5K06A

Recombinant bovine beta-lactoglobulin with uncleaved n-terminal methionine (rblgb)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
163
structure length
157
Chain Sequence
MLIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Beta-lactoglobulin
publication title Engineered beta-Lactoglobulin Produced in E. coli: Purification, Biophysical and Structural Characterisation.
pubmed doi rcsb
source organism Bos taurus
total genus 33
structure length 157
sequence length 163
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5k06A00
3CR6A 1ERBA 5L8OA 5LJHA 3HWEA 2P8GA 2ACPX 3NADA 2G78A 1AELA 1VYFA 4XMCA 2RQ0A 2CBSA 5KIDA 3PP6A 5DPQA 1KT4A 1EALA 4M6SA 3WJFA 1GX8A 4YBUA 1G5WA 4EDEA 1GT5A 4OMXA 4GNYA 5IO5A 4ORWA 4AZNA 4IB7A 1A3YA 1SY3A 4IAXA 4GE1A 5EZ2A 1BRQA 1CBQA 4HFOA 3APVA 1GXAA 3EBWA 3NX2A 4ORUA 3ZQ3A 1X8PA 1IKJA 1X8OA 5AQ6A 1ERXA 5HCDC 1TOWA 4HPDA 3ELXA 4AZRA 1S44A 2HLVA 1CBRA 3TGBA 1YWAA 2AL0X 1EPBA 4AZOA 2R74A 2W2BA 4TKJA 3U03A 2QO6A 1IW2A 3FW5A 5H9AA 1SXUA 4WBKA 2QOSC 2O62A 1TW4A 1X71A 5LJGA 1NP1A 3EM0A 4OMWA 3ZUOA 4RUNA 3VG7A 1GGLA 3BU1A 1RLBE 1GT4A 3B2IA 5H9LA 1UZ2X 1HQPA 5LJKA 4YFPA 2WQAE 3FA7A 5HZ9A 3GAQA 1ZNEA 5LJDA 4TQ2A 1BBPA 3UEVA 4ZFXA 2LB6A 3NX1A 3SAOA 4IB6A 2MM3A 2L5PA 4TKBA 2YG2A 5L8NA 4ZR2A 5HA0A 2N93A 4MVIA 2CBRA 4K19A 4D6BA 3ELZA 4HPBA 4NNTA 5HZ8A 2CM4A 1HMTA 4XMHA 4YH0A 3UEXA 1QQSA 4NLIA 4QYPA 3WJDA 1EUOA 1XKIA 2WEWA 3FA8A 4LKTA 5D45A 4NNSA 3BLGA 4QZUA 5FENA 3O22A 2AT0X 1O1VA 1X8QA 3JSQA 4TNNA 3ZUIA 3CBSA 1U0XA 4XMEA 4Y0RA 3HWFA 3TF6A 1FEMA 1QG5A 4YGGA 1TXLA 4YFQA 4ZH9A 1KT5A 1KT3A 2FLJA 4YGHA 4GETA 1ALBA 3PH6A 3MVFA 3C77X 3EYCA 4I9SA 2NP1A 5HZ5A 1DZKA 4LZVA 3P6CA 1EW3A 3WJEA 1GM6A 1MX7A 1HBQA 3NPOA 1HN2A 4ORYA 1YWDA 3P6DA 1P6PA 1QY0A 1T0VA 4YFRA 2AT8X 5F6BA 4ARHA 2X46A 4UU2A 5H9KA 1QFTA 4ORRA 3TZSA 5HZ6A 4YDAA 3FW4A 1AQBA 2OZQA 4AZMA 1PEEA 1A57A 2RA6A 3NQ9A 1EIIA 1LIBA 1ZRYA 4R0BA 4ODDA 2WUTA 1ZNLA 2CM9A 4DQ4A 1LICA 4YCHA 5LKEA 2A3FX 4ORSA 3KFHA 1SXYA 1U17A 1SXXA 1EXSA 3WBGA 1BM5A 4Y0QA 1IKEA 3P6HA 3C76X 1IFCA 5B27A 4XMDA 4IB8A 2F73A 3APWA 1OBQA 3VG2A 2RCQA 4NP1A 1O1UA 5D8JA 5BVSA 2RD7C 3P6FA 1SA8A 5LJBA 1FENA 4ZH6A 5HCCC 5D4AA 1I06A 5DG4A 3EBKA 1RBPA 3O19A 4PSQA 1SY0A 1JYDA 3FEPA 1BWYA 1BEBA 1BLRA 3T1DA 1E02A 3FR2A 1YUPA 5BVTA 1T68X 1KQXA 2LBAA 3BX7A 1X89A 1U18A 1OPAA 3O2YA 1LIFA 5HAEA 1KGLA 3L4RA 1UREA 4ALOA 2OVEA 1LFOA 1NGLA 2K62A 3RSWA 4DQ3A 3FA9A 3P6EA 2MO5A 3WJGA 2AKQA 1DFVA 2OVDA 4MVKA 1G7NA 4BOEA 3B2HA 2L68A 4WFUA 5F6ZA 1FELA 3WXQA 4OS0A 2CZUA 5LJEA 4YGZA 3AKMA 4IMNA 4YKMA 5HBSA 2EU7X 5FFHA 2FRSA 5IO7A 4TJZA 1O8VA 3VG4A 3I0AA 1OEKA 4OS8A 3UEUA 4GH7A 2AT3X 3FEKA 1QY1A 1SY1A 1YWBA 5BVQA 3S26A 3P6GA 4IMOA 1JZUA 1QABE 3Q6LA 1YP7A 1IIUA 1BSQA 4I3CA 2IFBA 5HWZA 3FIQA 3NQ3A 1JBHA 3STMX 1YP6A 1MUPA 5EDCA 5EDBA 4KIIA 4ORXA 2R73A 2ASNX 3D96A 2WSJA 2DM5A 3KFFA 5HTDA 1ICNA 1Z24A 1MDCA 1I04A 5EEDA 1HMSA 3U9PC 3STKA 4A1HA 2ALLX 1KQWA 1SXWA 4I3DA 1B8EA 3UEWA 4ZHFA 1AB0A 2POAA 2L67A 1OBPA 1XCAA 3WJBA 5IO6A 3FLLA 5L8IA 4M7MA 5KICA 1ZNHA 4HPCA 1T8VA 2FTBA 4ZCBA 1DC9A 2A2UA 4YMYA 1DF3A 1S2PA 1CRBA 4LZUA 1E5PA 2GC9A 4NLJA 2G79A 3KZAA 1GT3A 3BRNA 1YIVA 4NYRA 2A13A 2R56A 2W2AA 1LNMA 2Q2MA 2MJIA 5CE4A 5EPQA 4Y0PA 5H9NA 3AKNA 3VG3A 1X8UA 4AZQA 4QGVA 3IA8A 3G7XA 4YBPA 5B29A 2E4JA 4EFGA 4BVMA 1JJXA 1NP4A 2AT6X 3F9DA 2A2GA 2FS7A 1JV4A 5F58A 4BQUA 1KZWA 2NNDA 1BSOA 3APXA 4QZTA 2FT9A 1D3SA 1BSYA 3CMPA 5F1EA 3APUA 2JU3A 1OEJA 2JU8A 2RCTA 3TGAA 2WQ9A 5H8TA 1YWCA 2QM9A 1OBUA 3FR5A 3PH5A 1ACDA 1PBOA 4D6AA 1LF7A 2JN3A 1X8NA 3C78X 4GRJA 4RUUA 1DZMA 2A0AA 1ZNDA 2L9CA 4N7DA 1FTPA 2Q39A 1AVGI 1LIEA 4N7CA 5D47A 3OJYC 2AH7X 3QKGA 2FR2A 4GKCA 2Q9SA 3PEDA 1IFBA 5HCEC 3FR4A 3D97A 1GKAB 1TOUA 1KT6A 2CZTA 2QO5A 5EEEA 4ZJ0A 5LJCA 3STNA 2LFOA 3FMZA 1L6MA 5C0NA 3B2LA 3CWKA 1B0OA 4OS3A 4ZHCA 3EMMA 3MBTA 2NNEA 3BDRA 1KT7A 4IBAA 1HBPA 1OPBA 1ADLA 4NYQA 1S7DA 4IAWA 5HTEA 1CBIA 1JJJA 1MVGA 1DZPA 2PY1A 1HMRA 2Q2PA 3BSZE 1G74A 2HMBA 2XKLA 1E00A 4I3BA 2KT4B 1B4MA 1PMPA 1DV9A 1ZNGA 3DSZA 4WFVA 4O9SA 4QAEA 3CQRA 4ZGUA 2XSTA 4I9RA 2KTDA 1OEEA 3WJCA 3D95A 1CJ5A 4EEJA 2LKKA 4EXZA 3I17A 1KOIA 2LBVA 3B2KA 5HA1A 4ZHHA 5FAZA 3HWGA 3DTQA 1BRPA 5JR8A 4HPAA 4TKHA 5HZQA 1H91A 1KXOA 2QO4A 2JOZA 3FA6A 4YCEA 2WR6A 1JYJA 2GTFX 2AMMX 2HZQA 3BX8A 4A60A 3IFBA 3KFGA 4ZHDA 3CQNA 4IB9A 4ALBA 2ACOA 2OFMX 4AZPA 4QGWA 2K23A 2Q4NA 5F7GA 3B2JA 1VYGA 1LKEA 5D48A 2HYSA 1ZNKA 4GNWA 3K3LA 1I05A 2FS6A 4TLJA 1EIOA 1BJ7A 2WWPA 1ML7A 1N0SA 2NNQA 1A18A 1LIDA 3WVMA 4ES7A 4ZHGA 1R0UA 1GX9A 3HWDA 1QFVA 2WEXA 2FWVA 3KFIA 1CBSA 1DZJA 1KZXA 1PM1X 3BY0A 1VPRA 1I4UA 3CBCA 3HK1A 4QYNA 4A8ZA 1ICMA 5KHPA 1A2DA 1QWDA 2BLGA 3KQ0A 1TVQA 1LPJA 3U0DA 1EQDA 1SY2A 1G85A 2AT5X 4AYHA 3BU9A 5LKFA 4A1YA 3VG6A 2HNXA 4UU3A 4QGXA 1FE3A 3FENA 3JS1A 4YKOA 1E06A 4Y0SA 4CK4A 2ANSA 2X45A 3FELA 2GJ5A 2W2FA 3NP1A 1D2UA 1FDQA 3VG5A 1B56A 4LKPA 2HZRA 4XMGA 2OVAA 4XMFA 2JU7A 3PPTA 5K06A 2G7BA 2FR3A 4MVLA 3BS2A 3NR3A 3PECA 2OFRX 3TGCA 1QY2A 1GT1A 1MX8A 3F8AA 1GKAA 3RZYA 4AW8A 4YDBA 1EPAA
chains in the Genus database with same CATH superfamily
