1YWBA

0.9 a structure of np4 from rhodnius prolixus complexed with no at ph 5.6
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nitrophorin 4
publication title Ultrahigh Resolution Structures of Nitrophorin 4: Heme Distortion in Ferrous CO and NO Complexes
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Ligand binding protein, blood clotting
total genus 49
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2005-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1ywbA00
1DF3A 1NGLA 1EIOA 3KFHA 3NX2A 3ELXA 4OMWA 3APVA 4KIIA 4N7CA 3STMX 4ZH9A 5BVSA 2OVDA 4NP1A 4YGZA 4YBPA 1SY1A 3FA8A 1X8PA 1P6PA 1E06A 1KT7A 1T8VA 1X8OA 1FE3A 4LKTA 4GRJA 1ZNEA 4QYPA 1QFVA 2AT3X 2Q2MA 1NP1A 1FEMA 1X71A 2OVEA 3D97A 3HWGA 4IMNA 4YGGA 2AKQA 1GKAB 5AQ6A 2JU8A 1YWAA 5D45A 4A1HA 4R0BA 5LJHA 1HBPA 3CWKA 5LJGA 4LKPA 4GE1A 2K62A 1E00A 1OEJA 1OPBA 1T68X 5HZ5A 1KT6A 2HLVA 1IKEA 5B27A 1JJJA 4I3DA 1KOIA 1BLRA 1OBQA 2AT6X 4M6SA 3I17A 1I05A 1AELA 3BY0A 3WBGA 1MVGA 2A2UA 1VYGA 1X89A 1MDCA 3AKMA 2MM3A 2NNDA 4O9SA 1ICMA 1OBUA 3P6HA 1QY0A 1TW4A 5LKEA 2GTFX 4ODDA 1DFVA 5H9LA 4EDEA 5HTDA 4TJZA 4QZTA 2OVAA 4GETA 1HMRA 1SY3A 2HMBA 2HNXA 3UEVA 3U9PC 4YCEA 1MX7A 2WQ9A 1ZNGA 4ZJ0A 5KIDA 1BRQA 2Q9SA 2XSTA 3FA9A 2CZTA 5L8NA 2WSJA 4YDBA 3C78X 3WJDA 1AQBA 4AZQA 2N93A 3WXQA 5F58A 5H9KA 1JBHA 4K19A 3PEDA 2LKKA 4CK4A 2L68A 3WVMA 3VG3A 1BRPA 2G78A 1ZNHA 5D48A 1G5WA 4D6BA 3JSQA 3DTQA 5KICA 4I9SA 3STNA 2FRSA 1CBIA 2OFMX 3FR2A 1VPRA 1O1UA 2XKLA 4OS8A 4GNWA 4YDAA 1D2UA 5L8IA 2JN3A 2L5PA 4AZRA 1CJ5A 4ES7A 4I3BA 1EW3A 5F6BA 1LF7A 2CM9A 1O1VA 3CR6A 3KQ0A 2ANSA 1LIEA 4XMEA 4OS3A 4EEJA 3FLLA 3F9DA 1H91A 4DQ3A 1QY2A 2WUTA 1I06A 1JYDA 2LB6A 3FIQA 3T1DA 1FELA 2Q2PA 3FW4A 1KQXA 3P6GA 1EUOA 3ZUOA 1O8VA 4QGXA 4A60A 5EDBA 2X46A 1UREA 4MVKA 5HA1A 1DC9A 1QABE 3HWDA 4HPDA 4TKHA 1E02A 1OEEA 3FW5A 2KT4B 5EEEA 4ZHGA 2E4JA 1AVGI 2FR3A 1A3YA 3APXA 1A2DA 1IKJA 5HTEA 5FFHA 4YBUA 1SA8A 1GT4A 1X8UA 3CBCA 3HK1A 4WBKA 1PM1X 2LBAA 3JS1A 5IO5A 4MVLA 4TNNA 2ASNX 2WQAE 1ERXA 3PPTA 1ML7A 5LJKA 3Q6LA 2LFOA 4NNTA 3UEWA 3VG4A 4ZGUA 3APWA 3VG7A 3U0DA 3KFFA 1R0UA 1ZNLA 4IAWA 1FENA 1QWDA 1DZKA 2YG2A 1OEKA 3KFIA 4YFPA 5HA0A 5C0NA 1B8EA 1DZJA 3TGBA 5HZ6A 2PY1A 3C77X 2WEWA 1X8QA 2RQ0A 4GNYA 1EIIA 1PEEA 1KZWA 3WJGA 2CBSA 3WJEA 2RA6A 4QGWA 1ADLA 1UZ2X 1GXAA 1SXWA 4GKCA 4BQUA 2R73A 3BU1A 3P6DA 1KQWA 2ACOA 3PH6A 2LBVA 5LJEA 5LJCA 3BX8A 1DZMA 3VG6A 3WJFA 1EXSA 1X8NA 1TVQA 3B2IA 3NP1A 4XMHA 1YWCA 5DPQA 4AW8A 4M7MA 3QKGA 5HCDC 1IIUA 2RD7C 3PH5A 1KT3A 3MBTA 4ALOA 2GC9A 1VYFA 1GKAA 3B2LA 1BSQA 5B29A 2ALLX 4BVMA 1TXLA 5EEDA 3B2KA 4ORRA 4IB9A 5BVQA 3RSWA 4Y0SA 5HCCC 1SXXA 4XMDA 2AH7X 2FS6A 2G79A 4QAEA 4YFRA 2W2AA 1S7DA 3BRNA 3IA8A 2CZUA 1ICNA 1YWBA 3NQ9A 5EZ2A 3NPOA 3ELZA 4ZHFA 3APUA 3CMPA 4IB8A 1SY2A 1BSOA 2FTBA 5H8TA 3GAQA 3B2HA 1GM6A 2MO5A 4Y0PA 1RLBE 3KFGA 4N7DA 4ZCBA 2AMMX 4I9RA 1KZXA 2W2FA 3VG2A 4ALBA 3O2YA 2QO4A 3FA7A 2HZRA 2JU3A 2W2BA 2L9CA 4I3CA 2A3FX 4NLIA 1BBPA 1U18A 5LJBA 4ORYA 1KXOA 3FMZA 1A57A 2HYSA 3VG5A 1S2PA 5F7GA 1HQPA 2A0AA 2NNQA 3IFBA 5FENA 4BOEA 1LIBA 3ZUIA 1CBQA 2R56A 4OMXA 1FTPA 1A18A 1I4UA 1JYJA 4HFOA 4IB6A 1GT5A 4A1YA 3FEKA 1B0OA 5K06A 1BEBA 1YUPA 1IFCA 4IB7A 2FWVA 4LZUA 2L67A 1L6MA 4WFUA 2QOSC 2RCTA 4XMGA 1LKEA 3FEPA 1HN2A 1TOWA 1GT1A 2QO5A 1B4MA 3F8AA 3TZSA 1LPJA 3FA6A 3PP6A 3ZQ3A 1LIDA 4AZOA 4NLJA 4OS0A 1HMSA 2IFBA 1CRBA 1LNMA 2NP1A 1HBQA 3TF6A 2O62A 1OBPA 4TKBA 3EYCA 4XMCA 1TOUA 2R74A 1EPBA 1EPAA 1SXYA 4QYNA 2Q39A 3K3LA 3BDRA 3NQ3A 5H9AA 1MX8A 4PSQA 5L8OA 4Y0QA 4WFVA 1NP4A 2ACPX 5HZ8A 1ZNDA 3PECA 4IMOA 1IW2A 2POAA 5HAEA 5LKFA 4ZFXA 2NNEA 1CBRA 3OJYC 1JZUA 4YH0A 1G7NA 1XKIA 4YGHA 3P6FA 1YWDA 1BJ7A 3DSZA 4ORUA 4ZR2A 3D96A 2KTDA 5HZ9A 1ZRYA 2QO6A 4UU2A 3CQNA 1JV4A 2FR2A 2WEXA 4ARHA 1ACDA 3S26A 3BSZE 4QGVA 1QFTA 4HPCA 1GT3A 1LFOA 1EALA 3NX1A 4ORSA 4ZHDA 1IFBA 3EMMA 1S44A 1G85A 3D95A 2A13A 4HPAA 1QG5A 1BM5A 1BWYA 2CM4A 5HCEC 3AKNA 2G7BA 5D8JA 2JU7A 1JJXA 3FR4A 5D4AA 1ZNKA 2WR6A 1YP6A 1SY0A 3U03A 3EBWA 1OPAA 5D47A 1PBOA 3C76X 1B56A 4HPBA 1PMPA 3WJBA 3CBSA 1GX9A 2HZQA 4IAXA 1HMTA 3RZYA 4YKOA 1G74A 1KT4A 2OFRX 3HWFA 4D6AA 4Y0RA 4YKMA 2OZQA 3NADA 1DZPA 4MVIA 4NYQA 4AYHA 4TLJA 3CQRA 2FS7A 3P6EA 4EXZA 3UEUA 1YP7A 2BLGA 4LZVA 3UEXA 2AL0X 3NR3A 5HBSA 4GH7A 2A2GA 3B2JA 4AZNA 3O22A 5IO6A 2DM5A 3FR5A 1U17A 1ERBA 4IBAA 2F73A 2RCQA 5H9NA 3SAOA 4ZHHA 4NYRA 1D3SA 3EM0A 4RUUA 4ZHCA 4TKJA 3MVFA 1AB0A 2AT5X 5CE4A 5IO7A 3FENA 5HWZA 4AZPA 2AT8X 1DV9A 2K23A 5LJDA 1LIFA 4NNSA 3TGCA 5DG4A 2GJ5A 1BSYA 3EBKA 1N0SA 2EU7X 1FDQA 2FT9A 5F1EA 1KT5A 4ZH6A 5EDCA 3STKA 4YFQA 4TQ2A 1QQSA 1ALBA 1CBSA 1RBPA 2QM9A 5F6ZA 1E5PA 1GGLA 3O19A 2JOZA 2CBRA 3BU9A 1SXUA 1Z24A 4YCHA 5KHPA 3G7XA 3TGAA 1QY1A 3P6CA 2FLJA 2P8GA 3FELA 1KGLA 3BLGA 2X45A 1EQDA 4EFGA 2AT0X 3BX7A 3L4RA 5HZQA 1LICA 4AZMA 1MUPA 4A8ZA 4YMYA 3I0AA 4RUNA 4QZUA 4XMFA 1GX8A 4UU3A 3KZAA 3WJCA 1T0VA 2MJIA 2Q4NA 5EPQA 4ORWA 1YIVA 4DQ4A 1U0XA 5BVTA 5FAZA 3HWEA 1XCAA 2WWPA 3BS2A 4ORXA 5JR8A 1I04A
chains in the Genus database with same CATH superfamily
