOA 5JR8A 3KFIA 4WFUA 4ORUA 1B56A 1DF3A 4XMHA 4ZHFA 2Z4IA 1GKAA 3C78X 3PQUA 1A2DA 5CE4A 3ZI8A 2AKQA 4O4SA 3WJFA 3WJDA 1TW4A 2DM5A 2FR2A 1U18A 4ORYA 1ZNEA 3EM0A 4NLJA 4O4XA 4AZNA 4TNNA 2NNEA 4YH0A 2QO5A 1KT5A 3AKMA 3V8UA 3CBCA 1CBSA 1OPAA 4ZH6A 4M6SA 3HWFA 1HMTA 2O62A 4LZVA 3TGAA 4GU8A 1XKIA 2Q4NA 1JYDA 1X8QA 2QM9A 1EXSA 2WQAE 2OVAA 3OE3A 4KCAA 3JQOA 4ZGFA 3BX8A 2JU3A 4QGVA 1MX7A 3GAQA 3KZAA 5HBSA 5IO7A 3ZW1B 4O49A 4I9SA 2L9CA 2WUTA 4LKPA 3UAQA 3IFBA 4YGGA 5HA0A 4ORSA 1KQXA 1JJXA 3BRNA 1IKEA 3JS1A 5HCDC 1PEEA 5BYPA 2WEWA 4MVIA 1U17A 3H3IA 2ACPX 1JBHA 1HN2A 1X8NA 2LFOA 2HZRA 4KT5A 5FFHA 3WJEA 1T68X 1YP6A 5LJBA 4IB9A 3ZW2A 3EBWA 3D96A 5F58A 4I3DA 1O1VA 4YCEA 4IAXA 3HOLA 4TKBA 5L8OA 4I9RA 1JZUA 3FW4A 1UZ2X 4TLJA 4CK4A 4GZVA 1ZNLA 3PQSA 3F6ZB 3APUA 4QAEA 3BLGA 1EPAA 3L4RA 1A18A 1KOIA 3NADA 4GDZA 2LA7A 2LBVA 2GJ5A 1LIDA 4ALBA 2OVDA 3HWGA 3FYFA 1BJ7A 1KT7A 5EEEA 1CJ5A 1OBUA 4GNYA 2FWVA 1D2UA 3AKNA 1ZNKA 1XCAA 5KICA 4ZCBA 3BU9A 3WOVA 1BSYA 4HWMA 3EMMA 3PP6A 1I4UA 1ERBA 2R73A 3PH5A 2AMMX 4ON1A 5BVSA 4TQ2A 1FDQA 3D95A 4EFGA 3VG3A 4EXZA 2FS6A 3STKA 1SXUA 2CBRA 2L67A 4U8UN 1BBPA 1E00A 4EQAC 4IB6A 4NYQA 4AZRA 4YKOA 2KT4B 5AEOA 3HTYA 1PMPA 2AL0X 1BM5A 5LJHA 4M7MA 3EBKA 1T8VA 4HPAA 1U0XA 3VG2A 1TVQA 3FIQA 2F09A 3NP1A 3ZZVA 1E02A 2ZAGA 4KC7A 2ANSA 2MJIA 1SA8A 1EIOA 5FQ7E 2GTLN 3HWEA 1IKJA 4PSQA 4L1NA 3QKGA 5FQ6E 1E5PA 4GNWA 4GE1A 5HZQA 3DSZA 5B27A 4GK9A 2HZQA 5LJDA 1OEKA 2JW1A 1X8PA 1TOWA 1GT5A 2A0AA 4KH8A 4YGHA 3EYCA 2AT6X 4FBVA 1QFTA 3CMPA 3WBGA 2NP1A 1X8OA 4GRJA 4O3ZA 3BS2A 4INNA 5EEDA 3LV4A 4MVKA 2MHDA 4NNTA 1JYJA 3O22A 1GGLA 1I05A 1QY0A 3BDRA 2Q9SA 2QMIA 3ZW0B 1QFVA 3C76X 4AZMA 2W2BA 1DV9A 4QYNA 3S5XA 1GM6A 4ZGUA 1B8EA 4ORWA 3T1DA 1I04A 4IMOA 1IFBA 2G7BA 3P6HA 1Z24A 2MO5A 3FLLA 4Y0PA 4TKHA 2AT0X 2X8TA 3STNA 3RBYA 4QRLA 2CBSA 4YGZA 2LB6A 1PBOA 5LJKA 1S44A 1YWAA 3STMX 5HZ6A 1IIUA 3VPJE 3WJGA 1BLRA 1VPRA 3KFFA 4K19A 1SXWA 4QGWA 2W2AA 1A3YA 1AVGI 1YWBA 4QQ1A 2LKKA 3ZW1A 2X8FA 4ID2A 4QZUA 4ZH9A 3C77X 1OBPA 2RA6A 3TGCA 4QNIA 1GX8A 4A1HA 4ZHGA 1I06A 4QYPA 1LIEA 4GKCA 4XMDA 3NPOA 5H9AA 3APXA 5EDBA 3OBLA 4Y0QA 5AQ6A 4HPDA 1AB0A 1KXOA 4ORRA 4QGXA 1MX8A 4WHIA 1LIBA 4EDEA 5F6ZA 1FENA 3NX2A 1LNMA 2Z4HA 3BSZE 5H9LA 4MIRA 1BWYA 2JU7A 3B2LA 4ALOA 2L5PA 1EI5A 1FE3A 3FA6A 3PECA 4NW4A 4YFQA 1ZRYA 3ELXA 3VG7A 4DQ3A 5HZ9A 2BS6A 4A60A 2FTBA 3RWXA 2HNXA 4O3YA 4AZOA 3LHNA 1S7DA 3FR5A 1CBRA 2KD2A 3NBXX 5HTEA 2OZQA 4EEJA 1H91A 4WBKA 3BX7A 1B4MA 1X71A 3FR4A 2WR6A 3I0AA 3K3LA 4YBPA 3UEWA 4ZHDA 2FLJA 2LBAA 3P6EA 3APWA 2N93A 3ZWEA 1X8UA 4D6BA 1HMSA 5FENA 2CM4A 1QY2A 1EPBA 1KZXA 5DPQA 3P02A 1OEJA 1G5WA 4ZFXA 5BVQA 1KT4A 2RCQA 2P8GA 1E06A 3DTQA 3HWDA 3I17A 4ML7B 4YKMA 3UEUA 4BVMA 2X45A 3HOEA 4GH7A 5D8JA 2JN3A 2Q2MA 5IO6A 5H9KA 4I6SA 4DQ4A 5AJBA 1HBPA 2E4JA 2FR3A 4ZR2A 3MX7A 1KT3A 3CR6A 5D45A 4RUUA 2Q2PA 2BHVA 2WEXA 3PPTA 3ZW0A 3VG5A 1DZJA 2JOZA 4IABA 1LKEA 3FEPA 1MUPA 1TXLA 1EALA 5EZ2A 2K23A 4O4UA 1ADLA 1R0UA 4IMNA 2ACOA 2GC9A 1X89A 2X8SA 4U8UO 4I3CA 1ZNHA 4BOEA 3MBTA 4RUNA 3U9PC 5EPQA 4I95A 2KW1A 1ALBA 5LJEA 4YCHA 4XMEA 4YBUA 2Q39A 4O3XB 1KQWA 1SY3A 2ASNX 3U0DA 2M4LA 1SXXA 3OD9A 1Y9TA 4YFRA 1KT6A 5LKEA 5F6BA 2IFBA 3KFGA 5HTDA 1QQSA 1VYGA 2AT3X 4QZTA 1ICMA 2WWPA 1TOUA 2FS7A 5AJCA 5F7GA 5LJCA 2CZUA 4O4OA 3O2YA 1DZPA 3APVA 5B29A 2XSTA 1N0SA 1AQBA 4U9CA 2POAA 1LFOA 1BRQA 4IB7A 2GTLO 2NNQA 3FR2A 3ZUIA 2MWHA 2F73A 4UU2A 4FBOA 4LQZA 4XMGA 1O1UA 4TKJA 1UREA 1GX9A 2OVEA 4HPBA 3HK1A 1JJJA 2BT9A 3ZUOA 1KGLA 5D48A 1LIFA 3TGBA 2QOSC 3FELA 2OFRX 1D3SA 4OMWA 1LICA 2A3FX 2HYSA 1JIWI 4TJZA 1SY0A 1QY1A 1NP1A 2AT8X 1ERXA 3B2IA 1Y9LA 1DZKA 2G79A 3WJCA 1JV4A 1SY2A 1VYFA 2ALLX 3IA8A 1DFVA 4NYRA 2R74A 2MM3A 3B2JA 3GE2A 1BEBA 3VG6A 2R56A 1DZMA 1HMRA 1BSQA 4HPCA 4A1YA 1KZWA 4IB8A 5LJGA 4MISA 