3CR6A 4PJ2A 1ERBA 2RTIB 5L8OA 5LJHA 3HWEA 2P8GA 2ACPX 4IABA 4ML7B 3ZI8A 3NADA 2G78A 1AELA 1VYFA 2RTKA 4XMCA 2RQ0A 2CBSA 2OY7A 3PP6A 1VWCB 1SWPA 1KT4A 2ZAGA 5DPQA 3OBLA 4BJ8A 2OF8A 1EALA 4M6SA 3WJFA 1GX8A 4YBUA 1G5WA 4EDEA 1GT5A 4OMXA 2RTOB 4GNYA 5IO5A 4ORWA 4AZNA 4IB7A 1A3YA 4OELA 4BBOA 2MWHA 1SY3A 4IAXA 4GE1A 5EZ2A 1BRQA 2BT9A 1CBQA 4L3RA 4HFOA 3APVA 1GXAA 3SLTA 1SWSA 2X8FA 3EBWA 3NX2A 1VWPB 1IKJA 1X8PA 1X8OA 2F01A 3QQ2A 4ORUA 5AQ6A 3SZHA 4GJVA 1ERXA 5HCDC 1TOWA 1RXKA 1STSB 1SWTA 4HPDA 3LTWA 3ELXA 4U9CA 1PTSA 4IRWA 3T2XA 3VE2A 3T6LA 1OSPO 4AZRA 1S44A 2HLVA 4GU8A 1CBRA 3TGBA 3MG5A 3OE3A 1YWAA 3PQSA 2AL0X 1EPBA 1SWAA 4AZOA 3GE2A 2R74A 2W2BA 2Y3EA 2GH7A 1SWCA 4BX7A 4O3WA 1VWNB 4TKJA 3U03A 2GTLM 2QO6A 2X34A 1IW2A 3FW5A 2JW1A 2C1QA 1VWKB 5B10O 4MISA 5H9AA 4O4XA 2RTDB 1SXUA 2AF5A 4WBKA 2QOSC 1SRJA 4KCAA 5L3YA 2O62A 1TW4A 1SMPI 3ZW1A 3NQKA 1X71A 5LJGA 3HOEA 2IZHB 2C1SA 1NP1A 3T2WA 3EM0A 4OMWA 2RTMA 3ZUOA 4RUNA 3VG7A 1GGLA 3BU1A 2X8TA 2IZGB 1RLBE 1GT4A 3B2IA 1W4TA 1Y55X 5H9LA 1UZ2X 1SRHA 1HQPA 1VWJB 4YFPA 5LJKA 2WQAE 3FA7A 5HZ9A 5F2BA 4DNEA 3GAQA 1ZNEA 5LJDA 4TQ2A 2X32A 1BBPA 3UEVA 3SLOA 4ZFXA 2LB6A 3NX1A 3CKGA 3OD9A 3SAOA 4IB6A 2MM3A 2L5PA 4TKBA 3T6FA 1AVDA 2YG2A 5L8NA 1FJ1E 4ZR2A 3VGWA 5HA0A 2OFAA 2N93A 2IZIA 4MVIA 2CBRA 4K19A 4D6BA 3ELZA 4HPBA 4NNTA 4ON1A 1NBXA 4MIRA 5HZ8A 4BX5B 2A8GA 1HMTA 2CM4A 4XMHA 2JMBA 4YH0A 3UEXA 1QQSA 4NLIA 4QYPA 2RTRB 1W5RA 3WJDA 1EUOA 1XKIA 2WEWA 3FA8A 2BSZA 4LKTA 1MK5A 4U8UM 5D45A 1N9MA 2ZAIA 3BLGA 4NNSA 1SWBA 4QZUA 1Y53X 5FENA 3O22A 2AT0X 1O1VA 1X8QA 3JSQA 2A5BA 1VWGB 4TNNA 1N9YA 5B2AO 3CBSA 3RDUA 1U0XA 3ZUIA 4BX6A 2MHDA 4XMEA 3HWFA 4Y0RA 3TF6A 1FEMA 1QG5A 4NV8A 4YGGA 1LCZA 1TXLA 4YFQA 4ZH9A 3WYQA 4GZVA 1KT5A 1KT3A 1VWEB 2FLJA 4YGHA 4GGTA 2X55A 4GETA 1ALBA 3PH6A 4C5PA 3MVFA 3C77X 3EYCA 4I9SA 4CSBA 2NP1A 5HZ5A 1DZKA 4LZVA 3P6CA 4LQZA 1EW3A 1SRFA 2OVSA 1GM6A 4FGIB 1JJUA 3WJEA 4CPFA 1MX7A 3N91A 1HBQA 1GX3A 2KTSA 1HN2A 3NPOA 1VWQB 1YWDA 1P6PA 3P6DA 4JGLA 4ORYA 2KW1A 2X56A 1QY0A 1RAVA 1SRGA 1T0VA 4EQAC 4YFRA 2AT8X 5F6BA 4ARHA 1SLFB 2X46A 3KVNA 4UU2A 5H9KA 1LDQA 3RY2A 2OFBA 1EI5A 5FQ7E 1LDOA 1QFTA 4ORRA 2CAMA 4O4SA 3TZSA 5HZ6A 4YDAA 3FW4A 1AQBA 2OZQA 4AZMA 1PEEA 1IJ8A 2FHNX 2RA6A 3NQ9A 1LIBA 1A57A 1EIIA 1ZRYA 4R0BA 4ODDA 4KC7A 2WUTA 1ZNLA 2CM9A 1VWOB 1MEPA 4DQ4A 3EW2A 1LICA 2OL8O 4YCHA 5LKEA 2A3FX 4ORSA 3KFHA 1SXYA 1U17A 2OY1O 4U8UO 3WZQA 1SXXA 2UZ2A 3VHIA 1EXSA 3WBGA 4U8UN 2RTJA 2VFCA 4Y0QA 5K68A 1BM5A 1IKEA 3P6HA 2Y3FA 3X00A 3C76X 1IFCA 5B27A 4XMDA 2IZDB 3VU1A 4IB8A 2F73A 3APWA 3ZZVA 1OBQA 2RTQB 3VG2A 1WUBA 2IZFB 2RCQA 4NP1A 1O1UA 5D8JA 5BVSA 1W6FA 2RD7C 4O4UA 5AEOA 1LUQA 3P6FA 1SA8A 3S60A 1FENA 5LJBA 4ZH6A 5HCCC 5D4AA 1RSTB 4JO6A 2VDFA 1I06A 1SLGB 4L1NA 3V8UA 1CJ5A 5DG4A 3EBKA 1RBPA 3RWXA 1E2TA 3O19A 2JGSA 4PSQA 1HY2A 1SY0A 2AVIA 1JYDA 3FEPA 3SLJA 1BEBA 1BLRA 3T1DA 1BWYA 1SWRA 1E02A 3FYFA 1LELA 1UYOX 1KL4A 1YUPA 3FR2A 1N4JA 1VWHB 5BVTA 1T68X 4QRLA 1KQXA 3H3IA 4MVEA 2LBAA 2ZSCA 3BX7A 1X89A 1U18A 1OPAA 4KC8A 4Y59A 2F09A 4CPHB 4GDAA 1Y52X 2M4LA 3O2YA 1NQNA 1LIFA 3E3CA 4O3YA 5HAEA 3L4RA 1KGLA 1SLDB 1UREA 2Z4HA 4ALOA 2OVEA 2G8CO 1LFOA 1VWLB 1NGLA 1SWUA 2K62A 3ZW0B 3WZOA 3RSWA 3RY1A 4DQ3A 5K67A 3FA9A 3EC5A 3P6EA 2MO5A 1AVEA 3WJGA 2AKQA 1DFVA 2OVDA 4MVKA 1G7NA 1SWJA 4BOEA 2FKGA 3B2HA 2FGSA 2L68A 4WFUA 5F6ZA 1FELA 3WXQA 4OS0A 3AEHA 4U3QA 2CZUA 5LJEA 1JMZA 4YGZA 4CV7A 1SLEB 3AKMA 4IMNA 1RXJA 4KT5A 2RTNB 4YKMA 3RDSA 4KH8A 4ZHFA 4GGZA 2YMSA 5HBSA 2EU7X 5FFHA 3MM0A 2FRSA 5IO7A 4TJZA 1O8VA 1Y9TA 2RTEB 3VG4A 4O4OA 3I0AA 1OEKA 3EW1A 2VFBA 4B55A 5B11O 4OS8A 3UEUA 4GH7A 4BX5A 2FKJA 5FQ6E 3RKGA 2AT3X 3FEKA 1QY1A 1SY1A 1YWBA 2RTHB 5BVQA 3P6GA 4IMOA 4I95A 3S26A 4Z2OA 2C4IA 1JZUA 4GUZA 1QABE 1SWEA 1I78A 1SWNA 2IZEB 1YP7A 3Q6LA 4BCSA 1IIUA 1STRB 1BSQA 2IFBA 4I3CA 3FIQA 3NQ3A 4JHQA 5HWZA 2X8SA 1JBHA 3STMX 1YP6A 1MUPA 5EDCA 5EDBA 4CDEA 4KIIA 3LHNA 2A5CA 4ORXA 3RBYA 2R73A 2ASNX 3D96A 2WSJA 2MF6A 2DM5A 3KFFA 2FHLA 5HTDA 1ICNA 1Z24A 1MDCA 1I04A 1SREA 5EEDA 3VPJE 3WOVA 4BGFA 1HMSA 3U9PC 3STKA 4A1HA 2ALLX 2GTLO 1KQWA 2IZCB 2GTLN 1SXWA 4I3DA 1B8EA 5CSEA 3UEWA 4O3XB 1AB0A 2POAA 2L67A 1OBPA 1XCAA 3AUMO 3Q34A 3WJBA 4CDCA 4MEEA 5IO6A 3FLLA 5L8IA 4M7MA 5KICA 2OYBO 4DCBA 1ZNHA 4HPCA 1T8VA 2FTBA 4ZCBA 1DC9A 2A2UA 5IRAA 4YMYA 1DF3A 1S2PA 1CRBA 4LZUA 1E5PA 1UYNX 2GC9A 5BYPA 4NLJA 1VWDB 2G79A 2IZJA 3KZAA 4Z6JA 1GT3A 3BRNA 1YIVA 4NYRA 2A13A 2R56A 3FIDA 2KD2A 2W2AA 1RXHA 1LNMA 3WYPA 4O49A 2Q2MA 2QMIA 2MJIA 5CE4A 5EPQA 4Y0PA 5H9NA 2RN4A 3AKNA 1X8UA 2IZAA 4OEMA 3IA8A 3VG3A 4AZQA 4QGVA 3G7XA 1NQMA 4YBPA 5B29A 2E4JA 5AJBA 4BVMA 4EFGA 1JJXA 1NP4A 2AT6X 3F9DA 2A2GA 4FQBB 1SWQA 2FS7A 1JV4A 5F58A 4BQUA 1KZWA 2NNDA 2BC3A 1BSOA 3APXA 2BHVA 4QZTA 2FT9A 1D3SA 2HKDA 1BSYA 4Z27A 3CMPA 5F1EA 3APUA 5KIDA 2JU3A 1SWHA 1OEJA 2JU8A 2RCTA 3TGAA 2WQ9A 5H8TA 1YWCA 2QM9A 1OBUA 3FR5A 3PH5A 1ACDA 1PBOA 4NW4A 4D6AA 1LF7A 1PBYA 3RDQA 2JN3A 1X8NA 2RTLA 3PQUA 4U46A 1DF8A 3C78X 2WPUA 4GRJA 4QQ1A 4RUUA 5FQ8E 1HQQA 1DZMA 2A0AA 2OL7A 1ZNDA 2L9CA 4N7DA 3VHMA 1NC9A 4Z28A 1FTPA 2Q39A 1AVGI 1LIEA 4N7CA 2I5ZO 5D47A 3OJYC 2AH7X 1VWAB 3QKGA 2FR2A 4GKCA 2Q9SA 3PEDA 1IFBA 3ZW2A 3RDOA 5HCEC 2Y32A 3FR4A 3D97A 5B5FA 1GKAB 1TOUA 4CPHA 1KT6A 1SWFA 2CZTA 2QO5A 2BS5A 5EEEA 4ZJ0A 5LJCA 3STNA 4OKAA 1MOYA 2LFOA 3FMZA 1L6MA 5C0NA 4YVBA 1JQPA 3B2LA 3CWKA 1B0OA 4OS3A 4ZHCA 3ZW0A 3EMMA 4CDDA 3MBTA 2IZLB 4Z2VA 2NNEA 2QCBA 3BDRA 4Z2PA 2IZBA 1KT7A 4IBAA 1HBPA 1OPBA 1ADLA 4NYQA 1S7DA 4IAWA 5HTEA 1CBIA 5CYBA 1JJJA 3F6ZB 1MVGA 3D4RA 5IRUA 2Z4IA 1DZPA 1JIWI 3D9WA 2PY1A 1HMRA 2Q2PA 3BSZE 5AJCA 4WHIA 1G74A 2G5LA 2HMBA 1E00A 2XKLA 3P24A 3ZWEA 4I3BA 5IXGA 3NBXX 4JNJA 2RTCB 4FBVA 2KT4B 1B4MA 4CDFA 2OL6O 1PMPA 1DV9A 1ZNGA 1VWBB 3DSZA 3VE1A 2OF9A 4Y5DA 2RTBB 3RDXA 4WFVA 4O9SA 4QAEA 3CQRA 3WZPA 2XSTA 4GGRA 4ZGUA 4I9RA 2KTDA 