1DF3A 1PTSA 1NGLA 1EIOA 3KFHA 3NX2A 2RTGB 3ELXA 4OMWA 3APVA 4KIIA 4N7CA 4U8UN 3STMX 4CSBA 4ZH9A 5BVSA 2OVDA 4NP1A 4YGZA 4YBPA 1SY1A 3FA8A 1X8PA 1P6PA 1E06A 1SWTA 1KT7A 1T8VA 2OF9A 1X8OA 1FE3A 2G8CO 4LKTA 4GRJA 4O3XB 1ZNEA 4GUZA 4QYPA 1QFVA 3H3IA 1SREA 2AT3X 2Q2MA 1NP1A 1HXZA 1FEMA 1X71A 2OVEA 3D97A 3HWGA 4IMNA 4YGGA 2AKQA 1K24A 5BYPA 1LDQA 1GKAB 5AQ6A 4O4SA 2FHLA 1YWAA 2JU8A 5D45A 4R0BA 3FDCA 4A1HA 1HBPA 3CWKA 5LJGA 4KC8A 3EW1A 4LKPA 1Y9LA 3FIDA 4GE1A 3CKFA 1VWRB 2IZKA 3HOEA 2K62A 1E00A 1OEJA 1OPBA 1T68X 5HZ5A 1KT6A 5CYBA 2HLVA 1IKEA 5B27A 1JJJA 4I3DA 1KOIA 4CDDA 1SRIA 1BLRA 3PQUA 2KW1A 1OBQA 2AT6X 4M6SA 3I17A 1VWNB 1I05A 1AELA 3BY0A 3WBGA 1MM9A 1MVGA 2A2UA 1VYGA 1X89A 1MDCA 3AKMA 2MM3A 4EQAC 2NNDA 4O9SA 1VWJB 1ICMA 1OBUA 4Z27A 3P6HA 1QY0A 1TW4A 1SWKA 4DCBA 5B2AO 4CDEA 4MEEA 1SLGB 5IRUA 5LKEA 1HXLA 2GTFX 4ODDA 1DFVA 4FBOA 1JQPA 5H9LA 4EDEA 4FGIB 5HTDA 4TJZA 4QZTA 1SWQA 2PI3O 3KVNA 2OVAA 1N9YA 4OELA 4GETA 1HMRA 1SY3A 2HMBA 2HNXA 3UEVA 3U9PC 4CV7A 4YCEA 1MX7A 2RTOB 2WQ9A 3RDUA 1ZNGA 3MG5A 1K3BA 4ZJ0A 5LJKA 5KIDA 1BRQA 2Q9SA 1NDJA 4O4XA 2XSTA 3FA9A 2CZTA 5L8NA 2WSJA 3QQ2A 3C78X 4YDBA 3VHIA 3WJDA 1AQBA 4AZQA 2N93A 3WXQA 1Y0GA 5F58A 5H9KA 4INNA 4K19A 1JBHA 3F6ZB 1I78A 1VWLB 2LKKA 3PEDA 4GD9A 1WBIA 2L68A 4CK4A 4PJ2A 5K68A 3WVMA 3VG3A 1BRPA 2G78A 4FBVA 1ZNHA 4Z28A 5D48A 1G5WA 2IZGB 3CKGA 4D6BA 2RTHB 3JSQA 3DTQA 1SWGA 5KICA 4I9SA 1JJUA 3STNA 3ZI8A 2MF6A 2LA7A 2FRSA 5K67A 1CBIA 2C4IA 2OFMX 3FR2A 1VPRA 4GGTA 3T6LA 1N43A 1Y9TA 2DJFA 1O1UA 2XKLA 4OS8A 2X4MA 4GNWA 4YDAA 1D2UA 5L8IA 2JN3A 2L5PA 4AZRA 4Z2OA 2OY5O 1CJ5A 4ES7A 2OL8O 4I3BA 1EW3A 2C1QA 5F6BA 1LF7A 2CM9A 1O1VA 3CR6A 3EC5A 3KQ0A 2ANSA 5JD2A 4ID2A 1LIEA 1MK5A 3VHHA 4XMEA 4OS3A 4EEJA 3FLLA 1VWHB 3F9DA 1H91A 4DQ3A 1QY2A 2WUTA 1I06A 3ZW0A 1JYDA 2F01A 2LB6A 3FIQA 1SLFB 2QOMA 2RTKA 3T1DA 1FELA 1KL3A 2Q2PA 3FW4A 1KQXA 3P6GA 1EUOA 3ZUOA 1O8VA 4QGXA 4A60A 4GDZA 5EDBA 2X46A 1UREA 4MVKA 5HA1A 1DC9A 1QABE 1VWIB 3HWDA 4HPDA 4TKHA 1E02A 1OEEA 1RXKA 3FW5A 2KT4B 2VFCA 5EEEA 3RDXA 4CPFA 4ZHGA 2E4JA 5AEOA 4O4OA 1AVGI 2FR3A 1SRFA 3GE2A 1A3YA 3VHMA 2JMBA 1A2DA 1IKJA 2Y3EA 3APXA 5IRAA 3WYPA 2A5CA 4ML7B 4CDFA 5B5GA 5HTEA 5FFHA 2ZAIA 4YBUA 3VGWA 1SA8A 1GT4A 1X8UA 3CBCA 3HK1A 4WBKA 1PM1X 2LBAA 3JS1A 5IO5A 4MVLA 4TNNA 2ASNX 3ZW1A 2IZEB 1ERXA 2WQAE 1ML7A 1EI5A 3PPTA 2LFOA 3Q6LA 4GJSA 4NNTA 3RE6A 3UEWA 3VG4A 4ZGUA 1RAVA 3APWA 2IZLB 3VG7A 1SWNA 4L3RA 3U0DA 3KFFA 1R0UA 3RY2A 1ZNLA 2MHDA 3OD9A 4IAWA 1FENA 3WZOA 1QWDA 1VWDB 1DZKA 1N7YA 1Y53X 2GTLO 4I95A 2YG2A 1OEKA 2HKDA 4O4UA 3KFIA 4YFPA 5HA0A 3RWXA 1B8EA 1DZJA 2RTBB 5C0NA 2PY1A 5HZ6A 3C77X 2WEWA 3TGBA 1X8QA 4DNEA 2RQ0A 4GNYA 1EIIA 3VPJE 1PEEA 1KZWA 3WJGA 2CBSA 3WJEA 2RA6A 3FYFA 1ADLA 1UZ2X 1GXAA 4GGZA 4QGWA 1SXWA 4GKCA 4BQUA 2R73A 3BU1A 5KHPA 2RTLA 1KQWA 2ACOA 3P6DA 3PH6A 1SWFA 4O3YA 3BX8A 2LBVA 2KTSA 5LJEA 5LJCA 1DZMA 3VG6A 3WJFA 1EXSA 1X8NA 1TVQA 3B2IA 3NP1A 4XMHA 1YWCA 3WOVA 1SLDB 5DPQA 4AW8A 4JO6A 4M7MA 3QKGA 5HCDC 2OYBO 1IIUA 2RD7C 3PH5A 2OF8A 1KT3A 3MBTA 4ON1A 4ALOA 2GC9A 1VYFA 4O49A 1GKAA 3B2LA 1STPA 1BSQA 1VWGB 3HOLA 4OKAA 2ALLX 4Y59A 2UZ2A 4BVMA 4Z2PA 5B29A 1TXLA 2JGSA 5EEDA 3B2KA 1AVDA 2GTLM 4GZVA 4ORRA 4Z6JA 2A8GA 2RTCB 1VWPB 2M4LA 4IB9A 5BVQA 4Y0SA 3RDSA 3RSWA 1VWKB 5HCCC 1SXXA 1SWLA 4GGRA 4U3QA 4XMDA 3SLJA 3WZPA 3OBLA 4HWMA 2AH7X 2FS6A 2G79A 4KH8A 4QAEA 2RTEB 1DF8A 3S5VA 2W2AA 4YFRA 1S7DA 3BRNA 3IA8A 2CZUA 4ZGFA 5IRWA 2QMIA 1ICNA 1YWBA 3E3CA 1W6FA 2C1SA 3NQ9A 3NPOA 3ELZA 3JQOA 3APUA 3PK2A 5EZ2A 1SWUA 3CMPA 4IB8A 1SY2A 4NV7A 1BSOA 5FQ8E 2FTBA 5H8TA 3GAQA 3B2HA 1GM6A 2MO5A 4Y0PA 1RLBE 3KFGA 4N7DA 4GJVA 4ZCBA 2AMMX 5CSEA 3MX7A 4I9RA 1KZXA 2W2FA 3VG2A 4ALBA 3O2YA 2QO4A 1NC9A 3FA7A 2HZRA 2JU3A 2W2BA 2L9CA 4I3CA 2A3FX 2IZJA 4IABA 4NLIA 1BBPA 1U18A 5LJBA 4ORYA 1MEPA 3LV4A 1E2TA 1KXOA 2X8TA 2A5BA 4CDCA 3FMZA 4JNJA 1A57A 2HYSA 3VG5A 1S2PA 5F7GA 3T6FA 4GK9A 1N4JA 1HQPA 4BGFA 1LCZA 2A0AA 2NNQA 3IFBA 4I60A 5FENA 1PBYA 1LIBA 4BOEA 3ZUIA 1CBQA 3EW2A 3RDOA 2R56A 4OMXA 4CPIA 3LTWA 1MOYA 1FTPA 1VWMB 1A18A 1I4UA 1JYJA 1JIWI 1SMPI 1GT5A 1VWEB 3OE3A 4HFOA 4IB6A 4Y5DA 3VE2A 4A1YA 5B5FA 1NQNA 2G5LA 2I5ZO 1B0OA 2OFAA 3FEKA 3ZW2A 4CPHB 1UYOX 1BEBA 5K06A 1YUPA 2AF5A 1IFCA 2GH7A 2I5VO 4IB7A 2FWVA 2VDFA 1SWRA 3RBYA 4LZUA 2L67A 1L6MA 2FHNX 4WFUA 2QOSC 2RCTA 4XMGA 1SWBA 1HQQA 1LKEA 3FEPA 1HN2A 3ZW1B 1TOWA 1GT1A 2FGSA 3HTYA 2QO5A 3VE1A 1B4MA 3F8AA 3TZSA 4U46A 3PQSA 1LPJA 1JMXA 5AJCA 1VWOB 3FA6A 3PP6A 1LIDA 2UYWA 3ZQ3A 4NLJA 4AZOA 4BX6B 4OS0A 4YVBA 1HMSA 2IFBA 1CRBA 5AJBA 4BBOA 1LNMA 2NP1A 1HBQA 3TF6A 1RXJA 1OBPA 2O62A 3EYCA 2X55A 4TKBA 4XMCA 1I9HA 1TOUA 2Y32A 2R74A 1EPBA 3N91A 4EKVA 1EPAA 1SXYA 1AVEA 2ZSCA 2Q39A 3K3LA 3BDRA 3NQ3A 2X32A 4QYNA 5H9AA 1MX8A 4PSQA 4QNIA 2BS5A 2BSZA 2F09A 5L8OA 2GTLN 4Y0QA 2BT9A 1NP4A 2IZAA 4WFVA 1NBXA 1VWCB 2ACPX 1ZNDA 2RTFB 5HZ8A 2X34A 3PECA 1OSPO 1SRJA 4IMOA 3NBXX 3UAQA 1IW2A 3NQKA 2POAA 4U9CA 5HAEA 1SWAA 5LKFA 5B3MO 4ZFXA 2OFBA 2NNEA 4U8UO 1CBRA 2RTDB 3OJYC 4BX6A 1JZUA 4YH0A 1G7NA 2BS6A 1STSB 1XKIA 2IZCB 1YWDA 3P6FA 4QQ1A 4YGHA 1VWBB 5L3YA 3ZWEA 2RTPB 1NQMA 1BJ7A 4KT5A 3P02A 3DSZA 5LJHA 4ORUA 1W5RA 4ZR2A 3D96A 3AUMO 4OEMA 4BCSA 2KTDA 5HZ9A 1ZRYA 2QO6A 4UU2A 3CQNA 3P24A 1RSTB 3SLOA 1JV4A 2FR2A 2WEXA 4I6SA 4LQZA 4ARHA 1ACDA 3S26A 3BSZE 4QGVA 1SLEB 3X00A 1LELA 1QFTA 2X8SA 1GT3A 1LFOA 4HPCA 4NV8A 1EALA 2DJGA 3WZNA 3NX1A 2IZIA 4ORSA 1N9MA 4ZHDA 1IFBA 3EMMA 1S44A 1G85A 3D95A 2A13A 3RDQA 3Q34A 5B11O 4HPAA 1QG5A 3WYQA 1BM5A 1BWYA 1SWEA 2CM4A 5HCEC 3AKNA 2OY7A 1LCWA 2G7BA 4BX7B 5D8JA 2IZBA 4MISA 2JU7A 2OL6O 2Z4HA 3FR4A 3WZQA 1JJXA 5D4AA 3V8UA 1ZNKA 3T2WA 2ZAGA 2KD2A 1RXHA 1YP6A 2WR6A 4MIRA 1LUQA 1SY0A 3U03A 4U8UM 3T2XA 3EBWA 4B55A 1RSUB 1OPAA 1Y55X 5D47A 1PBOA 4BX5B 3SZIA 3C76X 4JGLA 4CPEA 1GX3A 1JMZA 1B56A 4HPBA 4CPHA 2YMSA 2RN4A 1PMPA 3PDFA 4MVEA 1IJ8A 5FQ6E 3CBSA 3WJBA 2IZFB 3S5XA 4GU8A 1GX9A 1LDOA 2RTQB 2HZQA 3MM0A 4IAXA 3RE5A 1HMTA 1SWPA 3RKGA 