3B2KA 3FMZA 4IBAA 5F1EA 2HLVA 4HFOA 2OVSA 3BU1A 3WVMA 3P6DA 2AH7X 1EW3A 3D4RA 1GT4A 1YP7A 1T0VA 3S60A 3B2HA 3RKGA 4A8ZA 2G78A 4R0BA 3FA8A 4ZHCA 1LPJA 2OFMX 5K06A 4OMXA 3P6CA 4NP1A 1ZNDA 4I3BA 1EIIA 3VG4A 3ZQ3A 5LKFA 4IAWA 2PY1A 3P6GA 1ICNA 3U03A 4JGLA 2ZAIA 1CRBA 5L8NA 1L6MA 4OS3A 5KIDA 1GKAB 3PEDA 5HA1A 4PJ2A 1EQDA 1SXYA 1G7NA 5FAZA 4OS8A 2A13A 2QO6A 4GETA 4KIIA 1FEMA 4N7DA 5CYBA 2CM9A 3RSWA 3S26A 3TF6A 4ZHHA 4AYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HBQ A;  3FEN A;  1NP4 A;  1PM1 X;  3MVF A;  4NLI A;  3CQR A;  1GXA A;  3BY0 A;  1NGL A;  1LF7 A;  1FTP A;  1YUP A;  4YFP A;  1RLB E;  3P6F A;  1QWD A;  3D97 A;  2CZT A;  3FEK A;  3CWK A;  1MVG A;  1HQP A;  2EU7 X;  2L68 A;  4UU3 A;  2KTD A;  2WSJ A;  2W2F A;  1YWD A;  1FEL A;  4WFV A;  3RZY A;  1A57 A;  2A2G A;  3G7X A;  2GTF X;  3F9D A;  4ZJ0 A;  3TZS A;  2FRS A;  1B0O A;  3NR3 A;  1YWC A;  1MDC A;  4MVL A;  5D47 A;  1S2P A;  3O19 A;  5HZ8 A;  2RQ0 A;  5HCC C;  1DC9 A;  2RCT A;  1O8V A;  2WQ9 A;  4LKT A;  5DG4 A;  2BLG A;  5L8I A;  2AT5 X;  4YMY A;  5HWZ A;  1BRP A;  3FA7 A;  3KQ0 A;  1OPB A;  2RD7 C;  5EDC A;  3FA9 A;  1SY1 A;  4O9S A;  5HAE A;  1OEE A;  1G74 A;  3UEX A;  1QAB E;  1OBQ A;  4Y0R A;  4YDB A;  5HZ5 A;  3CQN A;  4ODD A;  5BVT A;  2FT9 A;  4N7C A;  4XMC A;  3WJB A;  3SAO A;  2XKL A;  4OS0 A;  5H8T A;  1YIV A;  3OJY C;  3F8A A;  4ORX A;  1ZNG A;  2K62 A;  2NND A;  1P6P A;  4Y0S A;  4XMF A;  5HCE C;  1AEL A;  1CBI A;  2QO4 A;  5IO5 A;  3CBS A;  3JSQ A;  3Q6L A;  3UEV A;  4NNS A;  5C0N A;  1RBP A;  3NX1 A;  1BSO A;  3KFH A;  1IFC A;  4LZU A;  4ES7 A;  4D6A A;  2X46 A;  2JU8 A;  4AZQ A;  3FW5 A;  3WXQ A;  1IW2 A;  5H9N A;  1GT3 A;  1QG5 A;  4AW8 A;  2YG2 A;  5D4A A;  3PH6 A;  4BQU A;  1GT1 A;  1G85 A;  4ARH A;  2HMB A;  4YDA A;  2A2U A;  3NQ9 A;  1ML7 A;  1CBQ A;  5KHP A;  4AZP A;  1ACD A;  3ELZ A;  3NQ3 A;  1EUO A;  5JR8 A;  3KFI A;  4WFU A;  4ORU A;  1B56 A;  1DF3 A;  4XMH A;  4ZHF A;  1GKA A;  3C78 X;  1A2D A;  5CE4 A;  2AKQ A;  3WJF A;  3WJD A;  1TW4 A;  2DM5 A;  2FR2 A;  1U18 A;  4ORY A;  1ZNE A;  3EM0 A;  4NLJ A;  4AZN A;  4TNN A;  2NNE A;  4YH0 A;  2QO5 A;  1KT5 A;  3AKM A;  3CBC A;  1CBS A;  1OPA A;  4ZH6 A;  4M6S A;  3HWF A;  1HMT A;  2O62 A;  4LZV A;  3TGA A;  1XKI A;  2Q4N A;  1JYD A;  1X8Q A;  2QM9 A;  1EXS A;  2WQA E;  2OVA A;  3BX8 A;  2JU3 A;  4QGV A;  1MX7 A;  3GAQ A;  3KZA A;  5HBS A;  5IO7 A;  4I9S A;  2L9C A;  2WUT A;  4LKP A;  3IFB A;  4YGG A;  5HA0 A;  4ORS A;  1KQX A;  1JJX A;  3BRN A;  1IKE A;  3JS1 A;  5HCD C;  1PEE A;  2WEW A;  4MVI A;  1U17 A;  2ACP X;  1JBH A;  1HN2 A;  1X8N A;  2LFO A;  2HZR A;  5FFH A;  3WJE A;  1T68 X;  1YP6 A;  5LJB A;  4IB9 A;  3EBW A;  3D96 A;  5F58 A;  4I3D A;  1O1V A;  4YCE A;  4IAX A;  4TKB A;  5L8O A;  4I9R A;  1JZU A;  3FW4 A;  1UZ2 X;  4TLJ A;  4CK4 A;  1ZNL A;  4QAE A;  3APU A;  3BLG A;  1EPA A;  3L4R A;  1A18 A;  1KOI A;  3NAD A;  2LBV A;  2GJ5 A;  1LID A;  4ALB A;  2OVD A;  3HWG A;  1BJ7 A;  1KT7 A;  5EEE A;  1CJ5 A;  1OBU A;  4GNY A;  2FWV A;  1D2U A;  3AKN A;  1ZNK A;  1XCA A;  5KIC A;  4ZCB A;  3BU9 A;  1BSY A;  3EMM A;  3PP6 A;  1I4U A;  1ERB A;  2R73 A;  3PH5 A;  2AMM X;  5BVS A;  4TQ2 A;  1FDQ A;  3D95 A;  4EFG A;  3VG3 A;  4EXZ A;  2FS6 A;  3STK A;  1SXU A;  2CBR A;  2L67 A;  1BBP A;  1E00 A;  4IB6 A;  4NYQ A;  4AZR A;  4YKO A;  2KT4 B;  1PMP A;  2AL0 X;  1BM5 A;  5LJH A;  4M7M A;  3EBK A;  1T8V A;  4HPA A;  1U0X A;  3VG2 A;  1TVQ A;  3FIQ A;  3NP1 A;  1E02 A;  2ANS A;  2MJI A;  1SA8 A;  1EIO A;  3HWE A;  1IKJ A;  4PSQ A;  3QKG A;  1E5P A;  4GNW A;  4GE1 A;  5HZQ A;  3DSZ A;  5B27 A;  2HZQ A;  5LJD A;  1OEK A;  1X8P A;  1TOW A;  1GT5 A;  2A0A A;  4YGH A;  3EYC A;  2AT6 X;  1QFT A;  3CMP A;  