1OEEA 2RTGB 4NV7A 3WJCA 3D95A 2RTAA 5JD2A 3RDMA 1VWRB 2LKKA 3MX7A 4BX7B 3I17A 1KOIA 4EEJA 3VHHA 1WBIA 4EXZA 2LBVA 3B2KA 1KL5A 5CHKA 5HA1A 1SWGA 4ZHHA 5FAZA 3RE6A 3HWGA 3DTQA 3ZW1B 1VWIB 1BRPA 3S5VA 5JR8A 4FBRA 1N7YA 4HPAA 4TKHA 1VWMB 1H91A 1KXOA 5HZQA 2QO4A 2JOZA 3FA6A 4YCEA 2WR6A 1JYJA 1VWFB 2GTFX 2AMMX 2HZQA 3BX8A 2PI3O 4A60A 3IFBA 3PDFA 3KFGA 4ZHDA 3CQNA 4IB9A 4INNA 4ALBA 1JMXA 2ACOA 2OFMX 4AZPA 4QGWA 2K23A 2Q4NA 3PK2A 4GK9A 3B2JA 3P02A 5F7GA 3S5XA 1VYGA 1LKEA 2IZKA 5D48A 2HYSA 1ZNKA 1SWKA 4GNWA 4I60A 3K3LA 4CPIA 1I9HA 1I05A 3HTYA 2FS6A 4TLJA 1K3BA 1EIOA 1BJ7A 2WWPA 1ML7A 4GD9A 5B5GA 3RE5A 4QNIA 1N0SA 3HOLA 3JQOA 1RSUB 1STPA 2NNQA 1A18A 1LIDA 3SOTA 3WVMA 1LCWA 4ES7A 4ZGFA 2LA7A 4ZHGA 1R0UA 2DJFA 1SWLA 2RTPB 1GX9A 3HWDA 1QFVA 2WEXA 3HPEA 4ID2A 2FWVA 4BX6B 3KFIA 4EKVA 4I6SA 1CBSA 1DZJA 1KZXA 1PM1X 3BY0A 1VPRA 1I4UA 2DJGA 3CBCA 3HK1A 4QYNA 1K24A 4A8ZA 4HWMA 1VYOA 1ICMA 2OY5O 5KHPA 1A2DA 1QWDA 2BLGA 3KQ0A 1TVQA 4FBOA 1LPJA 3U0DA 1EQDA 1SY2A 1G85A 2AT5X 3ZQ3A 5IRWA 4AYHA 4CPEA 2BS6A 3BU9A 5LKFA 3VG6A 2HNXA 4UU3A 4QGXA 4A1YA 1MM9A 1FE3A 1NDJA 2UYWA 3CKFA 3FENA 3JS1A 1SWOA 2X4MA 1N43A 1E06A 4Y0SA 4YKOA 3SZIA 3UAQA 4CK4A 1KL3A 2ANSA 2X45A 3FELA 1HXLA 2GJ5A 2W2FA 3NP1A 1D2UA 1FDQA 3VG5A 4COTA 1B56A 4LKPA 3LV4A 1Y0GA 1SWDA 2HZRA 4XMGA 3SZJA 2OVAA 4O3ZA 1LCVA 2JU7A 2OY8A 3PPTA 4XMFA 5K06A 2QOMA 2G7BA 4GDZA 2FR3A 1SRIA 3BS2A 4MVLA 1Y9LA 3NR3A 1HXZA 3PECA 3WZNA 2OFRX 3FDCA 3TGCA 5B3MO 2RTFB 1QY2A 1GT1A 1MX8A 2I5VO 1GKAA 3F8AA 1KFFA 3RZYA 4AW8A 4YDBA 1EPAA 4GJSA
chains in the Genus database with same CATH topology
3CR6A 4PJ2A 1ERBA 5L8OA 5LJHA 3HWEA 2P8GA 2ACPX 4IABA 4ML7B 3ZI8A 3NADA 2G78A 1AELA 1VYFA 4XMCA 2RQ0A 2CBSA 5KIDA 3PP6A 5DPQA 1KT4A 2ZAGA 1EALA 3OBLA 4M6SA 3WJFA 1GX8A 4YBUA 1G5WA 4EDEA 1GT5A 4OMXA 4GNYA 5IO5A 4ORWA 4AZNA 4IB7A 1A3YA 2MWHA 1SY3A 4IAXA 4GE1A 5EZ2A 1BRQA 2BT9A 1CBQA 4L3RA 4HFOA 3APVA 1GXAA 3EBWA 2X8FA 3NX2A 4ORUA 1X8PA 1IKJA 3ZQ3A 1X8OA 5AQ6A 1ERXA 5HCDC 1TOWA 4HPDA 3ELXA 4U9CA 3VE2A 4AZRA 1S44A 2HLVA 4GU8A 1CBRA 3TGBA 3OE3A 1YWAA 3PQSA 2AL0X 1EPBA 4AZOA 3GE2A 2R74A 2W2BA 4O3WA 4TKJA 3U03A 2GTLM 2QO6A 1IW2A 3FW5A 2JW1A 4MISA 5H9AA 4O4XA 1SXUA 4WBKA 2QOSC 4KCAA 2O62A 1TW4A 1SMPI 3ZW1A 3NQKA 1X71A 5LJGA 3HOEA 1NP1A 3EM0A 4OMWA 3ZUOA 4RUNA 3VG7A 1GGLA 3BU1A 2X8TA 1RLBE 1GT4A 3B2IA 5H9LA 1UZ2X 1HQPA 5LJKA 4YFPA 2WQAE 3FA7A 5HZ9A 3GAQA 1ZNEA 5LJDA 4TQ2A 1BBPA 3UEVA 4ZFXA 2LB6A 3NX1A 3OD9A 3SAOA 4IB6A 2MM3A 2L5PA 4TKBA 2YG2A 5L8NA 4ZR2A 5HA0A 2N93A 4MVIA 2CBRA 4K19A 4D6BA 3ELZA 4HPBA 4NNTA 4ON1A 4MIRA 5HZ8A 2CM4A 1HMTA 4XMHA 2JMBA 4YH0A 3UEXA 1QQSA 4NLIA 4QYPA 3WJDA 1EUOA 1XKIA 2WEWA 3FA8A 4LKTA 4U8UM 5D45A 2ZAIA 3BLGA 4NNSA 4QZUA 5FENA 3O22A 2AT0X 1O1VA 1X8QA 3JSQA 4TNNA 3ZUIA 3CBSA 1U0XA 2MHDA 4XMEA 3HWFA 4Y0RA 3TF6A 1FEMA 1QG5A 4YGGA 1TXLA 4YFQA 4ZH9A 4GZVA 1KT5A 1KT3A 2FLJA 4YGHA 4GETA 1ALBA 3PH6A 3MVFA 3C77X 3EYCA 4I9SA 4CSBA 2NP1A 5HZ5A 1DZKA 4LZVA 3P6CA 4LQZA 1EW3A 2OVSA 4FGIB 1GM6A 3WJEA 1MX7A 3N91A 1HBQA 2KTSA 1HN2A 3NPOA 1YWDA 3P6DA 1P6PA 4JGLA 4ORYA 2KW1A 1QY0A 1T0VA 4EQAC 4YFRA 2AT8X 5F6BA 4ARHA 2X46A 4UU2A 5H9KA 5FQ7E 1EI5A 1QFTA 4ORRA 4O4SA 3TZSA 5HZ6A 4YDAA 3FW4A 1AQBA 2OZQA 4AZMA 1PEEA 1A57A 2RA6A 3NQ9A 1EIIA 1LIBA 1ZRYA 4R0BA 4ODDA 4KC7A 2WUTA 1ZNLA 2CM9A 4DQ4A 1LICA 4YCHA 5LKEA 2A3FX 4ORSA 3KFHA 1SXYA 1U17A 4U8UO 1SXXA 1EXSA 3WBGA 4U8UN 4Y0QA 1BM5A 1IKEA 3P6HA 3C76X 1IFCA 5B27A 4XMDA 3VU1A 4IB8A 2F73A 3APWA 3ZZVA 1OBQA 3VG2A 2RCQA 4NP1A 1O1UA 5D8JA 5BVSA 2RD7C 4O4UA 5AEOA 3P6FA 1SA8A 3S60A 1FENA 5LJBA 4ZH6A 5HCCC 5D4AA 1I06A 4L1NA 3V8UA 5DG4A 3EBKA 1RBPA 3RWXA 3O19A 4PSQA 1SY0A 1JYDA 3FEPA 1BWYA 1BEBA 1BLRA 3T1DA 1E02A 3FYFA 3FR2A 1YUPA 5BVTA 1T68X 4QRLA 1KQXA 3H3IA 4MVEA 2LBAA 3BX7A 4KC8A 1X89A 1U18A 1OPAA 2F09A 2M4LA 3O2YA 1LIFA 3E3CA 4O3YA 5HAEA 3L4RA 1KGLA 1UREA 2Z4HA 4ALOA 2OVEA 1LFOA 1NGLA 2K62A 3ZW0B 3RSWA 4DQ3A 3FA9A 3P6EA 2MO5A 3WJGA 2AKQA 1DFVA 2OVDA 4MVKA 1G7NA 4BOEA 3B2HA 2L68A 4WFUA 5F6ZA 1FELA 3WXQA 4OS0A 4U3QA 2CZUA 5LJEA 4YGZA 4CV7A 3AKMA 4IMNA 4KT5A 4YKMA 4KH8A 2YMSA 5HBSA 2EU7X 5FFHA 2FRSA 5IO7A 4TJZA 1O8VA 1Y9TA 3VG4A 4O4OA 3I0AA 1OEKA 4OS8A 3UEUA 4GH7A 5FQ6E 3RKGA 2AT3X 3FEKA 1QY1A 1SY1A 1YWBA 5BVQA 3S26A 3P6GA 4IMOA 4I95A 1JZUA 1QABE 3Q6LA 1YP7A 1IIUA 1BSQA 4I3CA 2IFBA 5HWZA 3FIQA 3NQ3A 2X8SA 1JBHA 3STMX 1YP6A 1MUPA 5EDCA 5EDBA 4KIIA 3LHNA 4ORXA 3RBYA 2R73A 2ASNX 3D96A 2WSJA 2DM5A 3KFFA 5HTDA 1ICNA 1Z24A 1MDCA 1I04A 5EEDA 3VPJE 3WOVA 1HMSA 3U9PC 3STKA 4A1HA 2ALLX 2GTLO 1KQWA 2GTLN 1SXWA 4I3DA 1B8EA 3UEWA 4ZHFA 4O3XB 1AB0A 2POAA 2L67A 1OBPA 1XCAA 3WJBA 5IO6A 3FLLA 5L8IA 4M7MA 5KICA 1ZNHA 4HPCA 1T8VA 2FTBA 4ZCBA 1DC9A 2A2UA 4YMYA 1DF3A 1S2PA 1CRBA 4LZUA 1E5PA 2GC9A 5BYPA 4NLJA 2G79A 3KZAA 1GT3A 3BRNA 1YIVA 4NYRA 2A13A 2R56A 2KD2A 2W2AA 1LNMA 4O49A 2Q2MA 2QMIA 2MJIA 5CE4A 5EPQA 4Y0PA 5H9NA 2RN4A 3AKNA 1X8UA 3VG3A 4AZQA 3IA8A 4QGVA 3G7XA 4YBPA 5B29A 2E4JA 5AJBA 4BVMA 4EFGA 1JJXA 1NP4A 2AT6X 3F9DA 2A2GA 4FQBB 2FS7A 1JV4A 5F58A 4BQUA 1KZWA 2NNDA 1BSOA 3APXA 2BHVA 4QZTA 2FT9A 1D3SA 1BSYA 3CMPA 5F1EA 3APUA 2JU3A 1OEJA 2JU8A 2RCTA 3TGAA 2WQ9A 5H8TA 1YWCA 2QM9A 1OBUA 3FR5A 3PH5A 1ACDA 1PBOA 4NW4A 4D6AA 1LF7A 2JN3A 1X8NA 3PQUA 3C78X 4GRJA 4QQ1A 4RUUA 5FQ8E 1DZMA 2A0AA 1ZNDA 2L9CA 4N7DA 1FTPA 2Q39A 1AVGI 1LIEA 4N7CA 5D47A 3OJYC 2AH7X 3QKGA 2FR2A 4GKCA 2Q9SA 3PEDA 1IFBA 3ZW2A 5HCEC 3FR4A 3D97A 1GKAB 1TOUA 1KT6A 2CZTA 2QO5A 2BS5A 5EEEA 4ZJ0A 5LJCA 3STNA 2LFOA 