3RZYA 2JW1A 1SRHA 3D4RA 4YKOA 1G74A 1KT4A 2OFRX 2OY8A 4BX7A 3HWFA 3VU1A 4D6AA 1FJ1E 2QCBA 4Y0RA 4YKMA 2CAMA 2OZQA 3NADA 1DZPA 2BHVA 3D9WA 4MVIA 4NYQA 4TLJA 3CQRA 2FS7A 1STRB 3P6EA 5FQ7E 4AYHA 2RTJA 4EXZA 3UEUA 1YP7A 2BLGA 4FQBB 4L1NA 4LZVA 2AL0X 3NR3A 3UEXA 5HBSA 4GH7A 2A2GA 3B2JA 4AZNA 2OY1O 3O22A 4BX5A 5IO6A 3AEHA 2DM5A 3FR5A 2RTAA 1KL5A 4Z2VA 1VWFB 1U17A 1VWQB 1ERBA 1SWHA 1SWOA 4IBAA 3ZW0B 2F73A 2RCQA 5H9NA 3SAOA 1DV9A 4ZHHA 4NYRA 1D3SA 3EM0A 4RUUA 4ZHCA 4TKJA 3MVFA 3RY1A 4O3WA 1AB0A 2AT5X 4QRLA 5CE4A 2Y3FA 5IO7A 3FENA 4KCAA 2IZDB 5IXGA 5HWZA 4AZPA 3SZJA 2AT8X 2MWHA 2OVSA 2K23A 2X56A 5LJDA 1LIFA 4NNSA 4ZHFA 5DG4A 3TGCA 1KFFA 2GJ5A 1SWSA 1BSYA 4WHIA 4C5PA 3EBKA 2FKJA 1N0SA 2EU7X 4COTA 1FDQA 2X8FA 1LCVA 2FT9A 3SLTA 2BC3A 5F1EA 1KT5A 2RTIB 4ZH6A 1Y52X 5EDCA 2VFBA 4YFQA 3STKA 4O3ZA 1QQSA 2RTRB 4FBRA 4TQ2A 1ALBA 1CBSA 1RBPA 2QM9A 4IRWA 5B10O 4BJ8A 5F6ZA 1SWDA 1E5PA 1GGLA 1W4TA 1HY2A 1SWJA 2JOZA 2CBRA 3BU9A 1SXUA 1Z24A 3O19A 4GDAA 4NW4A 3HPEA 3G7XA 3LHNA 4YCHA 3S60A 3TGAA 1QY1A 3P6CA 2IZHB 1SRGA 2FLJA 2P8GA 3SZHA 2RTMA 1VYOA 3FELA 2Z4IA 1KGLA 3BLGA 2X45A 3ZZVA 1EQDA 5F2BA 1UYNX 4EFGA 2AT0X 3BX7A 2OL7A 3L4RA 1VWAB 4KC7A 5HZQA 1SWCA 1LICA 4AZMA 1MUPA 2AVIA 2FKGA 4A8ZA 4YMYA 1KL4A 3I0AA 4RUNA 4QZUA 4XMFA 1GX8A 4UU3A 3KZAA 3SOTA 3WJCA 2WPUA 1T0VA 2MJIA 2Q4NA 5EPQA 3RDMA 5CHKA 4ORWA 1YIVA 4DQ4A 1U0XA 5BVTA 5FAZA 3HWEA 1XCAA 2WWPA 3BS2A 4ORXA 1WUBA 5JR8A 2RTNB 4JHQA 1I04A
chains in the Genus database with same CATH topology
1DF3A 1NGLA 1EIOA 3KFHA 3NX2A 3ELXA 4OMWA 4U8UN 3APVA 4KIIA 4N7CA 3STMX 4CSBA 4ZH9A 5BVSA 2OVDA 4NP1A 4YGZA 4YBPA 1SY1A 3FA8A 1X8PA 1P6PA 1E06A 1KT7A 1T8VA 1X8OA 1FE3A 4LKTA 4GRJA 1ZNEA 4QYPA 1QFVA 3H3IA 2AT3X 2Q2MA 1NP1A 1FEMA 1X71A 2OVEA 3D97A 3HWGA 4IMNA 4YGGA 2AKQA 5BYPA 1GKAB 5AQ6A 4O4SA 2JU8A 1YWAA 5D45A 4A1HA 4R0BA 5LJHA 1HBPA 3CWKA 5LJGA 4KC8A 4LKPA 1Y9LA 4GE1A 3HOEA 2K62A 1E00A 1OEJA 1OPBA 1T68X 5HZ5A 1KT6A 5CYBA 2HLVA 1IKEA 5B27A 1JJJA 4I3DA 1KOIA 1BLRA 3PQUA 2KW1A 1OBQA 2AT6X 4M6SA 3I17A 1I05A 1AELA 3BY0A 3WBGA 1MVGA 2A2UA 1VYGA 1X89A 1MDCA 3AKMA 2MM3A 4EQAC 2NNDA 4O9SA 1ICMA 1OBUA 3P6HA 1QY0A 1TW4A 5LKEA 2GTFX 4ODDA 1DFVA 4FBOA 5H9LA 4EDEA 4FGIB 5HTDA 4TJZA 4QZTA 2OVAA 4GETA 1HMRA 1SY3A 2HMBA 2HNXA 3UEVA 3U9PC 4CV7A 4YCEA 1MX7A 2WQ9A 1ZNGA 4ZJ0A 5LJKA 5KIDA 1BRQA 2Q9SA 4O4XA 2XSTA 3FA9A 2CZTA 5L8NA 2WSJA 4YDBA 3C78X 3WJDA 1AQBA 4AZQA 2N93A 3WXQA 5F58A 5H9KA 4INNA 4K19A 1JBHA 3F6ZB 3PEDA 2LKKA 4CK4A 2L68A 4PJ2A 3WVMA 3VG3A 1BRPA 2G78A 4FBVA 1ZNHA 5D48A 1G5WA 4D6BA 3JSQA 3DTQA 5KICA 4I9SA 3STNA 3ZI8A 2LA7A 2FRSA 1CBIA 2OFMX 3FR2A 1VPRA 1Y9TA 1O1UA 2XKLA 4OS8A 4GNWA 4YDAA 1D2UA 5L8IA 2JN3A 2L5PA 4AZRA 1CJ5A 4ES7A 4I3BA 1EW3A 5F6BA 1LF7A 2CM9A 1O1VA 3CR6A 3KQ0A 3ZWEA 2ANSA 4ID2A 1LIEA 4XMEA 4OS3A 4EEJA 3FLLA 3F9DA 1H91A 4DQ3A 1QY2A 2WUTA 1I06A 3ZW0A 1JYDA 2LB6A 3FIQA 3T1DA 1FELA 2Q2PA 3FW4A 1KQXA 3P6GA 1EUOA 3ZUOA 1O8VA 4QGXA 4A60A 4GDZA 5EDBA 2X46A 1UREA 4MVKA 5HA1A 1DC9A 1QABE 3HWDA 4HPDA 4TKHA 1E02A 1OEEA 3FW5A 2KT4B 5EEEA 4ZHGA 2E4JA 5AEOA 4O4OA 1AVGI 2FR3A 3GE2A 1A3YA 2JMBA 1A2DA 1IKJA 3APXA 4ML7B 5HTEA 5FFHA 2ZAIA 4YBUA 1SA8A 1GT4A 1X8UA 3CBCA 3HK1A 4WBKA 1PM1X 2LBAA 3JS1A 5IO5A 4MVLA 4TNNA 2ASNX 3ZW1A 2WQAE 1ERXA 3PPTA 1ML7A 1EI5A 3Q6LA 2LFOA 4NNTA 3UEWA 3VG4A 4ZGUA 3APWA 3VG7A 4L3RA 3U0DA 3KFFA 1R0UA 1ZNLA 2MHDA 3OD9A 4IAWA 1FENA 1QWDA 1DZKA 2GTLO 4I95A 2YG2A 1OEKA 4O4UA 3KFIA 4YFPA 5HA0A 3RWXA 1B8EA 1DZJA 5C0NA 5HZ6A 2PY1A 3TGBA 3C77X 2WEWA 1X8QA 2RQ0A 4GNYA 1EIIA 3VPJE 1PEEA 1KZWA 3WJGA 2CBSA 3WJEA 2RA6A 3FYFA 1ADLA 1UZ2X 1GXAA 4QGWA 1SXWA 4GKCA 4BQUA 2R73A 3BU1A 3P6DA 1KQWA 2ACOA 3PH6A 4O3YA 2LBVA 5LJEA 3BX8A 5LJCA 2KTSA 1DZMA 3VG6A 3WJFA 1EXSA 1X8NA 1TVQA 3B2IA 3NP1A 4XMHA 1YWCA 3WOVA 5DPQA 4AW8A 4M7MA 3QKGA 5HCDC 1IIUA 2RD7C 3PH5A 4ON1A 1KT3A 3MBTA 4ALOA 2GC9A 1VYFA 4O49A 1GKAA 3B2LA 1BSQA 3HOLA 5B29A 2ALLX 4BVMA 1TXLA 5EEDA 3B2KA 2GTLM 4GZVA 4ORRA 2M4LA 4IB9A 5BVQA 3RSWA 4Y0SA 5HCCC 1SXXA 4U3QA 4XMDA 3OBLA 4HWMA 2AH7X 2FS6A 2G79A 4KH8A 4QAEA 3S5VA 2W2AA 4YFRA 1S7DA 3BRNA 3IA8A 2CZUA 4ZGFA 2QMIA 1ICNA 1YWBA 3E3CA 3NQ9A 5EZ2A 3NPOA 3ELZA 3JQOA 3APUA 4ZHFA 3CMPA 4IB8A 1SY2A 1BSOA 5FQ8E 2FTBA 5H8TA 3GAQA 3B2HA 1GM6A 2MO5A 4Y0PA 1RLBE 3KFGA 4N7DA 4ZCBA 2AMMX 3MX7A 4I9RA 1KZXA 2W2FA 3VG2A 4ALBA 3O2YA 2QO4A 3FA7A 2HZRA 2JU3A 2W2BA 2L9CA 4I3CA 2A3FX 4IABA 4NLIA 1BBPA 1U18A 5LJBA 4ORYA 3LV4A 1KXOA 2X8TA 3FMZA 1A57A 2HYSA 3VG5A 1S2PA 5F7GA 4GK9A 1HQPA 2A0AA 2NNQA 3IFBA 5FENA 4BOEA 1LIBA 3ZUIA 1CBQA 2R56A 4OMXA 1FTPA 1A18A 1I4UA 1JYJA 1JIWI 1SMPI 1GT5A 3OE3A 4HFOA 4IB6A 3VE2A 4A1YA 3FEKA 1B0OA 3ZW2A 5K06A 1BEBA 1YUPA 1IFCA 4IB7A 2FWVA 3RBYA 4LZUA 2L67A 1L6MA 4WFUA 2QOSC 2RCTA 4XMGA 1LKEA 3FEPA 1HN2A 1TOWA 1GT1A 3HTYA 2QO5A 3VE1A 1B4MA 3F8AA 3TZSA 3PQSA 1LPJA 5AJCA 3FA6A 3PP6A 3ZQ3A 1LIDA 4AZOA 4NLJA 4OS0A 1HMSA 2IFBA 1CRBA 5AJBA 1LNMA 2NP1A 1HBQA 3TF6A 2O62A 1OBPA 4TKBA 3EYCA 4XMCA 1TOUA 3N91A 2R74A 1EPBA 1EPAA 1SXYA 4QYNA 2Q39A 3K3LA 3BDRA 3NQ3A 5H9AA 1MX8A 4PSQA 4QNIA 2BS5A 2F09A 5L8OA 2GTLN 4Y0QA 2BT9A 1NP4A 4WFVA 2ACPX 5HZ8A 1ZNDA 3PECA 4IMOA 3UAQA 3NBXX 1IW2A 3NQKA 2POAA 4U9CA 5HAEA 5LKFA 4ZFXA 2NNEA 4U8UO 1CBRA 3OJYC 1JZUA 4YH0A 1G7NA 2BS6A 1XKIA 4YGHA 3P6FA 1YWDA 4QQ1A 1BJ7A 4KT5A 3P02A 3DSZA 4ORUA 4ZR2A 3D96A 2KTDA 5HZ9A 1ZRYA 2QO6A 4UU2A 3CQNA 3P24A 1JV4A 2FR2A 2WEXA 4I6SA 4LQZA 4ARHA 1ACDA 3S26A 3BSZE 4QGVA 1QFTA 2X8SA 4HPCA 1GT3A 1LFOA 1EALA 3NX1A 4ORSA 4ZHDA 1IFBA 3EMMA 1S44A 