3WBG A;  2NP1 A;  1X8O A;  4GRJ A;  3BS2 A;  5EED A;  4MVK A;  4NNT A;  1JYJ A;  3O22 A;  1GGL A;  1I05 A;  1QY0 A;  3BDR A;  2Q9S A;  1QFV A;  3C76 X;  4AZM A;  2W2B A;  1DV9 A;  4QYN A;  1GM6 A;  4ZGU A;  1B8E A;  4ORW A;  3T1D A;  1I04 A;  4IMO A;  1IFB A;  2G7B A;  3P6H A;  1Z24 A;  2MO5 A;  3FLL A;  4Y0P A;  4TKH A;  2AT0 X;  3STN A;  2CBS A;  4YGZ A;  2LB6 A;  1PBO A;  5LJK A;  1S44 A;  1YWA A;  3STM X;  5HZ6 A;  1IIU A;  3WJG A;  1BLR A;  1VPR A;  3KFF A;  4K19 A;  1SXW A;  4QGW A;  2W2A A;  1A3Y A;  1AVG I;  1YWB A;  2LKK A;  4ZH9 A;  4QZU A;  3C77 X;  1OBP A;  2RA6 A;  3TGC A;  1GX8 A;  4A1H A;  4ZHG A;  1I06 A;  4QYP A;  1LIE A;  4GKC A;  4XMD A;  3NPO A;  5H9A A;  3APX A;  5EDB A;  4Y0Q A;  5AQ6 A;  4HPD A;  1AB0 A;  1KXO A;  4ORR A;  4QGX A;  1MX8 A;  4EDE A;  1LIB A;  5F6Z A;  1FEN A;  3NX2 A;  1LNM A;  3BSZ E;  5H9L A;  1BWY A;  2JU7 A;  3B2L A;  4ALO A;  2L5P A;  1FE3 A;  3FA6 A;  3PEC A;  4YFQ A;  1ZRY A;  3ELX A;  3VG7 A;  4DQ3 A;  5HZ9 A;  4A60 A;  2FTB A;  2HNX A;  4AZO A;  1S7D A;  3FR5 A;  1CBR A;  5HTE A;  2OZQ A;  4EEJ A;  1H91 A;  4WBK A;  3BX7 A;  1B4M A;  1X71 A;  3FR4 A;  2WR6 A;  3I0A A;  3K3L A;  4YBP A;  3UEW A;  4ZHD A;  2FLJ A;  2LBA A;  3P6E A;  3APW A;  2N93 A;  1X8U A;  4D6B A;  1HMS A;  5FEN A;  2CM4 A;  1QY2 A;  1EPB A;  1KZX A;  5DPQ A;  1OEJ A;  1G5W A;  4ZFX A;  5BVQ A;  1KT4 A;  2RCQ A;  2P8G A;  1E06 A;  3DTQ A;  3HWD A;  3I17 A;  4YKM A;  3UEU A;  4BVM A;  2X45 A;  4GH7 A;  5D8J A;  2JN3 A;  2Q2M A;  5IO6 A;  5H9K A;  4DQ4 A;  1HBP A;  2E4J A;  2FR3 A;  4ZR2 A;  1KT3 A;  3CR6 A;  5D45 A;  4RUU A;  2Q2P A;  2WEX A;  3PPT A;  3VG5 A;  1DZJ A;  2JOZ A;  1LKE A;  3FEP A;  1MUP A;  1TXL A;  1EAL A;  5EZ2 A;  2K23 A;  1ADL A;  1R0U A;  4IMN A;  2ACO A;  2GC9 A;  1X89 A;  4I3C A;  1ZNH A;  4BOE A;  3MBT A;  4RUN A;  3U9P C;  5EPQ A;  1ALB A;  5LJE A;  4YCH A;  4XME A;  4YBU A;  2Q39 A;  1KQW A;  1SY3 A;  2ASN X;  3U0D A;  1SXX A;  4YFR A;  5LKE A;  1KT6 A;  5F6B A;  2IFB A;  3KFG A;  5HTD A;  1QQS A;  1VYG A;  2AT3 X;  4QZT A;  1ICM A;  2WWP A;  1TOU A;  2FS7 A;  5F7G A;  5LJC A;  2CZU A;  3O2Y A;  1DZP A;  3APV A;  5B29 A;  2XST A;  1N0S A;  1AQB A;  2POA A;  1LFO A;  1BRQ A;  4IB7 A;  2NNQ A;  3FR2 A;  3ZUI A;  2F73 A;  4UU2 A;  4XMG A;  1O1U A;  4TKJ A;  1URE A;  1GX9 A;  2OVE A;  4HPB A;  3HK1 A;  1JJJ A;  3ZUO A;  1KGL A;  5D48 A;  1LIF A;  3TGB A;  2QOS C;  3FEL A;  2OFR X;  1D3S A;  4OMW A;  1LIC A;  2A3F X;  2HYS A;  4TJZ A;  1SY0 A;  1QY1 A;  1NP1 A;  2AT8 X;  1ERX A;  3B2I A;  1DZK A;  2G79 A;  3WJC A;  1JV4 A;  1SY2 A;  1VYF A;  2ALL X;  3IA8 A;  1DFV A;  4NYR A;  2R74 A;  2MM3 A;  3B2J A;  3VG6 A;  1BEB A;  4A1Y A;  2R56 A;  1DZM A;  1HMR A;  1BSQ A;  4HPC A;  1KZW A;  4IB8 A;  5LJG A;  3B2K A;  3FMZ A;  4IBA A;  5F1E A;  2HLV A;  4HFO A;  3BU1 A;  3WVM A;  3P6D A;  2AH7 X;  1EW3 A;  1GT4 A;  1YP7 A;  1T0V A;  3B2H A;  4A8Z A;  2G78 A;  4R0B A;  3FA8 A;  4ZHC A;  1LPJ A;  2OFM X;  5K06 A;  4OMX A;  3P6C A;  4NP1 A;  1ZND A;  4I3B A;  1EII A;  3VG4 A;  3ZQ3 A;  5LKF A;  4IAW A;  2PY1 A;  3P6G A;  1ICN A;  3U03 A;  1CRB A;  5L8N A;  1L6M A;  4OS3 A;  5KID A;  1GKA B;  3PED A;  5HA1 A;  1EQD A;  1SXY A;  1G7N A;  5FAZ A;  4OS8 A;  2A13 A;  2QO6 A;  4GET A;  4KII A;  1FEM A;  4N7D A;  3S26 A;  2CM9 A;  3RSW A;  3TF6 A;  4ZHH A;  4AYH A; 
#chains in the Genus database with same CATH topology