3FMZA 1L6MA 5C0NA 3B2LA 3CWKA 1B0OA 4OS3A 4ZHCA 3ZW0A 3EMMA 3MBTA 2NNEA 3BDRA 1KT7A 4IBAA 1HBPA 1OPBA 1ADLA 4NYQA 1S7DA 4IAWA 5HTEA 1CBIA 5CYBA 1JJJA 3F6ZB 1MVGA 3D4RA 2Z4IA 1DZPA 1JIWI 2PY1A 1HMRA 2Q2PA 3BSZE 5AJCA 4WHIA 1G74A 2HMBA 2XKLA 1E00A 3P24A 3ZWEA 4I3BA 3NBXX 4FBVA 2KT4B 1B4MA 1PMPA 1DV9A 1ZNGA 3DSZA 3VE1A 4WFVA 4O9SA 4QAEA 3CQRA 4ZGUA 2XSTA 4I9RA 2KTDA 1OEEA 3WJCA 3D95A 1CJ5A 3MX7A 2LKKA 4EEJA 4EXZA 3I17A 1KOIA 2LBVA 3B2KA 5HA1A 4ZHHA 5FAZA 3HWGA 3DTQA 3ZW1B 1BRPA 3S5VA 5JR8A 4FBRA 4HPAA 4TKHA 5HZQA 1H91A 1KXOA 2QO4A 2JOZA 3FA6A 4YCEA 2WR6A 1JYJA 2GTFX 2AMMX 2HZQA 3BX8A 4A60A 3IFBA 3KFGA 4ZHDA 3CQNA 4IB9A 4INNA 4ALBA 2ACOA 2OFMX 4AZPA 4QGWA 2K23A 2Q4NA 4GK9A 5F7GA 3B2JA 3P02A 1VYGA 1LKEA 5D48A 2HYSA 1ZNKA 4GNWA 3K3LA 1I05A 3HTYA 2FS6A 4TLJA 1EIOA 1BJ7A 2WWPA 1ML7A 4QNIA 1N0SA 3HOLA 3JQOA 3SOTA 2NNQA 1A18A 1LIDA 3WVMA 4ES7A 4ZGFA 2LA7A 4ZHGA 1R0UA 1GX9A 3HWDA 1QFVA 2WEXA 4ID2A 2FWVA 3KFIA 4I6SA 1CBSA 1DZJA 1KZXA 1PM1X 3BY0A 1VPRA 1I4UA 3CBCA 3HK1A 4QYNA 4A8ZA 4HWMA 1ICMA 5KHPA 1A2DA 1QWDA 2BLGA 3KQ0A 1TVQA 4FBOA 1LPJA 3U0DA 1EQDA 1SY2A 1G85A 2AT5X 4AYHA 2BS6A 3BU9A 5LKFA 3VG6A 2HNXA 4UU3A 4QGXA 4A1YA 3S5XA 1FE3A 3FENA 3JS1A 3UAQA 4YKOA 1E06A 4Y0SA 4CK4A 2ANSA 2X45A 3FELA 2GJ5A 2W2FA 3NP1A 1D2UA 1FDQA 3VG5A 4COTA 1B56A 4LKPA 3LV4A 2HZRA 4XMGA 2OVAA 4O3ZA 2JU7A 3PPTA 4XMFA 5K06A 2G7BA 4GDZA 2FR3A 4MVLA 3BS2A 1Y9LA 3NR3A 3PECA 2OFRX 3TGCA 1QY2A 1GT1A 1MX8A 3F8AA 1GKAA 3RZYA 4AW8A 4YDBA 1EPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CR6 A;  1ERB A;  5L8O A;  5LJH A;  3HWE A;  2P8G A;  2ACP X;  3NAD A;  2G78 A;  1AEL A;  1VYF A;  4XMC A;  2RQ0 A;  2CBS A;  5KID A;  3PP6 A;  5DPQ A;  1KT4 A;  1EAL A;  4M6S A;  3WJF A;  1GX8 A;  4YBU A;  1G5W A;  4EDE A;  1GT5 A;  4OMX A;  4GNY A;  5IO5 A;  4ORW A;  4AZN A;  4IB7 A;  1A3Y A;  1SY3 A;  4IAX A;  4GE1 A;  5EZ2 A;  1BRQ A;  1CBQ A;  4HFO A;  3APV A;  1GXA A;  3EBW A;  3NX2 A;  4ORU A;  3ZQ3 A;  1X8P A;  1IKJ A;  1X8O A;  5AQ6 A;  1ERX A;  5HCD C;  1TOW A;  4HPD A;  3ELX A;  4AZR A;  1S44 A;  2HLV A;  1CBR A;  3TGB A;  1YWA A;  2AL0 X;  1EPB A;  4AZO A;  2R74 A;  2W2B A;  4TKJ A;  3U03 A;  2QO6 A;  1IW2 A;  3FW5 A;  5H9A A;  1SXU A;  4WBK A;  2QOS C;  2O62 A;  1TW4 A;  1X71 A;  5LJG A;  1NP1 A;  3EM0 A;  4OMW A;  3ZUO A;  4RUN A;  3VG7 A;  1GGL A;  3BU1 A;  1RLB E;  1GT4 A;  3B2I A;  5H9L A;  1UZ2 X;  1HQP A;  5LJK A;  4YFP A;  2WQA E;  3FA7 A;  5HZ9 A;  3GAQ A;  1ZNE A;  5LJD A;  4TQ2 A;  1BBP A;  3UEV A;  4ZFX A;  2LB6 A;  3NX1 A;  3SAO A;  4IB6 A;  2MM3 A;  2L5P A;  4TKB A;  2YG2 A;  5L8N A;  4ZR2 A;  5HA0 A;  2N93 A;  4MVI A;  2CBR A;  4K19 A;  4D6B A;  3ELZ A;  4HPB A;  4NNT A;  5HZ8 A;  2CM4 A;  1HMT A;  4XMH A;  4YH0 A;  3UEX A;  1QQS A;  4NLI A;  4QYP A;  3WJD A;  1EUO A;  1XKI A;  2WEW A;  3FA8 A;  4LKT A;  5D45 A;  4NNS A;  3BLG A;  4QZU A;  5FEN A;  3O22 A;  2AT0 X;  1O1V A;  1X8Q A;  3JSQ A;  4TNN A;  3ZUI A;  3CBS A;  1U0X A;  4XME A;  4Y0R A;  3HWF A;  3TF6 A;  1FEM A;  1QG5 A;  4YGG A;  1TXL A;  4YFQ A;  4ZH9 A;  1KT5 A;  1KT3 A;  2FLJ A;  4YGH A;  4GET A;  1ALB A;  3PH6 A;  3MVF A;  3C77 X;  3EYC A;  4I9S A;  2NP1 A;  5HZ5 A;  1DZK A;  4LZV A;  3P6C A;  1EW3 A;  3WJE A;  1GM6 A;  1MX7 A;  1HBQ A;  3NPO A;  1HN2 A;  4ORY A;  1YWD A;  3P6D A;  1P6P A;  1QY0 A;  1T0V A;  4YFR A;  2AT8 X;  5F6B A;  4ARH A;  2X46 A;  4UU2 A;  5H9K A;  1QFT A;  4ORR A;  3TZS A;  5HZ6 A;  4YDA A;  3FW4 A;  1AQB A;  2OZQ A;  4AZM A;  1PEE A;  1A57 A;  2RA6 A;  3NQ9 A;  1EII A;  1LIB A;  1ZRY A;  4R0B A;  4ODD A;  2WUT A;  1ZNL A;  2CM9 A;  4DQ4 A;  1LIC A;  4YCH A;  5LKE A;  2A3F X;  4ORS A;  3KFH A;  1SXY A;  1U17 A;  1SXX A;  1EXS A;  3WBG A;  1BM5 A;  4Y0Q A;  1IKE A;  3P6H A;  3C76 X;  1IFC A;  5B27 A;  4XMD A;  4IB8 A;  2F73 A;  3APW A;  1OBQ A;  3VG2 A;  2RCQ A;  4NP1 A;  1O1U A;  5D8J A;  5BVS A;  2RD7 C;  3P6F A;  1SA8 A;  5LJB A;  1FEN A;  4ZH6 A;  5HCC C;  5D4A A;  1I06 A;  5DG4 A;  3EBK A;  1RBP A;  3O19 A;  4PSQ A;  1SY0 A;  1JYD A;  3FEP A;  1BWY A;  1BEB A;  1BLR A;  3T1D A;  1E02 A;  3FR2 A;  1YUP A;  5BVT A;  1T68 X;  1KQX A;  2LBA A;  3BX7 A;  1X89 A;  1U18 A;  1OPA A;  3O2Y A;  1LIF A;  5HAE A;  1KGL A;  3L4R A;  1URE A;  4ALO A;  2OVE A;  1LFO A;  1NGL A;  2K62 A;  3RSW A;  4DQ3 A;  3FA9 A;  3P6E A;  2MO5 A;  3WJG A;  2AKQ A;  1DFV A;  2OVD A;  4MVK A;  1G7N A;  4BOE A;  3B2H A;  2L68 A;  4WFU A;  5F6Z A;  1FEL A;  3WXQ A;  4OS0 A;  2CZU A;  5LJE A;  4YGZ A;  3AKM A;  4IMN A;  4YKM A;  5HBS A;  2EU7 X;  5FFH A;  2FRS A;  5IO7 A;  4TJZ A;  1O8V A;  3VG4 A;  3I0A A;  1OEK A;  4OS8 A;  3UEU A;  4GH7 A;  2AT3 X;  3FEK A;  1QY1 A;  1SY1 A;  1YWB A;  5BVQ A;  3S26 A;  3P6G A;  4IMO A;  1JZU A;  1QAB E;  3Q6L A;  1YP7 A;  1IIU A;  1BSQ A;  4I3C A;  2IFB A;  5HWZ A;  3FIQ A;  3NQ3 A;  1JBH A;  3STM X;  1YP6 A;  1MUP A;  5EDC A;  5EDB A;  4KII A;  4ORX A;  2R73 A;  2ASN X;  3D96 A;  2WSJ A;  2DM5 A;  3KFF A;  5HTD A;  1ICN A;  1Z24 A;  1MDC A;  1I04 A;  5EED A;  1HMS A;  3U9P C;  3STK A;  4A1H A;  2ALL X;  1KQW A;  1SXW A;  4I3D A;  1B8E A;  3UEW A;  4ZHF A;  1AB0 A;  2POA A;  2L67 A;  1OBP A;  1XCA A;  3WJB A;  5IO6 A;  3FLL A;  5L8I A;  4M7M A;  5KIC A;  1ZNH A;  4HPC A;  1T8V A;  2FTB A;  4ZCB A;  1DC9 A;  2A2U A;  4YMY A;  1DF3 A;  1S2P A;  1CRB A;  4LZU A;  1E5P A;  2GC9 A;  4NLJ A;  2G79 A;  3KZA A;  1GT3 A;  3BRN A;  1YIV A;  4NYR