1G85A 3D95A 2A13A 4HPAA 1QG5A 1BM5A 1BWYA 2CM4A 5HCEC 3AKNA 2G7BA 5D8JA 4MISA 2JU7A 2Z4HA 1JJXA 3FR4A 5D4AA 3V8UA 1ZNKA 2ZAGA 2KD2A 2WR6A 1YP6A 4MIRA 1SY0A 3U03A 4U8UM 3EBWA 1OPAA 5D47A 1PBOA 3C76X 4JGLA 1B56A 4HPBA 2YMSA 2RN4A 1PMPA 4MVEA 5FQ6E 3WJBA 3CBSA 3S5XA 4GU8A 1GX9A 2HZQA 4IAXA 1HMTA 3RZYA 3RKGA 2JW1A 3D4RA 4YKOA 1G74A 1KT4A 2OFRX 3HWFA 3VU1A 4D6AA 4Y0RA 4YKMA 2OZQA 3NADA 1DZPA 2BHVA 4MVIA 4NYQA 4AYHA 4TLJA 3CQRA 2FS7A 3P6EA 5FQ7E 4EXZA 3UEUA 1YP7A 2BLGA 4FQBB 4L1NA 4LZVA 2AL0X 3NR3A 3UEXA 5HBSA 4GH7A 2A2GA 3B2JA 4AZNA 3O22A 5IO6A 2DM5A 3FR5A 1U17A 1ERBA 4IBAA 3ZW0B 2F73A 2RCQA 5H9NA 3SAOA 4ZHHA 4NYRA 1D3SA 3EM0A 4RUUA 4ZHCA 4TKJA 3MVFA 4O3WA 1AB0A 2AT5X 4QRLA 5CE4A 5IO7A 3FENA 4KCAA 5HWZA 4AZPA 2AT8X 2MWHA 2OVSA 2K23A 1DV9A 5LJDA 1LIFA 4NNSA 3TGCA 5DG4A 2GJ5A 1BSYA 4WHIA 3EBKA 1N0SA 2EU7X 4COTA 1FDQA 2X8FA 2FT9A 5F1EA 1KT5A 4ZH6A 5EDCA 3STKA 4YFQA 4O3ZA 1QQSA 4FBRA 4TQ2A 1ALBA 1CBSA 1RBPA 2QM9A 5F6ZA 3ZZVA 1E5PA 1GGLA 3O19A 4O3XB 2JOZA 2CBRA 3BU9A 1SXUA 1Z24A 4NW4A 4YCHA 3ZW1B 5KHPA 3G7XA 3LHNA 3S60A 3TGAA 1QY1A 3P6CA 2FLJA 2P8GA 3FELA 2Z4IA 1KGLA 3BLGA 2X45A 1EQDA 4EFGA 2AT0X 3BX7A 3L4RA 4KC7A 5HZQA 1LICA 4AZMA 1MUPA 4A8ZA 4YMYA 3I0AA 4RUNA 4QZUA 4XMFA 1GX8A 4UU3A 3KZAA 3SOTA 3WJCA 1T0VA 2MJIA 2Q4NA 5EPQA 4ORWA 1YIVA 4DQ4A 1U0XA 5BVTA 5FAZA 3HWEA 1XCAA 2WWPA 3BS2A 4ORXA 5JR8A 1I04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF3 A;  1NGL A;  1EIO A;  3KFH A;  3NX2 A;  3ELX A;  4OMW A;  3APV A;  4KII A;  4N7C A;  3STM X;  4ZH9 A;  5BVS A;  2OVD A;  4NP1 A;  4YGZ A;  4YBP A;  1SY1 A;  3FA8 A;  1X8P A;  1P6P A;  1E06 A;  1KT7 A;  1T8V A;  1X8O A;  1FE3 A;  4LKT A;  4GRJ A;  1ZNE A;  4QYP A;  1QFV A;  2AT3 X;  2Q2M A;  1NP1 A;  1FEM A;  1X71 A;  2OVE A;  3D97 A;  3HWG A;  4IMN A;  4YGG A;  2AKQ A;  1GKA B;  5AQ6 A;  2JU8 A;  1YWA A;  5D45 A;  4A1H A;  4R0B A;  5LJH A;  1HBP A;  3CWK A;  5LJG A;  4LKP A;  4GE1 A;  2K62 A;  1E00 A;  1OEJ A;  1OPB A;  1T68 X;  5HZ5 A;  1KT6 A;  2HLV A;  1IKE A;  5B27 A;  1JJJ A;  4I3D A;  1KOI A;  1BLR A;  1OBQ A;  2AT6 X;  4M6S A;  3I17 A;  1I05 A;  1AEL A;  3BY0 A;  3WBG A;  1MVG A;  2A2U A;  1VYG A;  1X89 A;  1MDC A;  3AKM A;  2MM3 A;  2NND A;  4O9S A;  1ICM A;  1OBU A;  3P6H A;  1QY0 A;  1TW4 A;  5LKE A;  2GTF X;  4ODD A;  1DFV A;  5H9L A;  4EDE A;  5HTD A;  4TJZ A;  4QZT A;  2OVA A;  4GET A;  1HMR A;  1SY3 A;  2HMB A;  2HNX A;  3UEV A;  3U9P C;  4YCE A;  1MX7 A;  2WQ9 A;  1ZNG A;  4ZJ0 A;  5KID A;  1BRQ A;  2Q9S A;  2XST A;  3FA9 A;  2CZT A;  5L8N A;  2WSJ A;  4YDB A;  3C78 X;  3WJD A;  1AQB A;  4AZQ A;  2N93 A;  3WXQ A;  5F58 A;  5H9K A;  1JBH A;  4K19 A;  3PED A;  2LKK A;  4CK4 A;  2L68 A;  3WVM A;  3VG3 A;  1BRP A;  2G78 A;  1ZNH A;  5D48 A;  1G5W A;  4D6B A;  3JSQ A;  3DTQ A;  5KIC A;  4I9S A;  3STN A;  2FRS A;  1CBI A;  2OFM X;  3FR2 A;  1VPR A;  1O1U A;  2XKL A;  4OS8 A;  4GNW A;  4YDA A;  1D2U A;  5L8I A;  2JN3 A;  2L5P A;  4AZR A;  1CJ5 A;  4ES7 A;  4I3B A;  1EW3 A;  5F6B A;  1LF7 A;  2CM9 A;  1O1V A;  3CR6 A;  3KQ0 A;  2ANS A;  1LIE A;  4XME A;  4OS3 A;  4EEJ A;  3FLL A;  3F9D A;  1H91 A;  4DQ3 A;  1QY2 A;  2WUT A;  1I06 A;  1JYD A;  2LB6 A;  3FIQ A;  3T1D A;  1FEL A;  2Q2P A;  3FW4 A;  1KQX A;  3P6G A;  1EUO A;  3ZUO A;  1O8V A;  4QGX A;  4A60 A;  5EDB A;  2X46 A;  1URE A;  4MVK A;  5HA1 A;  1DC9 A;  1QAB E;  3HWD A;  4HPD A;  4TKH A;  1E02 A;  1OEE A;  3FW5 A;  2KT4 B;  5EEE A;  4ZHG A;  2E4J A;  1AVG I;  2FR3 A;  1A3Y A;  3APX A;  1A2D A;  1IKJ A;  5HTE A;  5FFH A;  4YBU A;  1SA8 A;  1GT4 A;  1X8U A;  3CBC A;  3HK1 A;  4WBK A;  1PM1 X;  2LBA A;  3JS1 A;  5IO5 A;  4MVL A;  4TNN A;  2ASN X;  2WQA E;  1ERX A;  3PPT A;  1ML7 A;  5LJK A;  3Q6L A;  2LFO A;  4NNT A;  3UEW A;  3VG4 A;  4ZGU A;  3APW A;  3VG7 A;  3U0D A;  3KFF A;  1R0U A;  1ZNL A;  4IAW A;  1FEN A;  1QWD A;  1DZK A;  2YG2 A;  1OEK A;  3KFI A;  4YFP A;  5HA0 A;  5C0N A;  1B8E A;  1DZJ A;  3TGB A;  5HZ6 A;  2PY1 A;  3C77 X;  2WEW A;  1X8Q A;  2RQ0 A;  4GNY A;  1EII A;  1PEE A;  1KZW A;  3WJG A;  2CBS A;  3WJE A;  2RA6 A;  4QGW A;  1ADL A;  1UZ2 X;  1GXA A;  1SXW A;  4GKC A;  4BQU A;  2R73 A;  3BU1 A;  3P6D A;  1KQW A;  2ACO A;  3PH6 A;  2LBV A;  5LJE A;  5LJC A;  3BX8 A;  1DZM A;  3VG6 A;  3WJF A;  1EXS A;  1X8N A;  1TVQ A;  3B2I A;  3NP1 A;  4XMH A;  1YWC A;  5DPQ A;  4AW8 A;  4M7M A;  3QKG A;  5HCD C;  1IIU A;  2RD7 C;  3PH5 A;  1KT3 A;  3MBT A;  4ALO A;  2GC9 A;  1VYF A;  1GKA A;  3B2L A;  1BSQ A;  5B29 A;  2ALL X;  4BVM A;  1TXL A;  5EED A;  3B2K A;  4ORR A;  4IB9 A;  5BVQ A;  3RSW A;  4Y0S A;  5HCC C;  1SXX A;  4XMD A;  2AH7 X;  2FS6 A;  2G79 A;  4QAE A;  4YFR A;  2W2A A;  1S7D A;  3BRN A;  3IA8 A;  2CZU A;  1ICN A;  1YWB A;  3NQ9 A;  5EZ2 A;  3NPO A;  3ELZ A;  4ZHF A;  3APU A;  3CMP A;  4IB8 A;  1SY2 A;  1BSO A;  2FTB A;  5H8T A;  3GAQ A;  3B2H A;  1GM6 A;  2MO5 A;  4Y0P A;  1RLB E;  3KFG A;  4N7D A;  4ZCB A;  2AMM X;  4I9R A;  1KZX A;  2W2F A;  3VG2 A;  4ALB A;  3O2Y A;  2QO4 A;  3FA7 A;  2HZR A;  2JU3 A;  2W2B A;  2L9C A;  4I3C A;  2A3F X;  4NLI A;  1BBP A;  1U18 A;  5LJB A;  4ORY A;  1KXO A;  3FMZ A;  1A57 A;  2HYS A;  3VG5 A;  1S2P A;  5F7G A;  1HQP A;  2A0A A;  2NNQ A;  3IFB A;  5FEN A;  4BOE A;  1LIB A;  3ZUI A;  1CBQ A;  2R56 A;  4OMX A;  1FTP A;  1A18 A;  1I4U A;  1JYJ A;  4HFO A;  4IB6 A;  1GT5 A;  4A1Y A;  3FEK A;  1B0O A;  5K06 A;  1BEB A;  1YUP A;  1IFC A;  4IB7 A;  2FWV A;  