 1N9M A;  1HBQ A;  3N91 A;  4CV7 A;  3FEN A;  1NP4 A;  3SZI A;  1PM1 X;  4CDF A;  3MVF A;  4NLI A;  3CQR A;  1GXA A;  2RN4 A;  2IZL B;  3BY0 A;  1NGL A;  5IRW A;  1LF7 A;  4FGI B;  1FTP A;  1YUP A;  2JMB A;  3FDC A;  4GD9 A;  4YFP A;  1RLB E;  3P6F A;  1K24 A;  1SRG A;  3SOT A;  1QWD A;  3D97 A;  5B11 O;  1WBI A;  4KC8 A;  3VU1 A;  2CZT A;  3FEK A;  5K67 A;  3CWK A;  3X00 A;  1VWO B;  4MVE A;  3PK2 A;  3VE2 A;  1MVG A;  4U8U M;  4Z2O A;  1STS B;  2IZF B;  1HQP A;  2EU7 X;  2C1Q A;  1N4J A;  2L68 A;  2OFA A;  4UU3 A;  2KTD A;  5F2B A;  2WSJ A;  2W2F A;  1YWD A;  1FEL A;  4WFV A;  4CDD A;  5L3Y A;  1SMP I;  3RZY A;  2A2G A;  4ZHF A;  1A57 A;  4JHQ A;  3G7X A;  2GTF X;  3F9D A;  4ZJ0 A;  3TZS A;  2IZA A;  2FRS A;  1B0O A;  2OL6 O;  1YWC A;  1MDC A;  3NR3 A;  4MVL A;  5D47 A;  1S2P A;  3O19 A;  4BX7 A;  4YVB A;  2RQ0 A;  5HCC C;  5HZ8 A;  1DC9 A;  2RCT A;  1O8V A;  2WQ9 A;  4LKT A;  5DG4 A;  2BLG A;  4BCS A;  2IZI A;  2AT5 X;  5L8I A;  4JO6 A;  5CHK A;  4YMY A;  5HWZ A;  3S5V A;  1BRP A;  4GGR A;  1SWS A;  3FA7 A;  2RTN B;  2GTL M;  2IZH B;  2YMS A;  3KQ0 A;  2KTS A;  1DF8 A;  2HKD A;  5IXG A;  1OPB A;  1VWJ B;  2RD7 C;  5EDC A;  3FA9 A;  4U3Q A;  1SY1 A;  4O9S A;  2I5Z O;  2OY5 O;  1OEE A;  1G74 A;  1SWO A;  5HAE A;  3UEX A;  1QAB E;  3P24 A;  4O3W A;  1OBQ A;  1RAV A;  3VE1 A;  4Y0R A;  4YDB A;  5HZ5 A;  3CQN A;  4ODD A;  3RDM A;  3CKG A;  5FQ8 E;  5BVT A;  2FT9 A;  4N7C A;  4XMC A;  3WJB A;  3SAO A;  1I78 A;  2XKL A;  4L3R A;  4OS0 A;  5H8T A;  1YIV A;  3OJY C;  3F8A A;  4ORX A;  1ZNG A;  2K62 A;  4B55 A;  4FBR A;  4I60 A;  2BS5 A;  1P6P A;  1NQN A;  2NND A;  4XMF A;  4Y0S A;  5HCE C;  1SLF B;  1AEL A;  4CSB A;  1CBI A;  2IZJ A;  2QO4 A;  5IO5 A;  3CBS A;  1UYO X;  3JSQ A;  1SWT A;  3Q6L A;  4NNS A;  4OEL A;  3UEV A;  5C0N A;  4FQB B;  1RBP A;  3NX1 A;  1PTS A;  1BSO A;  3KFH A;  1IFC A;  4LZU A;  4ES7 A;  4D6A A;  2X46 A;  5B2A O;  2JU8 A;  4AZQ A;  2QCB A;  3FW5 A;  3WXQ A;  1IW2 A;  5H9N A;  1GT3 A;  1QG5 A;  2WPU A;  3WYP A;  4CPE A;  3NQK A;  4AW8 A;  2YG2 A;  5D4A A;  1HQQ A;  3PH6 A;  4BQU A;  1GT1 A;  1G85 A;  3E3C A;  2FKG A;  4ARH A;  2HMB A;  4YDA A;  2A2U A;  3NQ9 A;  1ML7 A;  1CBQ A;  1STR B;  4AZP A;  4COT A;  5KHP A;  1ACD A;  1VWB B;  1NDJ A;  3ELZ A;  1EUO A;  3LTW A;  3NQ3 A;  4CPH A;  5JR8 A;  3KFI A;  4WFU A;  4ORU A;  4BX5 B;  1B56 A;  1LEL A;  1LDQ A;  4XMH A;  1LCZ A;  2G5L A;  2RTE B;  2RTR B;  5JD2 A;  2FHN X;  2Y3F A;  1GKA A;  2Z4I A;  3C78 X;  3PQU A;  1A2D A;  5CE4 A;  3ZI8 A;  2AKQ A;  3MM0 A;  4O4S A;  3WJF A;  3WJD A;  1TW4 A;  2DM5 A;  2FR2 A;  1U18 A;  4ORY A;  1ZNE A;  3EM0 A;  4NLJ A;  4O4X A;  4AZN A;  4Z27 A;  4TNN A;  2NNE A;  4BX6 B;  4YH0 A;  2QO5 A;  1KT5 A;  3AKM A;  2CAM A;  3V8U A;  3CBC A;  1CBS A;  1OPA A;  4ZH6 A;  4M6S A;  3HWF A;  1HMT A;  2O62 A;  4LZV A;  2RTL A;  4GU8 A;  3TGA A;  1XKI A;  2Q4N A;  1JYD A;  1X8Q A;  2QM9 A;  4JNJ A;  1EXS A;  2WQA E;  2OVA A;  3OE3 A;  1E2T A;  3JQO A;  4KCA A;  3BX8 A;  2JU3 A;  4CDC A;  2A8G A;  4QGV A;  4ZGF A;  3RY2 A;  1MX7 A;  3GAQ A;  2RTD B;  3KZA A;  5HBS A;  5IO7 A;  3ZW1 B;  3T6L A;  4O49 A;  4I9S A;  2L9C A;  2WUT A;  4LKP A;  3UAQ A;  3IFB A;  4IRW A;  4YGG A;  5HA0 A;  1NQM A;  1RXH A;  2RTM A;  3SLO A;  4ORS A;  1KQX A;  2A5B A;  1JJX A;  1JJU A;  3BRN A;  4GJV A;  1IKE A;  3JS1 A;  5HCD C;  2X56 A;  1PEE A;  5BYP A;  2WEW A;  4MVI A;  4GDA A;  1U17 A;  3H3I A;  4Z2P A;  1FJ1 E;  2ACP X;  1JBH A;  1HN2 A;  3RE6 A;  2OL7 A;  3VGW A;  1X8N A;  2LFO A;  1KFF A;  2HZR A;  4KT5 A;  5FFH A;  3RDX A;  3WJE A;  4Z6J A;  1T68 X;  1YP6 A;  5LJB A;  4IB9 A;  3ZW2 A;  3EBW A;  3D96 A;  5F58 A;  4I3D A;  1O1V A;  1SWU A;  4YCE A;  4CPF A;  4IAX A;  3HOL A;  4TKB A;  5L8O A;  4I9R A;  1JZU A;  1HXL A;  3FW4 A;  1UZ2 X;  4TLJ A;  4CK4 A;  2RTA A;  2IZE B;  4GZV A;  1ZNL A;  3PQS A;  3F6Z B;  3APU A;  4QAE A;  3BLG A;  1EPA A;  3L4R A;  1A18 A;  1KOI A;  1RST B;  3NAD A;  4GDZ A;  3WYQ A;  1VWM B;  2OY8 A;  2LA7 A;  2LBV A;  2GJ5 