A;  2A13 A;  2R56 A;  2W2A A;  1LNM A;  2Q2M A;  2MJI A;  5CE4 A;  5EPQ A;  4Y0P A;  5H9N A;  3AKN A;  3VG3 A;  1X8U A;  4AZQ A;  4QGV A;  3IA8 A;  3G7X A;  4YBP A;  5B29 A;  2E4J A;  4EFG A;  4BVM A;  1JJX A;  1NP4 A;  2AT6 X;  3F9D A;  2A2G A;  2FS7 A;  1JV4 A;  5F58 A;  4BQU A;  1KZW A;  2NND A;  1BSO A;  3APX A;  4QZT A;  2FT9 A;  1D3S A;  1BSY A;  3CMP A;  5F1E A;  3APU A;  2JU3 A;  1OEJ A;  2JU8 A;  2RCT A;  3TGA A;  2WQ9 A;  5H8T A;  1YWC A;  2QM9 A;  1OBU A;  3FR5 A;  3PH5 A;  1ACD A;  1PBO A;  4D6A A;  1LF7 A;  2JN3 A;  1X8N A;  3C78 X;  4GRJ A;  4RUU A;  1DZM A;  2A0A A;  1ZND A;  2L9C A;  4N7D A;  1FTP A;  2Q39 A;  1AVG I;  1LIE A;  4N7C A;  5D47 A;  3OJY C;  2AH7 X;  3QKG A;  2FR2 A;  4GKC A;  2Q9S A;  3PED A;  1IFB A;  5HCE C;  3FR4 A;  3D97 A;  1GKA B;  1TOU A;  1KT6 A;  2CZT A;  2QO5 A;  5EEE A;  4ZJ0 A;  5LJC A;  3STN A;  2LFO A;  3FMZ A;  1L6M A;  5C0N A;  3B2L A;  3CWK A;  1B0O A;  4OS3 A;  4ZHC A;  3EMM A;  3MBT A;  2NNE A;  3BDR A;  1KT7 A;  4IBA A;  1HBP A;  1OPB A;  1ADL A;  4NYQ A;  1S7D A;  4IAW A;  5HTE A;  1CBI A;  1JJJ A;  1MVG A;  1DZP A;  2PY1 A;  1HMR A;  2Q2P A;  3BSZ E;  1G74 A;  2HMB A;  2XKL A;  1E00 A;  4I3B A;  2KT4 B;  1B4M A;  1PMP A;  1DV9 A;  1ZNG A;  3DSZ A;  4WFV A;  4O9S A;  4QAE A;  3CQR A;  4ZGU A;  2XST A;  4I9R A;  2KTD A;  1OEE A;  3WJC A;  3D95 A;  1CJ5 A;  4EEJ A;  2LKK A;  4EXZ A;  3I17 A;  1KOI A;  2LBV A;  3B2K A;  5HA1 A;  4ZHH A;  5FAZ A;  3HWG A;  3DTQ A;  1BRP A;  5JR8 A;  4HPA A;  4TKH A;  5HZQ A;  1H91 A;  1KXO A;  2QO4 A;  2JOZ A;  3FA6 A;  4YCE A;  2WR6 A;  1JYJ A;  2GTF X;  2AMM X;  2HZQ A;  3BX8 A;  4A60 A;  3IFB A;  3KFG A;  4ZHD A;  3CQN A;  4IB9 A;  4ALB A;  2ACO A;  2OFM X;  4AZP A;  4QGW A;  2K23 A;  2Q4N A;  5F7G A;  3B2J A;  1VYG A;  1LKE A;  5D48 A;  2HYS A;  1ZNK A;  4GNW A;  3K3L A;  1I05 A;  2FS6 A;  4TLJ A;  1EIO A;  1BJ7 A;  2WWP A;  1ML7 A;  1N0S A;  2NNQ A;  1A18 A;  1LID A;  3WVM A;  4ES7 A;  4ZHG A;  1R0U A;  1GX9 A;  3HWD A;  1QFV A;  2WEX A;  2FWV A;  3KFI A;  1CBS A;  1DZJ A;  1KZX A;  1PM1 X;  3BY0 A;  1VPR A;  1I4U A;  3CBC A;  3HK1 A;  4QYN A;  4A8Z A;  1ICM A;  5KHP A;  1A2D A;  1QWD A;  2BLG A;  3KQ0 A;  1TVQ A;  1LPJ A;  3U0D A;  1EQD A;  1SY2 A;  1G85 A;  2AT5 X;  4AYH A;  3BU9 A;  5LKF A;  4A1Y A;  3VG6 A;  2HNX A;  4UU3 A;  4QGX A;  1FE3 A;  3FEN A;  3JS1 A;  4YKO A;  1E06 A;  4Y0S A;  4CK4 A;  2ANS A;  2X45 A;  3FEL A;  2GJ5 A;  2W2F A;  3NP1 A;  1D2U A;  1FDQ A;  3VG5 A;  1B56 A;  4LKP A;  2HZR A;  4XMG A;  2OVA A;  4XMF A;  2JU7 A;  3PPT A;  5K06 A;  2G7B A;  2FR3 A;  4MVL A;  3BS2 A;  3NR3 A;  3PEC A;  2OFR X;  3TGC A;  1QY2 A;  1GT1 A;  1MX8 A;  3F8A A;  1GKA A;  3RZY A;  4AW8 A;  4YDB A;  1EPA A; 
#chains in the Genus database with same CATH topology
 3CR6 A;  4PJ2 A;  1ERB A;  2RTI B;  5L8O A;  5LJH A;  3HWE A;  2P8G A;  2ACP X;  4IAB A;  4ML7 B;  3ZI8 A;  3NAD A;  2G78 A;  1AEL A;  1VYF A;  2RTK A;  4XMC A;  2RQ0 A;  2CBS A;  2OY7 A;  3PP6 A;  1VWC B;  1SWP A;  1KT4 A;  2ZAG A;  5DPQ A;  3OBL A;  4BJ8 A;  2OF8 A;  1EAL A;  4M6S A;  3WJF A;  1GX8 A;  4YBU A;  1G5W A;  4EDE A;  1GT5 A;  4OMX A;  2RTO B;  4GNY A;  5IO5 A;  4ORW A;  4AZN A;  4IB7 A;  1A3Y A;  4OEL A;  4BBO A;  2MWH A;  1SY3 A;  4IAX A;  4GE1 A;  5EZ2 A;  1BRQ A;  2BT9 A;  1CBQ A;  4L3R A;  4HFO A;  3APV A;  1GXA A;  3SLT A;  1SWS A;  2X8F A;  3EBW A;  3NX2 A;  1VWP B;  1IKJ A;  1X8P A;  1X8O A;  2F01 A;  3QQ2 A;  4ORU A;  5AQ6 A;  3SZH A;  4GJV A;  1ERX A;  5HCD C;  1TOW A;  1RXK A;  1STS B;  1SWT A;  4HPD A;  3LTW A;  3ELX A;  4U9C A;  1PTS A;  4IRW A;  3T2X A;  3VE2 A;  3T6L A;  1OSP O;  4AZR A;  1S44 A;  2HLV A;  4GU8 A;  1CBR A;  3TGB A;  3MG5 A;  3OE3 A;  1YWA A;  3PQS A;  2AL0 X;  1EPB A;  1SWA A;  4AZO A;  3GE2 A;  2R74 A;  2W2B A;  2Y3E A;  2GH7 A;  1SWC A;  4BX7 A;  4O3W A;  1VWN B;  4TKJ A;  3U03 A;  2GTL M;  2QO6 A;  2X34 A;  1IW2 A;  3FW5 A;  2JW1 A;  2C1Q A;  1VWK B;  5B10 O;  4MIS A;  5H9A A;  4O4X A;  2RTD B;  1SXU A;  2AF5 A;  4WBK A;  2QOS C;  1SRJ A;  4KCA A;  5L3Y A;  2O62 A;  1TW4 A;  1SMP I;  3ZW1 A;  3NQK A;  1X71 A;  5LJG A;  3HOE A;  2IZH B;  2C1S A;  1NP1 A;  3T2W A;  3EM0 A;  4OMW A;  2RTM A;  3ZUO A;  4RUN A;  3VG7 A;  1GGL A;  3BU1 A;  2X8T A;  2IZG B;  1RLB E;  1GT4 A;  3B2I A;  1W4T A;  1Y55 X;  5H9L A;  1UZ2 X;  1SRH A;  1HQP A;  1VWJ B;  4YFP A;  5LJK A;  2WQA E;  3FA7 A;  5HZ9 A;  5F2B A;  4DNE A;  3GAQ A;  1ZNE A;  5LJD A;  4TQ2 A;  2X32 A;  1BBP A;  3UEV A;  3SLO A;  4ZFX A;  2LB6 A;  3NX1 A;  3CKG A;  3OD9 A;  3SAO A;  4IB6 A;  2MM3 A;  2L5P A;  4TKB A;  3T6F A;  1AVD A;  2YG2 A;  5L8N A;  1FJ1 E;  4ZR2 A;  3VGW A;  5HA0 A;  2OFA A;  2N93 A;  2IZI A;  4MVI A;  2CBR A;  4K19 A;  4D6B A;  3ELZ A;  4HPB A;  4NNT A;  4ON1 A;  1NBX A;  4MIR A;  5HZ8 A;  4BX5 B;  2A8G A;  1HMT A;  2CM4 A;  4XMH A;  2JMB A;  4YH0 A;  3UEX A;  1QQS A;  4NLI A;  4QYP A;  2RTR B;  1W5R A;  3WJD A;  1EUO A;  1XKI A;  2WEW A;  3FA8 A;  2BSZ A;  4LKT A;  1MK5 A;  4U8U M;  5D45 A;  1N9M A;  2ZAI A;  3BLG A;  4NNS A;  1SWB A;  4QZU A;  1Y53 X;  5FEN A;  3O22 A;  2AT0 X;  1O1V A;  1X8Q A;  3JSQ A;  2A5B A;  1VWG B;  4TNN A;  1N9Y A;  5B2A O;  3CBS A;  3RDU A;  1U0X A;  3ZUI A;  4BX6 A;  2MHD A;  4XME A;  3HWF A;  4Y0R A;  3TF6 A;  1FEM A;  1QG5 A;  4NV8 A;  4YGG A;  1LCZ A;  1TXL A;  4YFQ A;  4ZH9 A;  3WYQ A;  4GZV A;  1KT5 A;  