4LZU A;  2L67 A;  1L6M A;  4WFU A;  2QOS C;  2RCT A;  4XMG A;  1LKE A;  3FEP A;  1HN2 A;  1TOW A;  1GT1 A;  2QO5 A;  1B4M A;  3F8A A;  3TZS A;  1LPJ A;  3FA6 A;  3PP6 A;  3ZQ3 A;  1LID A;  4AZO A;  4NLJ A;  4OS0 A;  1HMS A;  2IFB A;  1CRB A;  1LNM A;  2NP1 A;  1HBQ A;  3TF6 A;  2O62 A;  1OBP A;  4TKB A;  3EYC A;  4XMC A;  1TOU A;  2R74 A;  1EPB A;  1EPA A;  1SXY A;  4QYN A;  2Q39 A;  3K3L A;  3BDR A;  3NQ3 A;  5H9A A;  1MX8 A;  4PSQ A;  5L8O A;  4Y0Q A;  4WFV A;  1NP4 A;  2ACP X;  5HZ8 A;  1ZND A;  3PEC A;  4IMO A;  1IW2 A;  2POA A;  5HAE A;  5LKF A;  4ZFX A;  2NNE A;  1CBR A;  3OJY C;  1JZU A;  4YH0 A;  1G7N A;  1XKI A;  4YGH A;  3P6F A;  1YWD A;  1BJ7 A;  3DSZ A;  4ORU A;  4ZR2 A;  3D96 A;  2KTD A;  5HZ9 A;  1ZRY A;  2QO6 A;  4UU2 A;  3CQN A;  1JV4 A;  2FR2 A;  2WEX A;  4ARH A;  1ACD A;  3S26 A;  3BSZ E;  4QGV A;  1QFT A;  4HPC A;  1GT3 A;  1LFO A;  1EAL A;  3NX1 A;  4ORS A;  4ZHD A;  1IFB A;  3EMM A;  1S44 A;  1G85 A;  3D95 A;  2A13 A;  4HPA A;  1QG5 A;  1BM5 A;  1BWY A;  2CM4 A;  5HCE C;  3AKN A;  2G7B A;  5D8J A;  2JU7 A;  1JJX A;  3FR4 A;  5D4A A;  1ZNK A;  2WR6 A;  1YP6 A;  1SY0 A;  3U03 A;  3EBW A;  1OPA A;  5D47 A;  1PBO A;  3C76 X;  1B56 A;  4HPB A;  1PMP A;  3WJB A;  3CBS A;  1GX9 A;  2HZQ A;  4IAX A;  1HMT A;  3RZY A;  4YKO A;  1G74 A;  1KT4 A;  2OFR X;  3HWF A;  4D6A A;  4Y0R A;  4YKM A;  2OZQ A;  3NAD A;  1DZP A;  4MVI A;  4NYQ A;  4AYH A;  4TLJ A;  3CQR A;  2FS7 A;  3P6E A;  4EXZ A;  3UEU A;  1YP7 A;  2BLG A;  4LZV A;  3UEX A;  2AL0 X;  3NR3 A;  5HBS A;  4GH7 A;  2A2G A;  3B2J A;  4AZN A;  3O22 A;  5IO6 A;  2DM5 A;  3FR5 A;  1U17 A;  1ERB A;  4IBA A;  2F73 A;  2RCQ A;  5H9N A;  3SAO A;  4ZHH A;  4NYR A;  1D3S A;  3EM0 A;  4RUU A;  4ZHC A;  4TKJ A;  3MVF A;  1AB0 A;  2AT5 X;  5CE4 A;  5IO7 A;  3FEN A;  5HWZ A;  4AZP A;  2AT8 X;  1DV9 A;  2K23 A;  5LJD A;  1LIF A;  4NNS A;  3TGC A;  5DG4 A;  2GJ5 A;  1BSY A;  3EBK A;  1N0S A;  2EU7 X;  1FDQ A;  2FT9 A;  5F1E A;  1KT5 A;  4ZH6 A;  5EDC A;  3STK A;  4YFQ A;  4TQ2 A;  1QQS A;  1ALB A;  1CBS A;  1RBP A;  2QM9 A;  5F6Z A;  1E5P A;  1GGL A;  3O19 A;  2JOZ A;  2CBR A;  3BU9 A;  1SXU A;  1Z24 A;  4YCH A;  5KHP A;  3G7X A;  3TGA A;  1QY1 A;  3P6C A;  2FLJ A;  2P8G A;  3FEL A;  1KGL A;  3BLG A;  2X45 A;  1EQD A;  4EFG A;  2AT0 X;  3BX7 A;  3L4R A;  5HZQ A;  1LIC A;  4AZM A;  1MUP A;  4A8Z A;  4YMY A;  3I0A A;  4RUN A;  4QZU A;  4XMF A;  1GX8 A;  4UU3 A;  3KZA A;  3WJC A;  1T0V A;  2MJI A;  2Q4N A;  5EPQ A;  4ORW A;  1YIV A;  4DQ4 A;  1U0X A;  5BVT A;  5FAZ A;  3HWE A;  1XCA A;  2WWP A;  3BS2 A;  4ORX A;  5JR8 A;  1I04 A; 
#chains in the Genus database with same CATH topology
 1DF3 A;  1PTS A;  1NGL A;  1EIO A;  3KFH A;  3NX2 A;  2RTG B;  3ELX A;  4OMW A;  3APV A;  4KII A;  4N7C A;  4U8U N;  3STM X;  4CSB A;  4ZH9 A;  5BVS A;  2OVD A;  4NP1 A;  4YGZ A;  4YBP A;  1SY1 A;  3FA8 A;  1X8P A;  1P6P A;  1E06 A;  1SWT A;  1KT7 A;  1T8V A;  2OF9 A;  1X8O A;  1FE3 A;  2G8C O;  4LKT A;  4GRJ A;  4O3X B;  1ZNE A;  4GUZ A;  4QYP A;  1QFV A;  3H3I A;  1SRE A;  2AT3 X;  2Q2M A;  1NP1 A;  1HXZ A;  1FEM A;  1X71 A;  2OVE A;  3D97 A;  3HWG A;  4IMN A;  4YGG A;  2AKQ A;  1K24 A;  5BYP A;  1LDQ A;  1GKA B;  5AQ6 A;  4O4S A;  2FHL A;  1YWA A;  2JU8 A;  5D45 A;  4R0B A;  3FDC A;  4A1H A;  1HBP A;  3CWK A;  5LJG A;  4KC8 A;  3EW1 A;  4LKP A;  1Y9L A;  3FID A;  4GE1 A;  3CKF A;  1VWR B;  2IZK A;  3HOE A;  2K62 A;  1E00 A;  1OEJ A;  1OPB A;  1T68 X;  5HZ5 A;  1KT6 A;  5CYB A;  2HLV A;  1IKE A;  5B27 A;  1JJJ A;  4I3D A;  1KOI A;  4CDD A;  1SRI A;  1BLR A;  3PQU A;  2KW1 A;  1OBQ A;  2AT6 X;  4M6S A;  3I17 A;  1VWN B;  1I05 A;  1AEL A;  3BY0 A;  3WBG A;  1MM9 A;  1MVG A;  2A2U A;  1VYG A;  1X89 A;  1MDC A;  3AKM A;  2MM3 A;  4EQA C;  2NND A;  4O9S A;  1VWJ B;  1ICM A;  1OBU A;  4Z27 A;  3P6H A;  1QY0 A;  1TW4 A;  1SWK A;  4DCB A;  5B2A O;  4CDE A;  4MEE A;  1SLG B;  5IRU A;  5LKE A;  1HXL A;  2GTF X;  4ODD A;  1DFV A;  4FBO A;  1JQP A;  5H9L A;  4EDE A;  4FGI B;  5HTD A;  4TJZ A;  4QZT A;  1SWQ A;  2PI3 O;  3KVN A;  2OVA A;  1N9Y A;  4OEL A;  4GET A;  1HMR A;  1SY3 A;  2HMB A;  2HNX A;  3UEV A;  3U9P C;  4CV7 A;  4YCE A;  1MX7 A;  2RTO B;  2WQ9 A;  3RDU A;  1ZNG A;  3MG5 A;  1K3B A;  4ZJ0 A;  5LJK A;  5KID A;  1BRQ A;  2Q9S A;  1NDJ A;  4O4X A;  2XST A;  3FA9 A;  2CZT A;  5L8N A;  2WSJ A;  3QQ2 A;  3C78 X;  4YDB A;  3VHI A;  3WJD A;  1AQB A;  4AZQ A;  2N93 A;  3WXQ A;  1Y0G A;  5F58 A;  5H9K A;  4INN A;  4K19 A;  1JBH A;  3F6Z B;  1I78 A;  1VWL B;  2LKK A;  3PED A;  4GD9 A;  1WBI A;  2L68 A;  4CK4 A;  4PJ2 A;  5K68 A;  3WVM A;  3VG3 A;  1BRP A;  2G78 A;  4FBV A;  1ZNH A;  4Z28 A;  5D48 A;  1G5W A;  2IZG B;  3CKG A;  4D6B A;  2RTH B;  3JSQ A;  3DTQ A;  1SWG A;  5KIC A;  4I9S A;  1JJU A;  3STN A;  3ZI8 A;  2MF6 A;  2LA7 A;  2FRS A;  5K67 A;  1CBI A;  2C4I A;  2OFM X;  3FR2 A;  1VPR A;  4GGT A;  3T6L A;  1N43 A;  1Y9T A;  2DJF A;  1O1U A;  2XKL A;  4OS8 A;  2X4M A;  4GNW A;  4YDA A;  1D2U A;  5L8I A;  2JN3 A;  2L5P A;  4AZR A;  4Z2O A;  2OY5 O;  1CJ5 A;  4ES7 A;  2OL8 O;  4I3B A;  1EW3 A;  2C1Q A;  5F6B A;  1LF7 A;  2CM9 A;  1O1V A;  3CR6 A;  3EC5 A;  3KQ0 A;  2ANS A;  5JD2 A;  4ID2 A;  1LIE A;  1MK5 A;  3VHH A;  4XME A;  4OS3 A;  4EEJ A;  3FLL A;  1VWH B;  3F9D A;  1H91 A;  4DQ3 A;  1QY2 A;  2WUT A;  1I06 A;  3ZW0 A;  1JYD A;  2F01 A;  2LB6 A;  3FIQ A;  1SLF B;  2QOM A;  2RTK A;  3T1D A;  1FEL A;  1KL3 A;  2Q2P A;  3FW4 A;  1KQX A;  3P6G A;  1EUO A;  3ZUO A;  1O8V A;  4QGX A;  4A60 A;  4GDZ A;  5EDB A;  2X46 A;  1URE A;  4MVK A;  5HA1 A;  1DC9 A;  1QAB E;  1VWI B;  3HWD A;  4HPD A;  4TKH A;  1E02 A;  1OEE A;  1RXK A;  3FW5 A;  2KT4 B;  2VFC A;  5EEE A;  3RDX A;  4CPF A;  4ZHG A;  2E4J A;  5AEO A;  4O4O A;  1AVG I;  2FR3 A;  1SRF A;  3GE2 A;  1A3Y A;  3VHM A;  2JMB A;  1A2D A;  1IKJ A;  2Y3E A;  3APX A;  5IRA A;  3WYP A;  2A5C A;  4ML7 B;  4CDF A;  5B5G A;  5HTE A;  5FFH A;  2ZAI A;  4YBU A;  3VGW A;  1SA8 A;  1GT4 A;  1X8U A;  3CBC A;  3HK1 A;  4WBK A;  1PM1 X;  2LBA A;  3JS1 A;  5IO5 A;  4MVL A;  4TNN A;  2ASN X;  3ZW1 A;  2IZE B;  1ERX A;  2WQA E;  1ML7 A;  1EI5 A;  3PPT A;  2LFO A;  3Q6L A;  4GJS A;  4NNT A;  3RE6 A;  3UEW A;  3VG4 A;  4ZGU A;  1RAV A;  3APW A;  2IZL B;  3VG7 A;  1SWN A;  4L3R A;  3U0D A;  3KFF A;  1R0U A;  3RY2 A;  1ZNL A;  2MHD A;  3OD9 A;  4IAW A;  1FEN A;  3WZO A;  1QWD A;  1VWD B;  1DZK A;  1N7Y A;  1Y53 X;  2GTL O;  4I95 A;  2YG2 A;  1OEK A;  2HKD A;  4O4U A;  3KFI A;  4YFP A;  5HA0 A;  3RWX A;  1B8E A;  1DZJ A;  2RTB B;  5C0N A;  2PY1 A;  5HZ6 A;  3C77 X;  2WEW A;  3TGB A;  1X8Q A;  4DNE A;  2RQ0 A;  4GNY A;  1EII A;  3VPJ E;  1PEE A;  1KZW A;  3WJG A;  2CBS A;  3WJE A;  2RA6 A;  3FYF A;  1ADL A;  1UZ2 X;  1GXA A;  4GGZ A;  4QGW A;  1SXW A;  4GKC A;  4BQU A;  2R73 A;  3BU1 A;  5KHP A;  2RTL A;  1KQW A;  2ACO A;  3P6D A;  3PH6 A;  1SWF A;  4O3Y A;  3BX8 A;  2LBV A;  2KTS A;  5LJE A;  5LJC A;  1DZM A;  3VG6 A;  3WJF A;  1EXS A;  1X8N A;  1TVQ A;  3B2I A;  3NP1 A;  4XMH A;  1YWC A;  3WOV A;  1SLD B;  5DPQ A;  4AW8 A;  4JO6 A;  4M7M A;  3QKG A;  5HCD C;  2OYB O;  1IIU A;  2RD7 C;  3PH5 A;  2OF8 A;  1KT3 A;  3MBT A;  4ON1 A;  4ALO A;  2GC9 A;  1VYF A;  4O49 A;  1GKA A;  3B2L A;  1STP A;  1BSQ A;  1VWG B;  3HOL A;  4OKA A;  2ALL X;  4Y59 A;  2UZ2 A;  4BVM A;  4Z2P A;  5B29 A;  1TXL A;  2JGS A;  5EED A;  3B2K A;  1AVD A;  2GTL M;  4GZV A;  4ORR A;  4Z6J A;  2A8G A;  2RTC B;  1VWP B;  2M4L A;  4IB9 A;  5BVQ A;  4Y0S A;  3RDS A;  3RSW A;  1VWK B;  5HCC C;  1SXX A;  1SWL A;  4GGR A;  4U3Q A;  4XMD A;  3SLJ A;  3WZP A;  3OBL A;  4HWM A;  2AH7 X;  2FS6 A;  2G79 A;  4KH8 A;  4QAE A;  2RTE B;  1DF8 A;  3S5V A;  2W2A A;  4YFR A;  1S7D A;  3BRN A;  3IA8 A;  2CZU A;  4ZGF A;  5IRW A;  2QMI A;  1ICN A;  1YWB A;  3E3C A;  1W6F A;  2C1S A;  3NQ9 A;  3NPO A;  3ELZ A;  3JQO A;  3APU A;  3PK2 A;  5EZ2 A;  1SWU A;  3CMP A;  4IB8 A;  1SY2 A;  4NV7 A;  1BSO A;  5FQ8 E;  2FTB A;  5H8T A;  3GAQ A;  3B2H A;  1GM6 A;  2MO5 A;  4Y0P A;  1RLB E;  3KFG A;  4N7D A;  4GJV A;  4ZCB A;  2AMM X;  5CSE A;  3MX7 A;  4I9R A;  1KZX A;  2W2F A;  3VG2 A;  4ALB A;  3O2Y A;  2QO4 A;  1NC9 A;  3FA7 A;  2HZR A;  2JU3 A;  2W2B A;  2L9C A;  4I3C A;  2A3F X;  2IZJ A;  4IAB A;  4NLI A;  1BBP A;  1U18 A;  5LJB A;  4ORY A;  1MEP A;  3LV4 A;  1E2T A;  1KXO A;  2X8T A;  2A5B A;  4CDC A;  3FMZ A;  4JNJ A;  1A57 A;  2HYS A;  3VG5 A;  1S2P A;  5F7G A;  3T6F A;  4GK9 A;  1N4J A;  1HQP A;  4BGF A;  1LCZ A;  2A0A A;  2NNQ A;  3IFB A;  4I60 A;  5FEN A;  1PBY A;  1LIB A;  4BOE A;  3ZUI A;  1CBQ A;  3EW2 A;  3RDO A;  2R56 A;  4OMX A;  4CPI A;  3LTW A;  1MOY A;  1FTP A;  1VWM B;  1A18 A;  1I4U A;  1JYJ A;  1JIW I;  1SMP I;  1GT5 A;  1VWE B;  3OE3 A;  4HFO A;  4IB6 A;  4Y5D A;  3VE2 A;  4A1Y A;  5B5F A;  1NQN A;  2G5L A;  2I5Z O;  1B0O A;  2OFA A;  3FEK A;  3ZW2 A;  4CPH B;  1UYO X;  1BEB A;  5K06 A;  1YUP A;  2AF5 A;  1IFC A;  2GH7 A;  2I5V O;  4IB7 A;  2FWV A;  2VDF A;  1SWR A;  3RBY A;  4LZU A;  2L67 A;  1L6M A;  2FHN X;  4WFU A;  2QOS C;  2RCT A;  4XMG A;  1SWB A;  1HQQ A;  1LKE A;  3FEP A;  1HN2 A;  3ZW1 B;  1TOW A;  1GT1 A;  2FGS A;  3HTY A;  2QO5 A;  3VE1 A;  1B4M A;  3F8A A;  3TZS A;  4U46 A;  3PQS A;  1LPJ A;  1JMX A;  5AJC A;  1VWO B;  3FA6 A;  3PP6 A;  1LID A;  2UYW A;  3ZQ3 A;  4NLJ A;  4AZO A;  4BX6 B;  4OS0 A;  4YVB A;  1HMS A;  2IFB A;  1CRB A;  5AJB A;  4BBO A;  1LNM A;  2NP1 A;  1HBQ A;  3TF6 A;  1RXJ A;  1OBP A;  2O62 A;  3EYC A;  2X55 A;  4TKB A;  4XMC A;  1I9H A;  1TOU A;  2Y32 A;  2R74 A;  1EPB A;  3N91 A;  4EKV A;  1EPA A;  1SXY A;  1AVE A;  2ZSC A;  2Q39 A;  3K3L A;  3BDR A;  3NQ3 A;  2X32 A;  4QYN A;  5H9A A;  1MX8 A;  4PSQ A;  4QNI A;  2BS5 A;  2BSZ A;  2F09 A;  5L8O A;  2GTL N;  4Y0Q A;  2BT9 A;  1NP4 A;  2IZA A;  4WFV A;  1NBX A;  1VWC B;  2ACP X;  1ZND A;  2RTF B;  5HZ8 A;  2X34 A;  3PEC A;  1OSP O;  1SRJ A;  4IMO A;  3NBX X;  3UAQ A;  1IW2 A;  3NQK A;  2POA A;  4U9C A;  5HAE A;  1SWA A;  5LKF A;  5B3M O;  4ZFX A;  2OFB A;  2NNE A;  4U8U O;  1CBR A;  2RTD B;  3OJY C;  4BX6 A;  1JZU A;  4YH0 A;  1G7N A;  2BS6 A;  1STS B;  1XKI A;  2IZC B;  1YWD A;  3P6F A;  4QQ1 A;  4YGH A;  1VWB B;  5L3Y A;  3ZWE A;  2RTP B;  1NQM A;  1BJ7 A;  4KT5 A;  3P02 A;  3DSZ A;  5LJH A;  4ORU A;  1W5R A;  4ZR2 A;  3D96 A;  3AUM O;  4OEM A;  4BCS A;  2KTD A;  5HZ9 A;  1ZRY A;  2QO6 A;  4UU2 A;  3CQN A;  3P24 A;  1RST B;  3SLO A;  1JV4 A;  2FR2 A;  2WEX A;  4I6S A;  4LQZ A;  4ARH A;  1ACD A;  3S26 A;  3BSZ E;  4QGV A;  1SLE B;  3X00 A;  1LEL A;  1QFT A;  2X8S A;  1GT3 A;  1LFO A;  4HPC A;  4NV8 A;  1EAL A;  2DJG A;  3WZN A;  3NX1 A;  2IZI A;  4ORS A;  1N9M A;  4ZHD A;  1IFB A;  3EMM A;  1S44 A;  1G85 A;  3D95 A;  2A13 A;  3RDQ A;  3Q34 A;  5B11 O;  4HPA A;  1QG5 A;  3WYQ A;  1BM5 A;  1BWY A;  1SWE A;  2CM4 A;  5HCE C;  3AKN