A;  1LID A;  4ALB A;  2OVD A;  3HWG A;  2RTH B;  3SLT A;  3FYF A;  1BJ7 A;  1KT7 A;  5EEE A;  1CJ5 A;  1OBU A;  4GNY A;  2FWV A;  1D2U A;  3AKN A;  1ZNK A;  1XCA A;  5KIC A;  1VWG B;  4ZCB A;  3BU9 A;  3WOV A;  1BSY A;  4HWM A;  3EMM A;  3PP6 A;  1I4U A;  2JGS A;  1ERB A;  2R73 A;  3PH5 A;  2AMM X;  4ON1 A;  5BVS A;  3MG5 A;  4Z28 A;  4TQ2 A;  1KL4 A;  1K3B A;  1FDQ A;  3D95 A;  5K68 A;  3VG3 A;  4EFG A;  4EXZ A;  2FS6 A;  3STK A;  1SXU A;  2CBR A;  2IZC B;  2L67 A;  4U8U N;  4Y59 A;  5B3M O;  1BBP A;  1SWK A;  1SRI A;  3PDF A;  1E00 A;  4EQA C;  4IB6 A;  4NYQ A;  2ZSC A;  1VWQ B;  5IRA A;  4YKO A;  2KT4 B;  2X55 A;  4AZR A;  1SRJ A;  5AEO A;  3HTY A;  1PMP A;  2AL0 X;  1BM5 A;  3SLJ A;  5LJH A;  4M7M A;  3EBK A;  1T8V A;  3D9W A;  4HPA A;  1U0X A;  3VG2 A;  4NV8 A;  2IZD B;  2IZB A;  1TVQ A;  3FIQ A;  2F09 A;  3NP1 A;  4GGZ A;  4BX5 A;  2RTJ A;  3ZZV A;  1SWE A;  2DJF A;  1E02 A;  2IZK A;  2ZAG A;  4KC7 A;  2ANS A;  1W6F A;  2MJI A;  1SA8 A;  1EIO A;  5FQ7 E;  2GTL N;  3HWE A;  1IKJ A;  2G8C O;  4L1N A;  3QKG A;  4PSQ A;  5FQ6 E;  1E5P A;  4GNW A;  4GE1 A;  5HZQ A;  3RDU A;  3VHM A;  3DSZ A;  5B27 A;  4A1Y A;  2C1S A;  1WUB A;  4GK9 A;  2HZQ A;  5LJD A;  4BX6 A;  1KL5 A;  1OEK A;  2JW1 A;  1X8P A;  1STP A;  1TOW A;  1GT5 A;  2A0A A;  4KH8 A;  2GH7 A;  4YGH A;  3EYC A;  2AT6 X;  2C4I A;  4FBV A;  1GX3 A;  3EC5 A;  2F01 A;  1QFT A;  3CMP A;  3WBG A;  2NP1 A;  1X8O A;  4GRJ A;  4O3Z A;  3RDQ A;  4OEM A;  3BS2 A;  4INN A;  5EED A;  2OF9 A;  3LV4 A;  2MHD A;  1LCW A;  1JYJ A;  3O22 A;  4MVK A;  4NNT A;  1GGL A;  1I05 A;  1QY0 A;  3BDR A;  2Q9S A;  3WZO A;  2QMI A;  3ZW0 B;  1SWJ A;  1QFV A;  3C76 X;  4AZM A;  2W2B A;  2AVI A;  4BBO A;  1DV9 A;  1IJ8 A;  1SWR A;  4GUZ A;  4QYN A;  3S5X A;  1GM6 A;  4ZGU A;  1B8E A;  4ORW A;  3T1D A;  1I04 A;  4IMO A;  1IFB A;  1SWB A;  1MM9 A;  1VWK B;  1SWN A;  2G7B A;  1Z24 A;  2MO5 A;  3P6H A;  2OL8 O;  3FLL A;  4Y0P A;  2FHL A;  4TKH A;  2AT0 X;  2X8T A;  3STN A;  3RBY A;  4QRL A;  2CBS A;  1LUQ A;  3T2X A;  4YGZ A;  2LB6 A;  1I9H A;  1PBO A;  3WZN A;  1S44 A;  1YWA A;  3STM X;  5LJK A;  5HZ6 A;  1SWQ A;  1IIU A;  3VPJ E;  1RXJ A;  3WJG A;  1VPR A;  3KFF A;  4K19 A;  1SXW A;  4QGW A;  2W2A A;  1BLR A;  1A3Y A;  1AVG I;  1YWB A;  4QQ1 A;  2LKK A;  2X4M A;  3SZJ A;  3ZW1 A;  2X8F A;  4ID2 A;  4QZU A;  4ZH9 A;  3C77 X;  1OBP A;  2RA6 A;  2OFB A;  4QNI A;  1GX8 A;  4A1H A;  4ZHG A;  3TGC A;  1I06 A;  4QYP A;  1LIE A;  1VWP B;  4GKC A;  4XMD A;  3NPO A;  5H9A A;  3APX A;  5EDB A;  1KL3 A;  3OBL A;  4Y0Q A;  5AQ6 A;  4HPD A;  1AB0 A;  3VG6 A;  1KXO A;  4ORR A;  4QGX A;  1MX8 A;  4WHI A;  1LIB A;  3RE5 A;  5F6Z A;  4EDE A;  1KZW A;  1FEN A;  3NX2 A;  1LNM A;  2Z4H A;  3BSZ E;  5H9L A;  4MIR A;  4CPI A;  1BWY A;  1SWL A;  2JU7 A;  3B2L A;  4ALO A;  2L5P A;  1EI5 A;  1FE3 A;  3FA6 A;  3PEC A;  4NW4 A;  4YFQ A;  4CDE A;  1ZRY A;  3ELX A;  1OSP O;  2DJG A;  3VG7 A;  4DQ3 A;  4DCB A;  5HZ9 A;  2BS6 A;  4A60 A;  2FTB A;  2Y3E A;  4GJS A;  3RWX A;  2HNX A;  4O3Y A;  4U46 A;  4AZO A;  3LHN A;  4GGT A;  1S7D A;  2RTC B;  3FR5 A;  1CBR A;  2KD2 A;  1RXK A;  3NBX X;  1Y55 X;  5HTE A;  1VWE B;  3RY1 A;  2OF8 A;  2OZQ A;  4EEJ A;  1H91 A;  4WBK A;  3BX7 A;  1B4M A;  1X71 A;  3FR4 A;  3AEH A;  1AVE A;  1SRH A;  2WR6 A;  5IRU A;  3RDS A;  3I0A A;  3K3L A;  4YBP A;  3UEW A;  4ZHD A;  2X34 A;  2FLJ A;  2LBA A;  3P6E A;  3APW A;  2N93 A;  3ZWE A;  2PI3 O;  1X8U A;  4D6B A;  1HMS A;  5FEN A;  2CM4 A;  4C5P A;  1QY2 A;  1MK5 A;  1EPB A;  1PBY A;  1SLE B;  1KZX A;  5DPQ A;  3P02 A;  1OEJ A;  4BGF A;  4ZFX A;  1G5W A;  1SWC A;  5BVQ A;  2OY1 O;  1KT4 A;  2RCQ A;  1LCV A;  1E06 A;  1SWA A;  1VWF B;  2P8G A;  1SWH A;  3DTQ A;  3HWD A;  1VWR B;  3I17 A;  4ML7 B;  4YKM A;  5CSE A;  2X45 A;  3UEU A;  4BVM A;  2OYB O;  2FKJ A;  3HOE A;  4GH7 A;  5D8J A;  2FGS A;  1SRE A;  2JN3 A;  2Q2M A;  2QOM A;  2RTK A;  5H9K A;  4I6S A;  5IO6 A;  4DQ4 A;  5AJB A;  1HBP A;  2E4J A;  2FR3 A;  4ZR2 A;  2BSZ A;  1KT3 A;  3MX7 A;  3CR6 A;  2VDF A;  5D45 A;  4RUU A;  2Q2P A;  2RTO B;  2BHV A;  2WEX A;  3Q34 A;  3PPT A;  3ZW0 A;  3VG5 A;  1DZJ A;  2JOZ A;  4IAB A;  3HPE A;  1MEP A;  1LKE A;  2VFB A;  2IZG B;  3FEP A;  1MUP A;  1TXL A;  3VHI A;  1EAL A;  5EZ2 A;  2K23 A;  3EW1 A;  4O4U A;  1ADL A;  2RTI B;  1R0U A;  4IMN A;  2ACO A;  2GC9 A;  4DNE A;  4EKV A;  1X89 A;  2X8S A;  2UYW A;  4U8U O;  2I5V O;  1LDO A;  1HXZ A;  1N7Y A;  1ZNH A;  4I3C A;  3MBT A;  4RUN A;  4BOE A;  3U9P C;  5EPQ A;  4I95 A;  2KW1 A;  3QQ2 A;  1ALB A;  5LJE A;  4YCH A;  4XME A;  4YBU A;  2Q39 A;  4O3X B;  1SWD A;  2OY7 A;  1KQW A;  1SLD B;  1SY3 A;  2ASN X;  3U0D A;  2M4L A;  1SXX A;  3OD9 A;  1Y9T A;  4YFR A;  1KT6 A;  5LKE A;  5F6B A;  2IFB A;  3KFG A;  1HY2 A;  4BJ8 A;  5HTD A;  1QQS A;  4NV7 A;  1VYG A;  2AT3 X;  4QZT A;  1ICM A;  2WWP A;  1TOU A;  2FS7 A;  2RTP B;  5AJC A;  5F7G A;  2CZU A;  5LJC A;  4O4O A;  2RTF B;  3O2Y A;  1DZP A;  3APV A;  4OKA A;  5B29 A;  2XST A;  1N0S A;  1AQB A;  1Y0G A;  4BX7 B;  4U9C A;  5B5F A;  2POA A;  1LFO A;  1BRQ A;  1NBX A;  4IB7 A;  1VWI B;  1W4T A;  2GTL O;  3WZQ A;  2NNQ A;  3FR2 A;  1DF3 A;  2X32 A;  2MWH A;  2F73 A;  3ZUI A;  4UU2 A;  4FBO A;  4LQZ A;  4XMG A;  1O1U A;  4TKJ A;  1URE A;  1SRF A;  3SZH A;  1N9Y A;  2A5C A;  1GX9 A;  2OVE A;  3T2W A;  4HPB A;  3HK1 A;  1JJJ A;  2BT9 A;  3ZUO A;  1KGL A;  5D48 A;  1LIF A;  3TGB A;  2QOS C;  3FEL A;  2OFR X;  1SWF A;  1D3S A;  4OMW A;  1LIC A;  2A3F X;  2HYS A;  1JIW I;  3RDO A;  4TJZ A;  1SY0 A;  2RTB B;  1VWC B;  1QY1 A;  1NP1 A;  2AT8 X;  4Y5D A;  3WZP A;  1ERX A;  3B2I A;  1Y9L A;  1DZK A;  2G79 A;  2Y32 A;  3WJC A;  1JV4 A;  1SY2 A;  1VYF A;  1Y53 X;  2ALL X;  3AUM O;  3IA8 A;  1DFV A;  3VHH A;  3EW2 A;  5B10 O;  4NYR A;  2R74 A;  2VFC A;  2MM3 A;  3B2J A;  1SLG B;  1BEB A;  2AF5 A;  2R56 A;  1DZM A;  1HMR A;  1BSQ A;  3CKF A;  3GE2 A;  1JMX A;  4HPC A;  4IB8 A;  5LJG A;  4MIS A;  2BC3 A;  3B2K A;  3FMZ A;  4IBA A;  5F1E A;  2HLV A;  1NC9 A;  1VWH B;  4HFO A;  2OVS A;  3BU1 A;  3WVM A;  3P6D A;  2AH7 X;  1SWG A;  1EW3 A;  3D4R A;  1GT4 A;  1YP7 A;  4Z2V A;  1AVD A;  1SWP A;  1T0V A;  4MEE A;  3S60 A;  3B2H A;  3RKG A;  1N43 A;  3FID A;  2G78 A;  4R0B A;  4A8Z A;  2RTG B;  3FA8 A;  4ZHC A;  1LPJ A;  1UYN X;  1Y52 X;  2OFM X;  3P6C A;  4OMX A;  5K06 A;  4NP1 A;  1VWA B;  1ZND A;  3T6F A;  4I3B A;  1EII A;  3VG4 A;  3ZQ3 A;  5LKF A;  1JMZ A;  3KVN A;  4IAW A;  2PY1 A;  4CPH B;  3P6G A;  1ICN A;  1JQP A;  3U03 A;  1VYO A;  2RTQ B;  4JGL A;  2ZAI A;  1CRB A;  5L8N A;  1L6M A;  1RSU B;  4OS3 A;  5KID A;  1GKA B;  3PED A;  5HA1 A;  2MF6 A;  4PJ2 A;  1EQD A;  1W5R A;  1SXY A;  2UZ2 A;  1G7N A;  5FAZ A;  1VWD B;  1VWN B;  2A13 A;  2QO6 A;  4OS8 A;  5B5G A;  4GET A;  4KII A;  1FEM A;  4N7D A;  5CYB A;  2CM9 A;  3RSW A;  1MOY A;  3S26 A;  3TF6 A;  4ZHH A;  4AYH A;  1VWL B; 
#chains in the Genus database with same CATH homology