1KT3 A;  1VWE B;  2FLJ A;  4YGH A;  4GGT A;  2X55 A;  4GET A;  1ALB A;  3PH6 A;  4C5P A;  3MVF A;  3C77 X;  3EYC A;  4I9S A;  4CSB A;  2NP1 A;  5HZ5 A;  1DZK A;  4LZV A;  3P6C A;  4LQZ A;  1EW3 A;  1SRF A;  2OVS A;  1GM6 A;  4FGI B;  1JJU A;  3WJE A;  4CPF A;  1MX7 A;  3N91 A;  1HBQ A;  1GX3 A;  2KTS A;  1HN2 A;  3NPO A;  1VWQ B;  1YWD A;  1P6P A;  3P6D A;  4JGL A;  4ORY A;  2KW1 A;  2X56 A;  1QY0 A;  1RAV A;  1SRG A;  1T0V A;  4EQA C;  4YFR A;  2AT8 X;  5F6B A;  4ARH A;  1SLF B;  2X46 A;  3KVN A;  4UU2 A;  5H9K A;  1LDQ A;  3RY2 A;  2OFB A;  1EI5 A;  5FQ7 E;  1LDO A;  1QFT A;  4ORR A;  2CAM A;  4O4S A;  3TZS A;  5HZ6 A;  4YDA A;  3FW4 A;  1AQB A;  2OZQ A;  4AZM A;  1PEE A;  1IJ8 A;  2FHN X;  2RA6 A;  3NQ9 A;  1LIB A;  1A57 A;  1EII A;  1ZRY A;  4R0B A;  4ODD A;  4KC7 A;  2WUT A;  1ZNL A;  2CM9 A;  1VWO B;  1MEP A;  4DQ4 A;  3EW2 A;  1LIC A;  2OL8 O;  4YCH A;  5LKE A;  2A3F X;  4ORS A;  3KFH A;  1SXY A;  1U17 A;  2OY1 O;  4U8U O;  3WZQ A;  1SXX A;  2UZ2 A;  3VHI A;  1EXS A;  3WBG A;  4U8U N;  2RTJ A;  2VFC A;  4Y0Q A;  5K68 A;  1BM5 A;  1IKE A;  3P6H A;  2Y3F A;  3X00 A;  3C76 X;  1IFC A;  5B27 A;  4XMD A;  2IZD B;  3VU1 A;  4IB8 A;  2F73 A;  3APW A;  3ZZV A;  1OBQ A;  2RTQ B;  3VG2 A;  1WUB A;  2IZF B;  2RCQ A;  4NP1 A;  1O1U A;  5D8J A;  5BVS A;  1W6F A;  2RD7 C;  4O4U A;  5AEO A;  1LUQ A;  3P6F A;  1SA8 A;  3S60 A;  1FEN A;  5LJB A;  4ZH6 A;  5HCC C;  5D4A A;  1RST B;  4JO6 A;  2VDF A;  1I06 A;  1SLG B;  4L1N A;  3V8U A;  1CJ5 A;  5DG4 A;  3EBK A;  1RBP A;  3RWX A;  1E2T A;  3O19 A;  2JGS A;  4PSQ A;  1HY2 A;  1SY0 A;  2AVI A;  1JYD A;  3FEP A;  3SLJ A;  1BEB A;  1BLR A;  3T1D A;  1BWY A;  1SWR A;  1E02 A;  3FYF A;  1LEL A;  1UYO X;  1KL4 A;  1YUP A;  3FR2 A;  1N4J A;  1VWH B;  5BVT A;  1T68 X;  4QRL A;  1KQX A;  3H3I A;  4MVE A;  2LBA A;  2ZSC A;  3BX7 A;  1X89 A;  1U18 A;  1OPA A;  4KC8 A;  4Y59 A;  2F09 A;  4CPH B;  4GDA A;  1Y52 X;  2M4L A;  3O2Y A;  1NQN A;  1LIF A;  3E3C A;  4O3Y A;  5HAE A;  3L4R A;  1KGL A;  1SLD B;  1URE A;  2Z4H A;  4ALO A;  2OVE A;  2G8C O;  1LFO A;  1VWL B;  1NGL A;  1SWU A;  2K62 A;  3ZW0 B;  3WZO A;  3RSW A;  3RY1 A;  4DQ3 A;  5K67 A;  3FA9 A;  3EC5 A;  3P6E A;  2MO5 A;  1AVE A;  3WJG A;  2AKQ A;  1DFV A;  2OVD A;  4MVK A;  1G7N A;  1SWJ A;  4BOE A;  2FKG A;  3B2H A;  2FGS A;  2L68 A;  4WFU A;  5F6Z A;  1FEL A;  3WXQ A;  4OS0 A;  3AEH A;  4U3Q A;  2CZU A;  5LJE A;  1JMZ A;  4YGZ A;  4CV7 A;  1SLE B;  3AKM A;  4IMN A;  1RXJ A;  4KT5 A;  2RTN B;  4YKM A;  3RDS A;  4KH8 A;  4ZHF A;  4GGZ A;  2YMS A;  5HBS A;  2EU7 X;  5FFH A;  3MM0 A;  2FRS A;  5IO7 A;  4TJZ A;  1O8V A;  1Y9T A;  2RTE B;  3VG4 A;  4O4O A;  3I0A A;  1OEK A;  3EW1 A;  2VFB A;  4B55 A;  5B11 O;  4OS8 A;  3UEU A;  4GH7 A;  4BX5 A;  2FKJ A;  5FQ6 E;  3RKG A;  2AT3 X;  3FEK A;  1QY1 A;  1SY1 A;  1YWB A;  2RTH B;  5BVQ A;  3P6G A;  4IMO A;  4I95 A;  3S26 A;  4Z2O A;  2C4I A;  1JZU A;  4GUZ A;  1QAB E;  1SWE A;  1I78 A;  1SWN A;  2IZE B;  1YP7 A;  3Q6L A;  4BCS A;  1IIU A;  1STR B;  1BSQ A;  2IFB A;  4I3C A;  3FIQ A;  3NQ3 A;  4JHQ A;  5HWZ A;  2X8S A;  1JBH A;  3STM X;  1YP6 A;  1MUP A;  5EDC A;  5EDB A;  4CDE A;  4KII A;  3LHN A;  2A5C A;  4ORX A;  3RBY A;  2R73 A;  2ASN X;  3D96 A;  2WSJ A;  2MF6 A;  2DM5 A;  3KFF A;  2FHL A;  5HTD A;  1ICN A;  1Z24 A;  1MDC A;  1I04 A;  1SRE A;  5EED A;  3VPJ E;  3WOV A;  4BGF A;  1HMS A;  3U9P C;  3STK A;  4A1H A;  2ALL X;  2GTL O;  1KQW A;  2IZC B;  2GTL N;  1SXW A;  4I3D A;  1B8E A;  5CSE A;  3UEW A;  4O3X B;  1AB0 A;  2POA A;  2L67 A;  1OBP A;  1XCA A;  3AUM O;  3Q34 A;  3WJB A;  4CDC A;  4MEE A;  5IO6 A;  3FLL A;  5L8I A;  4M7M A;  5KIC A;  2OYB O;  4DCB A;  1ZNH A;  4HPC A;  1T8V A;  2FTB A;  4ZCB A;  1DC9 A;  2A2U A;  5IRA A;  4YMY A;  1DF3 A;  1S2P A;  1CRB A;  4LZU A;  1E5P A;  1UYN X;  2GC9 A;  5BYP A;  4NLJ A;  1VWD B;  2G79 A;  2IZJ A;  3KZA A;  4Z6J A;  1GT3 A;  3BRN A;  1YIV A;  4NYR A;  2A13 A;  2R56 A;  3FID A;  2KD2 A;  2W2A A;  1RXH A;  1LNM A;  3WYP A;  4O49 A;  2Q2M A;  2QMI A;  2MJI A;  5CE4 A;  5EPQ A;  4Y0P A;  5H9N A;  2RN4 A;  3AKN A;  1X8U A;  2IZA A;  4OEM A;  3IA8 A;  3VG3 A;  4AZQ A;  4QGV A;  3G7X A;  1NQM A;  4YBP A;  5B29 A;  2E4J A;  5AJB A;  4BVM A;  4EFG A;  1JJX A;  1NP4 A;  2AT6 X;  3F9D A;  2A2G A;  4FQB B;  1SWQ A;  2FS7 A;  1JV4 A;  5F58 A;  4BQU A;  1KZW A;  2NND A;  2BC3 A;  1BSO A;  3APX A;  2BHV A;  4QZT A;  2FT9 A;  1D3S A;  2HKD A;  1BSY A;  4Z27 A;  3CMP A;  5F1E A;  3APU A;  5KID A;  2JU3 A;  1SWH A;  1OEJ A;  2JU8 A;  2RCT A;  3TGA A;  2WQ9 A;  5H8T A;  1YWC A;  2QM9 A;  1OBU A;  3FR5 A;  3PH5 A;  1ACD A;  1PBO A;  4NW4 A;  4D6A A;  1LF7 A;  1PBY A;  3RDQ A;  2JN3 A;  1X8N A;  2RTL A;  3PQU A;  4U46 A;  1DF8 A;  3C78 X;  2WPU A;  4GRJ A;  4QQ1 A;  4RUU A;  5FQ8 E;  1HQQ A;  1DZM A;  2A0A A;  2OL7 A;  1ZND A;  2L9C A;  4N7D A;  3VHM A;  1NC9 A;  4Z28 A;  1FTP A;  2Q39 A;  1AVG I;  1LIE A;  4N7C A;  2I5Z O;  5D47 A;  3OJY C;  2AH7 X;  1VWA B;  3QKG A;  2FR2 A;  4GKC A;  2Q9S A;  3PED A;  1IFB A;  3ZW2 A;  3RDO A;  5HCE C;  2Y32 A;  3FR4 A;  3D97 A;  5B5F A;  1GKA B;  1TOU A;  4CPH A;  1KT6 A;  1SWF A;  2CZT A;  2QO5 A;  2BS5 A;  5EEE A;  4ZJ0 A;  5LJC A;  3STN A;  4OKA A;  1MOY A;  2LFO A;  3FMZ A;  1L6M A;  5C0N A;  4YVB A;  1JQP A;  3B2L A;  3CWK A;  1B0O A;  4OS3 A;  4ZHC A;  3ZW0 A;  3EMM A;  4CDD A;  3MBT A;  2IZL B;  