A;  2OY7 A;  1LCW A;  2G7B A;  4BX7 B;  5D8J A;  2IZB A;  4MIS A;  2JU7 A;  2OL6 O;  2Z4H A;  3FR4 A;  3WZQ A;  1JJX A;  5D4A A;  3V8U A;  1ZNK A;  3T2W A;  2ZAG A;  2KD2 A;  1RXH A;  1YP6 A;  2WR6 A;  4MIR A;  1LUQ A;  1SY0 A;  3U03 A;  4U8U M;  3T2X A;  3EBW A;  4B55 A;  1RSU B;  1OPA A;  1Y55 X;  5D47 A;  1PBO A;  4BX5 B;  3SZI A;  3C76 X;  4JGL A;  4CPE A;  1GX3 A;  1JMZ A;  1B56 A;  4HPB A;  4CPH A;  2YMS A;  2RN4 A;  1PMP A;  3PDF A;  4MVE A;  1IJ8 A;  5FQ6 E;  3CBS A;  3WJB A;  2IZF B;  3S5X A;  4GU8 A;  1GX9 A;  1LDO A;  2RTQ B;  2HZQ A;  3MM0 A;  4IAX A;  3RE5 A;  1HMT A;  1SWP A;  3RKG A;  3RZY A;  2JW1 A;  1SRH A;  3D4R A;  4YKO A;  1G74 A;  1KT4 A;  2OFR X;  2OY8 A;  4BX7 A;  3HWF A;  3VU1 A;  4D6A A;  1FJ1 E;  2QCB A;  4Y0R A;  4YKM A;  2CAM A;  2OZQ A;  3NAD A;  1DZP A;  2BHV A;  3D9W A;  4MVI A;  4NYQ A;  4TLJ A;  3CQR A;  2FS7 A;  1STR B;  3P6E A;  5FQ7 E;  4AYH A;  2RTJ A;  4EXZ A;  3UEU A;  1YP7 A;  2BLG A;  4FQB B;  4L1N A;  4LZV A;  2AL0 X;  3NR3 A;  3UEX A;  5HBS A;  4GH7 A;  2A2G A;  3B2J A;  4AZN A;  2OY1 O;  3O22 A;  4BX5 A;  5IO6 A;  3AEH A;  2DM5 A;  3FR5 A;  2RTA A;  1KL5 A;  4Z2V A;  1VWF B;  1U17 A;  1VWQ B;  1ERB A;  1SWH A;  1SWO A;  4IBA A;  3ZW0 B;  2F73 A;  2RCQ A;  5H9N A;  3SAO A;  1DV9 A;  4ZHH A;  4NYR A;  1D3S A;  3EM0 A;  4RUU A;  4ZHC A;  4TKJ A;  3MVF A;  3RY1 A;  4O3W A;  1AB0 A;  2AT5 X;  4QRL A;  5CE4 A;  2Y3F A;  5IO7 A;  3FEN A;  4KCA A;  2IZD B;  5IXG A;  5HWZ A;  4AZP A;  3SZJ A;  2AT8 X;  2MWH A;  2OVS A;  2K23 A;  2X56 A;  5LJD A;  1LIF A;  4NNS A;  4ZHF A;  5DG4 A;  3TGC A;  1KFF A;  2GJ5 A;  1SWS A;  1BSY A;  4WHI A;  4C5P A;  3EBK A;  2FKJ A;  1N0S A;  2EU7 X;  4COT A;  1FDQ A;  2X8F A;  1LCV A;  2FT9 A;  3SLT A;  2BC3 A;  5F1E A;  1KT5 A;  2RTI B;  4ZH6 A;  1Y52 X;  5EDC A;  2VFB A;  4YFQ A;  3STK A;  4O3Z A;  1QQS A;  2RTR B;  4FBR A;  4TQ2 A;  1ALB A;  1CBS A;  1RBP A;  2QM9 A;  4IRW A;  5B10 O;  4BJ8 A;  5F6Z A;  1SWD A;  1E5P A;  1GGL A;  1W4T A;  1HY2 A;  1SWJ A;  2JOZ A;  2CBR A;  3BU9 A;  1SXU A;  1Z24 A;  3O19 A;  4GDA A;  4NW4 A;  3HPE A;  3G7X A;  3LHN A;  4YCH A;  3S60 A;  3TGA A;  1QY1 A;  3P6C A;  2IZH B;  1SRG A;  2FLJ A;  2P8G A;  3SZH A;  2RTM A;  1VYO A;  3FEL A;  2Z4I A;  1KGL A;  3BLG A;  2X45 A;  3ZZV A;  1EQD A;  5F2B A;  1UYN X;  4EFG A;  2AT0 X;  3BX7 A;  2OL7 A;  3L4R A;  1VWA B;  4KC7 A;  5HZQ A;  1SWC A;  1LIC A;  4AZM A;  1MUP A;  2AVI A;  2FKG A;  4A8Z A;  4YMY A;  1KL4 A;  3I0A A;  4RUN A;  4QZU A;  4XMF A;  1GX8 A;  4UU3 A;  3KZA A;  3SOT A;  3WJC A;  2WPU A;  1T0V A;  2MJI A;  2Q4N A;  5EPQ A;  3RDM A;  5CHK A;  4ORW A;  1YIV A;  4DQ4 A;  1U0X A;  5BVT A;  5FAZ A;  3HWE A;  1XCA A;  2WWP A;  3BS2 A;  4ORX A;  1WUB A;  5JR8 A;  2RTN B;  4JHQ A;  1I04 A; 
#chains in the Genus database with same CATH homology
 1DF3 A;  1NGL A;  1EIO A;  3KFH A;  3NX2 A;  3ELX A;  4OMW A;  4U8U N;  3APV A;  4KII A;  4N7C A;  3STM X;  4CSB A;  4ZH9 A;  5BVS A;  2OVD A;  4NP1 A;  4YGZ A;  4YBP A;  1SY1 A;  3FA8 A;  1X8P A;  1P6P A;  1E06 A;  1KT7 A;  1T8V A;  1X8O A;  1FE3 A;  4LKT A;  4GRJ A;  1ZNE A;  4QYP A;  1QFV A;  3H3I A;  2AT3 X;  2Q2M A;  1NP1 A;  1FEM A;  1X71 A;  2OVE A;  3D97 A;  3HWG A;  4IMN A;  4YGG A;  2AKQ A;  5BYP A;  1GKA B;  5AQ6 A;  4O4S A;  2JU8 A;  1YWA A;  5D45 A;  4A1H A;  4R0B A;  5LJH A;  1HBP A;  3CWK A;  5LJG A;  4KC8 A;  4LKP A;  1Y9L A;  4GE1 A;  3HOE A;  2K62 A;  1E00 A;  1OEJ A;  1OPB A;  1T68 X;  5HZ5 A;  1KT6 A;  5CYB A;  2HLV A;  1IKE A;  5B27 A;  1JJJ A;  4I3D A;  1KOI A;  1BLR A;  3PQU A;  2KW1 A;  1OBQ A;  2AT6 X;  4M6S A;  3I17 A;  1I05 A;  1AEL A;  3BY0 A;  3WBG A;  1MVG A;  2A2U A;  1VYG A;  1X89 A;  1MDC A;  3AKM A;  2MM3 A;  4EQA C;  2NND A;  4O9S A;  1ICM A;  1OBU A;  3P6H A;  1QY0 A;  1TW4 A;  5LKE A;  2GTF X;  4ODD A;  1DFV A;  4FBO A;  5H9L A;  4EDE A;  4FGI B;  5HTD A;  4TJZ A;  4QZT A;  2OVA A;  4GET A;  1HMR A;  1SY3 A;  2HMB A;  2HNX A;  3UEV A;  3U9P C;  4CV7 A;  4YCE A;  1MX7 A;  2WQ9 A;  1ZNG A;  4ZJ0 A;  5LJK A;  5KID A;  1BRQ A;  2Q9S A;  4O4X A;  2XST A;  3FA9 A;  2CZT A;  5L8N A;  2WSJ A;  4YDB A;  3C78 X;  3WJD A;  1AQB A;  4AZQ A;  2N93 A;  3WXQ A;  5F58 A;  5H9K A;  4INN A;  4K19 A;  1JBH A;  3F6Z B;  3PED A;  2LKK A;  4CK4 A;  2L68 A;  4PJ2 A;  3WVM A;  3VG3 A;  1BRP A;  2G78 A;  4FBV A;  1ZNH A;  5D48 A;  1G5W A;  4D6B A;  3JSQ A;  3DTQ A;  5KIC A;  4I9S A;  3STN A;  3ZI8 A;  2LA7 A;  2FRS A;  1CBI A;  2OFM X;  3FR2 A;  1VPR A;  1Y9T A;  1O1U A;  2XKL A;  4OS8 A;  4GNW A;  4YDA A;  1D2U A;  5L8I A;  2JN3 A;  2L5P A;  4AZR A;  1CJ5 A;  4ES7 A;  4I3B A;  1EW3 A;  5F6B A;  1LF7 A;  2CM9 A;  1O1V A;  3CR6 A;  3KQ0 A;  3ZWE A;  2ANS A;  4ID2 A;  1LIE A;  4XME A;  4OS3 A;  4EEJ A;  3FLL A;  3F9D A;  1H91 A;  4DQ3 A;  1QY2 A;  2WUT A;  1I06 A;  3ZW0 A;  1JYD A;  2LB6 A;  3FIQ A;  3T1D A;  1FEL A;  2Q2P A;  3FW4 A;  1KQX A;  3P6G A;  1EUO A;  3ZUO A;  1O8V A;  4QGX A;  4A60 A;  4GDZ A;  5EDB A;  2X46 A;  1URE A;  4MVK A;  5HA1 A;  1DC9 A;  1QAB E;  3HWD A;  4HPD A;  4TKH A;  1E02 A;  1OEE A;  3FW5 A;  2KT4 B;  5EEE A;  4ZHG A;  2E4J A;  5AEO A;  4O4O A;  1AVG I;  2FR3 A;  3GE2 A;  1A3Y A;  2JMB A;  1A2D A;  1IKJ A;  3APX A;  4ML7 B;  5HTE A;  5FFH A;  2ZAI A;  4YBU A;  1SA8 A;  1GT4 A;  1X8U A;  3CBC A;  3HK1 A;  4WBK A;  1PM1 X;  2LBA A;  3JS1 A;  5IO5 A;  4MVL A;  4TNN A;  2ASN X;  3ZW1 A;  