 1HBQ A;  3N91 A;  4CV7 A;  3FEN A;  1NP4 A;  1PM1 X;  3MVF A;  4NLI A;  3CQR A;  1GXA A;  2RN4 A;  3BY0 A;  1NGL A;  1LF7 A;  4FGI B;  1FTP A;  1YUP A;  2JMB A;  4YFP A;  1RLB E;  3P6F A;  3SOT A;  1QWD A;  3D97 A;  4KC8 A;  3VU1 A;  2CZT A;  3FEK A;  3CWK A;  4MVE A;  3VE2 A;  1MVG A;  4U8U M;  1HQP A;  2EU7 X;  2L68 A;  4UU3 A;  2KTD A;  2WSJ A;  2W2F A;  1YWD A;  1FEL A;  4WFV A;  1SMP I;  3RZY A;  2A2G A;  1A57 A;  3G7X A;  2GTF X;  3F9D A;  4ZJ0 A;  3TZS A;  2FRS A;  1B0O A;  3NR3 A;  1YWC A;  1MDC A;  4MVL A;  5D47 A;  1S2P A;  3O19 A;  5HZ8 A;  2RQ0 A;  5HCC C;  1DC9 A;  2RCT A;  1O8V A;  2WQ9 A;  4LKT A;  5DG4 A;  2BLG A;  5L8I A;  2AT5 X;  4YMY A;  5HWZ A;  3S5V A;  1BRP A;  3FA7 A;  2YMS A;  2GTL M;  3KQ0 A;  2KTS A;  1OPB A;  2RD7 C;  5EDC A;  3FA9 A;  4U3Q A;  1SY1 A;  4O9S A;  5HAE A;  1OEE A;  1G74 A;  3UEX A;  1QAB E;  3P24 A;  4O3W A;  1OBQ A;  3VE1 A;  4Y0R A;  4YDB A;  5HZ5 A;  3CQN A;  4ODD A;  5FQ8 E;  5BVT A;  2FT9 A;  4N7C A;  4XMC A;  3WJB A;  3SAO A;  2XKL A;  4L3R A;  4OS0 A;  5H8T A;  1YIV A;  3OJY C;  3F8A A;  4ORX A;  1ZNG A;  2K62 A;  4FBR A;  2BS5 A;  1P6P A;  2NND A;  4XMF A;  4Y0S A;  5HCE C;  1AEL A;  4CSB A;  1CBI A;  2QO4 A;  5IO5 A;  3CBS A;  3JSQ A;  3Q6L A;  3UEV A;  4NNS A;  5C0N A;  4FQB B;  1RBP A;  3NX1 A;  1BSO A;  3KFH A;  1IFC A;  4LZU A;  4ES7 A;  4D6A A;  2X46 A;  2JU8 A;  4AZQ A;  3FW5 A;  3WXQ A;  1IW2 A;  5H9N A;  1GT3 A;  1QG5 A;  3NQK A;  4AW8 A;  2YG2 A;  5D4A A;  3PH6 A;  4BQU A;  1GT1 A;  1G85 A;  3E3C A;  4ARH A;  2HMB A;  4YDA A;  2A2U A;  3NQ9 A;  1ML7 A;  1CBQ A;  4COT A;  4AZP A;  5KHP A;  1ACD A;  3ELZ A;  3NQ3 A;  1EUO A;  5JR8 A;  3KFI A;  4WFU A;  4ORU A;  1B56 A;  1DF3 A;  4XMH A;  4ZHF A;  2Z4I A;  1GKA A;  3C78 X;  3PQU A;  1A2D A;  5CE4 A;  3ZI8 A;  2AKQ A;  4O4S A;  3WJF A;  3WJD A;  1TW4 A;  2DM5 A;  2FR2 A;  1U18 A;  4ORY A;  1ZNE A;  3EM0 A;  4NLJ A;  4O4X A;  4AZN A;  4TNN A;  2NNE A;  4YH0 A;  2QO5 A;  1KT5 A;  3AKM A;  3V8U A;  3CBC A;  1CBS A;  1OPA A;  4ZH6 A;  4M6S A;  3HWF A;  1HMT A;  2O62 A;  4LZV A;  3TGA A;  4GU8 A;  1XKI A;  2Q4N A;  1JYD A;  1X8Q A;  2QM9 A;  1EXS A;  2WQA E;  2OVA A;  3OE3 A;  4KCA A;  3JQO A;  4ZGF A;  3BX8 A;  2JU3 A;  4QGV A;  1MX7 A;  3GAQ A;  3KZA A;  5HBS A;  5IO7 A;  3ZW1 B;  4O49 A;  4I9S A;  2L9C A;  2WUT A;  4LKP A;  3UAQ A;  3IFB A;  4YGG A;  5HA0 A;  4ORS A;  1KQX A;  1JJX A;  3BRN A;  1IKE A;  3JS1 A;  5HCD C;  1PEE A;  5BYP A;  2WEW A;  4MVI A;  1U17 A;  3H3I A;  2ACP X;  1JBH A;  1HN2 A;  1X8N A;  2LFO A;  2HZR A;  4KT5 A;  5FFH A;  3WJE A;  1T68 X;  1YP6 A;  5LJB A;  4IB9 A;  3ZW2 A;  3EBW A;  3D96 A;  5F58 A;  4I3D A;  1O1V A;  4YCE A;  4IAX A;  3HOL A;  4TKB A;  5L8O A;  4I9R A;  1JZU A;  3FW4 A;  1UZ2 X;  4TLJ A;  4CK4 A;  4GZV A;  1ZNL A;  3PQS A;  3F6Z B;  3APU A;  4QAE A;  3BLG A;  1EPA A;  3L4R A;  1A18 A;  1KOI A;  3NAD A;  4GDZ A;  2LA7 A;  2LBV A;  2GJ5 A;  1LID A;  4ALB A;  2OVD A;  3HWG A;  3FYF A;  1BJ7 A;  1KT7 A;  5EEE A;  1CJ5 A;  1OBU A;  4GNY A;  2FWV A;  1D2U A;  3AKN A;  1ZNK A;  1XCA A;  5KIC A;  4ZCB A;  3BU9 A;  3WOV A;  1BSY A;  4HWM A;  3EMM A;  3PP6 A;  1I4U A;  1ERB A;  2R73 A;  3PH5 A;  2AMM X;  4ON1 A;  5BVS A;  4TQ2 A;  1FDQ A;  3D95 A;  4EFG A;  3VG3 A;  4EXZ A;  2FS6 A;  3STK A;  1SXU A;  2CBR A;  2L67 A;  4U8U N;  1BBP A;  1E00 A;  4EQA C;  4IB6 A;  4NYQ A;  4AZR A;  4YKO A;  2KT4 B;  5AEO A;  3HTY A;  1PMP A;  2AL0 X;  1BM5 A;  5LJH A;  4M7M A;  3EBK A;  1T8V A;  4HPA A;  1U0X A;  3VG2 A;  1TVQ A;  3FIQ A;  2F09 A;  3NP1 A;  3ZZV A;  1E02 A;  2ZAG A;  4KC7 A;  2ANS A;  2MJI A;  1SA8 A;  1EIO A;  5FQ7 E;  2GTL N;  3HWE A;  1IKJ A;  4PSQ A;  4L1N A;  3QKG A;  5FQ6 E;  1E5P A;  4GNW A;  4GE1 A;  5HZQ A;  3DSZ A;  5B27 A;  4GK9 A;  2HZQ A;  5LJD A;  1OEK A;  2JW1 A;  1X8P A;  1TOW A;  1GT5 A;  2A0A A;  4KH8 A;  4YGH A;  3EYC A;  2AT6 X;  4FBV A;  1QFT A;  3CMP A;  3WBG A;  2NP1 A;  1X8O A;  4GRJ A;  4O3Z A;  3BS2 A;  4INN A;  5EED A;  3LV4 A;  4MVK A;  2MHD A;  4NNT A;  1JYJ A;  3O22 A;  1GGL A;  1I05 A;  1QY0 A;  3BDR A;  2Q9S A;  2QMI A;  3ZW0 B;  1QFV A;  3C76 X;  4AZM A;  2W2B A;  1DV9 A;  4QYN A;  3S5X A;  1GM6 A;  4ZGU A;  1B8E A;  4ORW A;  3T1D A;  1I04 