4Z2V A;  2NNE A;  2QCB A;  3BDR A;  4Z2P A;  2IZB A;  1KT7 A;  4IBA A;  1HBP A;  1OPB A;  1ADL A;  4NYQ A;  1S7D A;  4IAW A;  5HTE A;  1CBI A;  5CYB A;  1JJJ A;  3F6Z B;  1MVG A;  3D4R A;  5IRU A;  2Z4I A;  1DZP A;  1JIW I;  3D9W A;  2PY1 A;  1HMR A;  2Q2P A;  3BSZ E;  5AJC A;  4WHI A;  1G74 A;  2G5L A;  2HMB A;  1E00 A;  2XKL A;  3P24 A;  3ZWE A;  4I3B A;  5IXG A;  3NBX X;  4JNJ A;  2RTC B;  4FBV A;  2KT4 B;  1B4M A;  4CDF A;  2OL6 O;  1PMP A;  1DV9 A;  1ZNG A;  1VWB B;  3DSZ A;  3VE1 A;  2OF9 A;  4Y5D A;  2RTB B;  3RDX A;  4WFV A;  4O9S A;  4QAE A;  3CQR A;  3WZP A;  2XST A;  4GGR A;  4ZGU A;  4I9R A;  2KTD A;  1OEE A;  2RTG B;  4NV7 A;  3WJC A;  3D95 A;  2RTA A;  5JD2 A;  3RDM A;  1VWR B;  2LKK A;  3MX7 A;  4BX7 B;  3I17 A;  1KOI A;  4EEJ A;  3VHH A;  1WBI A;  4EXZ A;  2LBV A;  3B2K A;  1KL5 A;  5CHK A;  5HA1 A;  1SWG A;  4ZHH A;  5FAZ A;  3RE6 A;  3HWG A;  3DTQ A;  3ZW1 B;  1VWI B;  1BRP A;  3S5V A;  5JR8 A;  4FBR A;  1N7Y A;  4HPA A;  4TKH A;  1VWM B;  1H91 A;  1KXO A;  5HZQ A;  2QO4 A;  2JOZ A;  3FA6 A;  4YCE A;  2WR6 A;  1JYJ A;  1VWF B;  2GTF X;  2AMM X;  2HZQ A;  3BX8 A;  2PI3 O;  4A60 A;  3IFB A;  3PDF A;  3KFG A;  4ZHD A;  3CQN A;  4IB9 A;  4INN A;  4ALB A;  1JMX A;  2ACO A;  2OFM X;  4AZP A;  4QGW A;  2K23 A;  2Q4N A;  3PK2 A;  4GK9 A;  3B2J A;  3P02 A;  5F7G A;  3S5X A;  1VYG A;  1LKE A;  2IZK A;  5D48 A;  2HYS A;  1ZNK A;  1SWK A;  4GNW A;  4I60 A;  3K3L A;  4CPI A;  1I9H A;  1I05 A;  3HTY A;  2FS6 A;  4TLJ A;  1K3B A;  1EIO A;  1BJ7 A;  2WWP A;  1ML7 A;  4GD9 A;  5B5G A;  3RE5 A;  4QNI A;  1N0S A;  3HOL A;  3JQO A;  1RSU B;  1STP A;  2NNQ A;  1A18 A;  1LID A;  3SOT A;  3WVM A;  1LCW A;  4ES7 A;  4ZGF A;  2LA7 A;  4ZHG A;  1R0U A;  2DJF A;  1SWL A;  2RTP B;  1GX9 A;  3HWD A;  1QFV A;  2WEX A;  3HPE A;  4ID2 A;  2FWV A;  4BX6 B;  3KFI A;  4EKV A;  4I6S A;  1CBS A;  1DZJ A;  1KZX A;  1PM1 X;  3BY0 A;  1VPR A;  1I4U A;  2DJG A;  3CBC A;  3HK1 A;  4QYN A;  1K24 A;  4A8Z A;  4HWM A;  1VYO A;  1ICM A;  2OY5 O;  5KHP A;  1A2D A;  1QWD A;  2BLG A;  3KQ0 A;  1TVQ A;  4FBO A;  1LPJ A;  3U0D A;  1EQD A;  1SY2 A;  1G85 A;  2AT5 X;  3ZQ3 A;  5IRW A;  4AYH A;  4CPE A;  2BS6 A;  3BU9 A;  5LKF A;  3VG6 A;  2HNX A;  4UU3 A;  4QGX A;  4A1Y A;  1MM9 A;  1FE3 A;  1NDJ A;  2UYW A;  3CKF A;  3FEN A;  3JS1 A;  1SWO A;  2X4M A;  1N43 A;  1E06 A;  4Y0S A;  4YKO A;  3SZI A;  3UAQ A;  4CK4 A;  1KL3 A;  2ANS A;  2X45 A;  3FEL A;  1HXL A;  2GJ5 A;  2W2F A;  3NP1 A;  1D2U A;  1FDQ A;  3VG5 A;  4COT A;  1B56 A;  4LKP A;  3LV4 A;  1Y0G A;  1SWD A;  2HZR A;  4XMG A;  3SZJ A;  2OVA A;  4O3Z A;  1LCV A;  2JU7 A;  2OY8 A;  3PPT A;  4XMF A;  5K06 A;  2QOM A;  2G7B A;  4GDZ A;  2FR3 A;  1SRI A;  3BS2 A;  4MVL A;  1Y9L A;  3NR3 A;  1HXZ A;  3PEC A;  3WZN A;  2OFR X;  3FDC A;  3TGC A;  5B3M O;  2RTF B;  1QY2 A;  1GT1 A;  1MX8 A;  2I5V O;  1GKA A;  3F8A A;  1KFF A;  3RZY A;  4AW8 A;  4YDB A;  1EPA A;  4GJS A; 
#chains in the Genus database with same CATH homology
 3CR6 A;  4PJ2 A;  1ERB A;  5L8O A;  5LJH A;  3HWE A;  2P8G A;  2ACP X;  4IAB A;  4ML7 B;  3ZI8 A;  3NAD A;  2G78 A;  1AEL A;  1VYF A;  4XMC A;  2RQ0 A;  2CBS A;  5KID A;  3PP6 A;  5DPQ A;  1KT4 A;  2ZAG A;  1EAL A;  3OBL A;  4M6S A;  3WJF A;  1GX8 A;  4YBU A;  1G5W A;  4EDE A;  1GT5 A;  4OMX A;  4GNY A;  5IO5 A;  4ORW A;  4AZN A;  4IB7 A;  1A3Y A;  2MWH A;  1SY3 A;  4IAX A;  4GE1 A;  5EZ2 A;  1BRQ A;  2BT9 A;  1CBQ A;  4L3R A;  4HFO A;  3APV A;  1GXA A;  3EBW A;  2X8F A;  3NX2 A;  4ORU A;  1X8P A;  1IKJ A;  3ZQ3 A;  1X8O A;  5AQ6 A;  1ERX A;  5HCD C;  1TOW A;  4HPD A;  3ELX A;  4U9C A;  3VE2 A;  4AZR A;  1S44 A;  2HLV A;  4GU8 A;  1CBR A;  3TGB A;  3OE3 A;  1YWA A;  3PQS A;  2AL0 X;  1EPB A;  4AZO A;  3GE2 A;  2R74 A;  2W2B A;  4O3W A;  4TKJ A;  3U03 A;  2GTL M;  2QO6 A;  1IW2 A;  3FW5 A;  2JW1 A;  4MIS A;  5H9A A;  4O4X A;  1SXU A;  4WBK A;  2QOS C;  4KCA A;  2O62 A;  1TW4 A;  1SMP I;  3ZW1 A;  3NQK A;  1X71 A;  5LJG A;  3HOE A;  1NP1 A;  3EM0 A;  4OMW A;  3ZUO A;  4RUN A;  3VG7 A;  1GGL A;  3BU1 A;  2X8T A;  1RLB E;  1GT4 A;  3B2I A;  5H9L A;  1UZ2 X;  1HQP A;  5LJK A;  4YFP A;  2WQA E;  3FA7 A;  5HZ9 A;  3GAQ A;  1ZNE A;  5LJD A;  4TQ2 A;  1BBP A;  3UEV A;  4ZFX A;  2LB6 A;  3NX1 A;  3OD9 A;  3SAO A;  4IB6 A;  2MM3 A;  2L5P A;  4TKB A;  2YG2 A;  5L8N A;  4ZR2 A;  5HA0 A;  2N93 A;  4MVI A;  2CBR A;  4K19 A;  4D6B A;  3ELZ A;  4HPB A;  4NNT A;  4ON1 A;  4MIR A;  5HZ8 A;  2CM4 A;  1HMT A;  4XMH A;  2JMB A;  4YH0 A;  3UEX A;  1QQS A;  4NLI A;  4QYP A;  3WJD A;  1EUO A;  1XKI A;  2WEW A;  3FA8 A;  4LKT A;  4U8U M;  5D45 A;  2ZAI A;  3BLG A;  4NNS A;  4QZU A;  5FEN A;  3O22 A;  2AT0 X;  1O1V A;  1X8Q A;  3JSQ A;  4TNN A;  3ZUI A;  3CBS A;  1U0X A;  2MHD A;  4XME A;  3HWF A;  4Y0R A;  3TF6 A;  1FEM A;  1QG5 A;  4YGG A;  1TXL A;  4YFQ A;  4ZH9 A;  4GZV A;  1KT5 A;  1KT3 A;  2FLJ A;  4YGH A;  4GET A;  1ALB A;  3PH6 A;  3MVF A;  3C77 X;  3EYC A;  4I9S A;  4CSB A;  2NP1 A;  5HZ5 A;  1DZK A;  4LZV A;  3P6C A;  4LQZ A;  1EW3 A;  2OVS A;  4FGI B;  1GM6 A;  3WJE A;  1MX7 A;  3N91 A;  1HBQ A;  2KTS A;  1HN2 A;  3NPO A;  1YWD A;  3P6D A;  1P6P A;  4JGL A;  4ORY A;  2KW1 A;  1QY0 A;  1T0V A;  4EQA C;  4YFR A;  2AT8 X;  5F6B A;  4ARH A;  2X46 A;  4UU2 A;  5H9K A;  5FQ7 E;  1EI5 A;  1QFT A;  4ORR A;  4O4S A;  3TZS A;  5HZ6 A;  4YDA A;  3FW4 A;  1AQB A;  2OZQ A;  4AZM A;  1PEE