2WQA E;  1ERX A;  3PPT A;  1ML7 A;  1EI5 A;  3Q6L A;  2LFO A;  4NNT A;  3UEW A;  3VG4 A;  4ZGU A;  3APW A;  3VG7 A;  4L3R A;  3U0D A;  3KFF A;  1R0U A;  1ZNL A;  2MHD A;  3OD9 A;  4IAW A;  1FEN A;  1QWD A;  1DZK A;  2GTL O;  4I95 A;  2YG2 A;  1OEK A;  4O4U A;  3KFI A;  4YFP A;  5HA0 A;  3RWX A;  1B8E A;  1DZJ A;  5C0N A;  5HZ6 A;  2PY1 A;  3TGB A;  3C77 X;  2WEW A;  1X8Q A;  2RQ0 A;  4GNY A;  1EII A;  3VPJ E;  1PEE A;  1KZW A;  3WJG A;  2CBS A;  3WJE A;  2RA6 A;  3FYF A;  1ADL A;  1UZ2 X;  1GXA A;  4QGW A;  1SXW A;  4GKC A;  4BQU A;  2R73 A;  3BU1 A;  3P6D A;  1KQW A;  2ACO A;  3PH6 A;  4O3Y A;  2LBV A;  5LJE A;  3BX8 A;  5LJC A;  2KTS A;  1DZM A;  3VG6 A;  3WJF A;  1EXS A;  1X8N A;  1TVQ A;  3B2I A;  3NP1 A;  4XMH A;  1YWC A;  3WOV A;  5DPQ A;  4AW8 A;  4M7M A;  3QKG A;  5HCD C;  1IIU A;  2RD7 C;  3PH5 A;  4ON1 A;  1KT3 A;  3MBT A;  4ALO A;  2GC9 A;  1VYF A;  4O49 A;  1GKA A;  3B2L A;  1BSQ A;  3HOL A;  5B29 A;  2ALL X;  4BVM A;  1TXL A;  5EED A;  3B2K A;  2GTL M;  4GZV A;  4ORR A;  2M4L A;  4IB9 A;  5BVQ A;  3RSW A;  4Y0S A;  5HCC C;  1SXX A;  4U3Q A;  4XMD A;  3OBL A;  4HWM A;  2AH7 X;  2FS6 A;  2G79 A;  4KH8 A;  4QAE A;  3S5V A;  2W2A A;  4YFR A;  1S7D A;  3BRN A;  3IA8 A;  2CZU A;  4ZGF A;  2QMI A;  1ICN A;  1YWB A;  3E3C A;  3NQ9 A;  5EZ2 A;  3NPO A;  3ELZ A;  3JQO A;  3APU A;  4ZHF A;  3CMP A;  4IB8 A;  1SY2 A;  1BSO A;  5FQ8 E;  2FTB A;  5H8T A;  3GAQ A;  3B2H A;  1GM6 A;  2MO5 A;  4Y0P A;  1RLB E;  3KFG A;  4N7D A;  4ZCB A;  2AMM X;  3MX7 A;  4I9R A;  1KZX A;  2W2F A;  3VG2 A;  4ALB A;  3O2Y A;  2QO4 A;  3FA7 A;  2HZR A;  2JU3 A;  2W2B A;  2L9C A;  4I3C A;  2A3F X;  4IAB A;  4NLI A;  1BBP A;  1U18 A;  5LJB A;  4ORY A;  3LV4 A;  1KXO A;  2X8T A;  3FMZ A;  1A57 A;  2HYS A;  3VG5 A;  1S2P A;  5F7G A;  4GK9 A;  1HQP A;  2A0A A;  2NNQ A;  3IFB A;  5FEN A;  4BOE A;  1LIB A;  3ZUI A;  1CBQ A;  2R56 A;  4OMX A;  1FTP A;  1A18 A;  1I4U A;  1JYJ A;  1JIW I;  1SMP I;  1GT5 A;  3OE3 A;  4HFO A;  4IB6 A;  3VE2 A;  4A1Y A;  3FEK A;  1B0O A;  3ZW2 A;  5K06 A;  1BEB A;  1YUP A;  1IFC A;  4IB7 A;  2FWV A;  3RBY A;  4LZU A;  2L67 A;  1L6M A;  4WFU A;  2QOS C;  2RCT A;  4XMG A;  1LKE A;  3FEP A;  1HN2 A;  1TOW A;  1GT1 A;  3HTY A;  2QO5 A;  3VE1 A;  1B4M A;  3F8A A;  3TZS A;  3PQS A;  1LPJ A;  5AJC A;  3FA6 A;  3PP6 A;  3ZQ3 A;  1LID A;  4AZO A;  4NLJ A;  4OS0 A;  1HMS A;  2IFB A;  1CRB A;  5AJB A;  1LNM A;  2NP1 A;  1HBQ A;  3TF6 A;  2O62 A;  1OBP A;  4TKB A;  3EYC A;  4XMC A;  1TOU A;  3N91 A;  2R74 A;  1EPB A;  1EPA A;  1SXY A;  4QYN A;  2Q39 A;  3K3L A;  3BDR A;  3NQ3 A;  5H9A A;  1MX8 A;  4PSQ A;  4QNI A;  2BS5 A;  2F09 A;  5L8O A;  2GTL N;  4Y0Q A;  2BT9 A;  1NP4 A;  4WFV A;  2ACP X;  5HZ8 A;  1ZND A;  3PEC A;  4IMO A;  3UAQ A;  3NBX X;  1IW2 A;  3NQK A;  2POA A;  4U9C A;  5HAE A;  5LKF A;  4ZFX A;  2NNE A;  4U8U O;  1CBR A;  3OJY C;  1JZU A;  4YH0 A;  1G7N A;  2BS6 A;  1XKI A;  4YGH A;  3P6F A;  1YWD A;  4QQ1 A;  1BJ7 A;  4KT5 A;  3P02 A;  3DSZ A;  4ORU A;  4ZR2 A;  3D96 A;  2KTD A;  5HZ9 A;  1ZRY A;  2QO6 A;  4UU2 A;  3CQN A;  3P24 A;  1JV4 A;  2FR2 A;  2WEX A;  4I6S A;  4LQZ A;  4ARH A;  1ACD A;  3S26 A;  3BSZ E;  4QGV A;  1QFT A;  2X8S A;  4HPC A;  1GT3 A;  1LFO A;  1EAL A;  3NX1 A;  4ORS A;  4ZHD A;  1IFB A;  3EMM A;  1S44 A;  1G85 A;  3D95 A;  2A13 A;  4HPA A;  1QG5 A;  1BM5 A;  1BWY A;  2CM4 A;  5HCE C;  3AKN A;  2G7B A;  5D8J A;  4MIS A;  2JU7 A;  2Z4H A;  1JJX A;  3FR4 A;  5D4A A;  3V8U A;  1ZNK A;  2ZAG A;  2KD2 A;  2WR6 A;  1YP6 A;  4MIR A;  1SY0 A;  3U03 A;  4U8U M;  3EBW A;  1OPA A;  5D47 A;  1PBO A;  3C76 X;  4JGL A;  1B56 A;  4HPB A;  2YMS A;  2RN4 A;  1PMP A;  4MVE A;  5FQ6 E;  3WJB A;  3CBS A;  3S5X A;  4GU8 A;  1GX9 A;  2HZQ A;  4IAX A;  1HMT A;  3RZY A;  3RKG A;  2JW1 A;  3D4R A;  4YKO A;  1G74 A;  1KT4 A;  2OFR X;  3HWF A;  3VU1 A;  4D6A A;  4Y0R A;  4YKM A;  2OZQ A;  3NAD A;  1DZP A;  2BHV A;  4MVI A;  4NYQ A;  4AYH A;  4TLJ A;  3CQR A;  2FS7 A;  3P6E A;  5FQ7 E;  4EXZ A;  3UEU A;  1YP7 A;  2BLG A;  4FQB B;  4L1N A;  4LZV A;  2AL0 X;  3NR3 A;  3UEX A;  5HBS A;  4GH7 A;  2A2G A;  3B2J A;  4AZN A;  3O22 A;  5IO6 A;  2DM5 A;  3FR5 A;  1U17 A;  1ERB A;  4IBA A;  3ZW0 B;  2F73 A;  2RCQ A;  5H9N A;  3SAO A;  4ZHH A;  4NYR A;  1D3S A;  3EM0 A;  4RUU A;  4ZHC A;  4TKJ A;  3MVF A;  4O3W A;  1AB0 A;  2AT5 X;  4QRL A;  5CE4 A;  5IO7 A;  3FEN A;  4KCA A;  5HWZ A;  4AZP A;  2AT8 X;  2MWH A;  2OVS A;  2K23 A;  1DV9 A;  5LJD A;  1LIF A;  4NNS A;  3TGC A;  5DG4 A;  2GJ5 A;  1BSY A;  4WHI A;  3EBK A;  1N0S A;  2EU7 X;  4COT A;  1FDQ A;  2X8F A;  2FT9 A;  5F1E A;  1KT5 A;  4ZH6 A;  5EDC A;  3STK A;  4YFQ A;  4O3Z A;  1QQS A;  4FBR A;  4TQ2 A;  1ALB A;  1CBS A;  1RBP A;  2QM9 A;  5F6Z A;  3ZZV A;  1E5P A;  1GGL A;  3O19 A;  4O3X B;  2JOZ A;  2CBR A;  3BU9 A;  1SXU A;  1Z24 A;  4NW4 A;  4YCH A;  3ZW1 B;  5KHP A;  3G7X A;  3LHN A;  3S60 A;  3TGA A;  1QY1 A;  3P6C A;  2FLJ A;  2P8G A;  3FEL A;  2Z4I A;  1KGL A;  3BLG A;  2X45 A;  1EQD A;  4EFG A;  2AT0 X;  3BX7 A;  3L4R A;  4KC7 A;  5HZQ A;  1LIC A;  4AZM A;  1MUP A;  4A8Z A;  4YMY A;  3I0A A;  4RUN A;  4QZU A;  4XMF A;  1GX8 A;  4UU3 A;  3KZA A;  3SOT A;  3WJC A;  1T0V A;  2MJI A;  2Q4N A;  5EPQ A;  4ORW A;  1YIV A;  4DQ4 A;  1U0X A;  5BVT A;  5FAZ A;  3HWE A;  1XCA A;  2WWP A;  3BS2 A;  4ORX A;  5JR8 A;  1I04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...