A;  4IMO A;  1IFB A;  2G7B A;  3P6H A;  1Z24 A;  2MO5 A;  3FLL A;  4Y0P A;  4TKH A;  2AT0 X;  2X8T A;  3STN A;  3RBY A;  4QRL A;  2CBS A;  4YGZ A;  2LB6 A;  1PBO A;  5LJK A;  1S44 A;  1YWA A;  3STM X;  5HZ6 A;  1IIU A;  3VPJ E;  3WJG A;  1BLR A;  1VPR A;  3KFF A;  4K19 A;  1SXW A;  4QGW A;  2W2A A;  1A3Y A;  1AVG I;  1YWB A;  4QQ1 A;  2LKK A;  3ZW1 A;  2X8F A;  4ID2 A;  4QZU A;  4ZH9 A;  3C77 X;  1OBP A;  2RA6 A;  3TGC A;  4QNI A;  1GX8 A;  4A1H A;  4ZHG A;  1I06 A;  4QYP A;  1LIE A;  4GKC A;  4XMD A;  3NPO A;  5H9A A;  3APX A;  5EDB A;  3OBL A;  4Y0Q A;  5AQ6 A;  4HPD A;  1AB0 A;  1KXO A;  4ORR A;  4QGX A;  1MX8 A;  4WHI A;  1LIB A;  4EDE A;  5F6Z A;  1FEN A;  3NX2 A;  1LNM A;  2Z4H A;  3BSZ E;  5H9L A;  4MIR A;  1BWY A;  2JU7 A;  3B2L A;  4ALO A;  2L5P A;  1EI5 A;  1FE3 A;  3FA6 A;  3PEC A;  4NW4 A;  4YFQ A;  1ZRY A;  3ELX A;  3VG7 A;  4DQ3 A;  5HZ9 A;  2BS6 A;  4A60 A;  2FTB A;  3RWX A;  2HNX A;  4O3Y A;  4AZO A;  3LHN A;  1S7D A;  3FR5 A;  1CBR A;  2KD2 A;  3NBX X;  5HTE A;  2OZQ A;  4EEJ A;  1H91 A;  4WBK A;  3BX7 A;  1B4M A;  1X71 A;  3FR4 A;  2WR6 A;  3I0A A;  3K3L A;  4YBP A;  3UEW A;  4ZHD A;  2FLJ A;  2LBA A;  3P6E A;  3APW A;  2N93 A;  3ZWE A;  1X8U A;  4D6B A;  1HMS A;  5FEN A;  2CM4 A;  1QY2 A;  1EPB A;  1KZX A;  5DPQ A;  3P02 A;  1OEJ A;  1G5W A;  4ZFX A;  5BVQ A;  1KT4 A;  2RCQ A;  2P8G A;  1E06 A;  3DTQ A;  3HWD A;  3I17 A;  4ML7 B;  4YKM A;  3UEU A;  4BVM A;  2X45 A;  3HOE A;  4GH7 A;  5D8J A;  2JN3 A;  2Q2M A;  5IO6 A;  5H9K A;  4I6S A;  4DQ4 A;  5AJB A;  1HBP A;  2E4J A;  2FR3 A;  4ZR2 A;  3MX7 A;  1KT3 A;  3CR6 A;  5D45 A;  4RUU A;  2Q2P A;  2BHV A;  2WEX A;  3PPT A;  3ZW0 A;  3VG5 A;  1DZJ A;  2JOZ A;  4IAB A;  1LKE A;  3FEP A;  1MUP A;  1TXL A;  1EAL A;  5EZ2 A;  2K23 A;  4O4U A;  1ADL A;  1R0U A;  4IMN A;  2ACO A;  2GC9 A;  1X89 A;  2X8S A;  4U8U O;  4I3C A;  1ZNH A;  4BOE A;  3MBT A;  4RUN A;  3U9P C;  5EPQ A;  4I95 A;  2KW1 A;  1ALB A;  5LJE A;  4YCH A;  4XME A;  4YBU A;  2Q39 A;  4O3X B;  1KQW A;  1SY3 A;  2ASN X;  3U0D A;  2M4L A;  1SXX A;  3OD9 A;  1Y9T A;  4YFR A;  1KT6 A;  5LKE A;  5F6B A;  2IFB A;  3KFG A;  5HTD A;  1QQS A;  1VYG A;  2AT3 X;  4QZT A;  1ICM A;  2WWP A;  1TOU A;  2FS7 A;  5AJC A;  5F7G A;  5LJC A;  2CZU A;  4O4O A;  3O2Y A;  1DZP A;  3APV A;  5B29 A;  2XST A;  1N0S A;  1AQB A;  4U9C A;  2POA A;  1LFO A;  1BRQ A;  4IB7 A;  2GTL O;  2NNQ A;  3FR2 A;  3ZUI A;  2MWH A;  2F73 A;  4UU2 A;  4FBO A;  4LQZ A;  4XMG A;  1O1U A;  4TKJ A;  1URE A;  1GX9 A;  2OVE A;  4HPB A;  3HK1 A;  1JJJ A;  2BT9 A;  3ZUO A;  1KGL A;  5D48 A;  1LIF A;  3TGB A;  2QOS C;  3FEL A;  2OFR X;  1D3S A;  4OMW A;  1LIC A;  2A3F X;  2HYS A;  1JIW I;  4TJZ A;  1SY0 A;  1QY1 A;  1NP1 A;  2AT8 X;  1ERX A;  3B2I A;  1Y9L A;  1DZK A;  2G79 A;  3WJC A;  1JV4 A;  1SY2 A;  1VYF A;  2ALL X;  3IA8 A;  1DFV A;  4NYR A;  2R74 A;  2MM3 A;  3B2J A;  3GE2 A;  1BEB A;  3VG6 A;  2R56 A;  1DZM A;  1HMR A;  1BSQ A;  4HPC A;  4A1Y A;  1KZW A;  4IB8 A;  5LJG A;  4MIS A;  3B2K A;  3FMZ A;  4IBA A;  5F1E A;  2HLV A;  4HFO A;  2OVS A;  3BU1 A;  3WVM A;  3P6D A;  2AH7 X;  1EW3 A;  3D4R A;  1GT4 A;  1YP7 A;  1T0V A;  3S60 A;  3B2H A;  3RKG A;  4A8Z A;  2G78 A;  4R0B A;  3FA8 A;  4ZHC A;  1LPJ A;  2OFM X;  5K06 A;  4OMX A;  3P6C A;  4NP1 A;  1ZND A;  4I3B A;  1EII A;  3VG4 A;  3ZQ3 A;  5LKF A;  4IAW A;  2PY1 A;  3P6G A;  1ICN A;  3U03 A;  4JGL A;  2ZAI A;  1CRB A;  5L8N A;  1L6M A;  4OS3 A;  5KID A;  1GKA B;  3PED A;  5HA1 A;  4PJ2 A;  1EQD A;  1SXY A;  1G7N A;  5FAZ A;  4OS8 A;  2A13 A;  2QO6 A;  4GET A;  4KII A;  1FEM A;  4N7D A;  5CYB A;  2CM9 A;  3RSW A;  3S26 A;  3TF6 A;  4ZHH A;  4AYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...