A;  1A57 A;  2RA6 A;  3NQ9 A;  1EII A;  1LIB A;  1ZRY A;  4R0B A;  4ODD A;  4KC7 A;  2WUT A;  1ZNL A;  2CM9 A;  4DQ4 A;  1LIC A;  4YCH A;  5LKE A;  2A3F X;  4ORS A;  3KFH A;  1SXY A;  1U17 A;  4U8U O;  1SXX A;  1EXS A;  3WBG A;  4U8U N;  4Y0Q A;  1BM5 A;  1IKE A;  3P6H A;  3C76 X;  1IFC A;  5B27 A;  4XMD A;  3VU1 A;  4IB8 A;  2F73 A;  3APW A;  3ZZV A;  1OBQ A;  3VG2 A;  2RCQ A;  4NP1 A;  1O1U A;  5D8J A;  5BVS A;  2RD7 C;  4O4U A;  5AEO A;  3P6F A;  1SA8 A;  3S60 A;  1FEN A;  5LJB A;  4ZH6 A;  5HCC C;  5D4A A;  1I06 A;  4L1N A;  3V8U A;  5DG4 A;  3EBK A;  1RBP A;  3RWX A;  3O19 A;  4PSQ A;  1SY0 A;  1JYD A;  3FEP A;  1BWY A;  1BEB A;  1BLR A;  3T1D A;  1E02 A;  3FYF A;  3FR2 A;  1YUP A;  5BVT A;  1T68 X;  4QRL A;  1KQX A;  3H3I A;  4MVE A;  2LBA A;  3BX7 A;  4KC8 A;  1X89 A;  1U18 A;  1OPA A;  2F09 A;  2M4L A;  3O2Y A;  1LIF A;  3E3C A;  4O3Y A;  5HAE A;  3L4R A;  1KGL A;  1URE A;  2Z4H A;  4ALO A;  2OVE A;  1LFO A;  1NGL A;  2K62 A;  3ZW0 B;  3RSW A;  4DQ3 A;  3FA9 A;  3P6E A;  2MO5 A;  3WJG A;  2AKQ A;  1DFV A;  2OVD A;  4MVK A;  1G7N A;  4BOE A;  3B2H A;  2L68 A;  4WFU A;  5F6Z A;  1FEL A;  3WXQ A;  4OS0 A;  4U3Q A;  2CZU A;  5LJE A;  4YGZ A;  4CV7 A;  3AKM A;  4IMN A;  4KT5 A;  4YKM A;  4KH8 A;  2YMS A;  5HBS A;  2EU7 X;  5FFH A;  2FRS A;  5IO7 A;  4TJZ A;  1O8V A;  1Y9T A;  3VG4 A;  4O4O A;  3I0A A;  1OEK A;  4OS8 A;  3UEU A;  4GH7 A;  5FQ6 E;  3RKG A;  2AT3 X;  3FEK A;  1QY1 A;  1SY1 A;  1YWB A;  5BVQ A;  3S26 A;  3P6G A;  4IMO A;  4I95 A;  1JZU A;  1QAB E;  3Q6L A;  1YP7 A;  1IIU A;  1BSQ A;  4I3C A;  2IFB A;  5HWZ A;  3FIQ A;  3NQ3 A;  2X8S A;  1JBH A;  3STM X;  1YP6 A;  1MUP A;  5EDC A;  5EDB A;  4KII A;  3LHN A;  4ORX A;  3RBY A;  2R73 A;  2ASN X;  3D96 A;  2WSJ A;  2DM5 A;  3KFF A;  5HTD A;  1ICN A;  1Z24 A;  1MDC A;  1I04 A;  5EED A;  3VPJ E;  3WOV A;  1HMS A;  3U9P C;  3STK A;  4A1H A;  2ALL X;  2GTL O;  1KQW A;  2GTL N;  1SXW A;  4I3D A;  1B8E A;  3UEW A;  4ZHF A;  4O3X B;  1AB0 A;  2POA A;  2L67 A;  1OBP A;  1XCA A;  3WJB A;  5IO6 A;  3FLL A;  5L8I A;  4M7M A;  5KIC A;  1ZNH A;  4HPC A;  1T8V A;  2FTB A;  4ZCB A;  1DC9 A;  2A2U A;  4YMY A;  1DF3 A;  1S2P A;  1CRB A;  4LZU A;  1E5P A;  2GC9 A;  5BYP A;  4NLJ A;  2G79 A;  3KZA A;  1GT3 A;  3BRN A;  1YIV A;  4NYR A;  2A13 A;  2R56 A;  2KD2 A;  2W2A A;  1LNM A;  4O49 A;  2Q2M A;  2QMI A;  2MJI A;  5CE4 A;  5EPQ A;  4Y0P A;  5H9N A;  2RN4 A;  3AKN A;  1X8U A;  3VG3 A;  4AZQ A;  3IA8 A;  4QGV A;  3G7X A;  4YBP A;  5B29 A;  2E4J A;  5AJB A;  4BVM A;  4EFG A;  1JJX A;  1NP4 A;  2AT6 X;  3F9D A;  2A2G A;  4FQB B;  2FS7 A;  1JV4 A;  5F58 A;  4BQU A;  1KZW A;  2NND A;  1BSO A;  3APX A;  2BHV A;  4QZT A;  2FT9 A;  1D3S A;  1BSY A;  3CMP A;  5F1E A;  3APU A;  2JU3 A;  1OEJ A;  2JU8 A;  2RCT A;  3TGA A;  2WQ9 A;  5H8T A;  1YWC A;  2QM9 A;  1OBU A;  3FR5 A;  3PH5 A;  1ACD A;  1PBO A;  4NW4 A;  4D6A A;  1LF7 A;  2JN3 A;  1X8N A;  3PQU A;  3C78 X;  4GRJ A;  4QQ1 A;  4RUU A;  5FQ8 E;  1DZM A;  2A0A A;  1ZND A;  2L9C A;  4N7D A;  1FTP A;  2Q39 A;  1AVG I;  1LIE A;  4N7C A;  5D47 A;  3OJY C;  2AH7 X;  3QKG A;  2FR2 A;  4GKC A;  2Q9S A;  3PED A;  1IFB A;  3ZW2 A;  5HCE C;  3FR4 A;  3D97 A;  1GKA B;  1TOU A;  1KT6 A;  2CZT A;  2QO5 A;  2BS5 A;  5EEE A;  4ZJ0 A;  5LJC A;  3STN A;  2LFO A;  3FMZ A;  1L6M A;  5C0N A;  3B2L A;  3CWK A;  1B0O A;  4OS3 A;  4ZHC A;  3ZW0 A;  3EMM A;  3MBT A;  2NNE A;  3BDR A;  1KT7 A;  4IBA A;  1HBP A;  1OPB A;  1ADL A;  4NYQ A;  1S7D A;  4IAW A;  5HTE A;  1CBI A;  5CYB A;  1JJJ A;  3F6Z B;  1MVG A;  3D4R A;  2Z4I A;  1DZP A;  1JIW I;  2PY1 A;  1HMR A;  2Q2P A;  3BSZ E;  5AJC A;  4WHI A;  1G74 A;  2HMB A;  2XKL A;  1E00 A;  3P24 A;  3ZWE A;  4I3B A;  3NBX X;  4FBV A;  2KT4 B;  1B4M A;  1PMP A;  1DV9 A;  1ZNG A;  3DSZ A;  3VE1 A;  4WFV A;  4O9S A;  4QAE A;  3CQR A;  4ZGU A;  2XST A;  4I9R A;  2KTD A;  1OEE A;  3WJC A;  3D95 A;  1CJ5 A;  3MX7 A;  2LKK A;  4EEJ A;  4EXZ A;  3I17 A;  1KOI A;  2LBV A;  3B2K A;  5HA1 A;  4ZHH A;  5FAZ A;  3HWG A;  3DTQ A;  3ZW1 B;  1BRP A;  3S5V A;  5JR8 A;  4FBR A;  4HPA A;  4TKH A;  5HZQ A;  1H91 A;  1KXO A;  2QO4 A;  2JOZ A;  3FA6 A;  4YCE A;  2WR6 A;  1JYJ A;  2GTF X;  2AMM X;  2HZQ A;  3BX8 A;  4A60 A;  3IFB A;  3KFG A;  4ZHD A;  3CQN A;  4IB9 A;  4INN A;  4ALB A;  2ACO A;  2OFM X;  4AZP A;  4QGW A;  2K23 A;  2Q4N A;  4GK9 A;  5F7G A;  3B2J A;  3P02 A;  1VYG A;  1LKE A;  5D48 A;  2HYS A;  1ZNK A;  4GNW A;  3K3L A;  1I05 A;  3HTY A;  2FS6 A;  4TLJ A;  1EIO A;  1BJ7 A;  2WWP A;  1ML7 A;  4QNI A;  1N0S A;  3HOL A;  3JQO A;  3SOT A;  2NNQ A;  1A18 A;  1LID A;  3WVM A;  4ES7 A;  4ZGF A;  2LA7 A;  4ZHG A;  1R0U A;  1GX9 A;  3HWD A;  1QFV A;  2WEX A;  4ID2 A;  2FWV A;  3KFI A;  4I6S A;  1CBS A;  1DZJ A;  1KZX A;  1PM1 X;  3BY0 A;  1VPR A;  1I4U A;  3CBC A;  3HK1 A;  4QYN A;  4A8Z A;  4HWM A;  1ICM A;  5KHP A;  1A2D A;  1QWD A;  2BLG A;  3KQ0 A;  1TVQ A;  4FBO A;  1LPJ A;  3U0D A;  1EQD A;  1SY2 A;  1G85 A;  2AT5 X;  4AYH A;  2BS6 A;  3BU9 A;  5LKF A;  3VG6 A;  2HNX A;  4UU3 A;  4QGX A;  4A1Y A;  3S5X A;  1FE3 A;  3FEN A;  3JS1 A;  3UAQ A;  4YKO A;  1E06 A;  4Y0S A;  4CK4 A;  2ANS A;  2X45 A;  3FEL A;  2GJ5 A;  2W2F A;  3NP1 A;  1D2U A;  1FDQ A;  3VG5 A;  4COT A;  1B56 A;  4LKP A;  3LV4 A;  2HZR A;  4XMG A;  2OVA A;  4O3Z A;  2JU7 A;  3PPT A;  4XMF A;  5K06 A;  2G7B A;  4GDZ A;  2FR3 A;  4MVL A;  3BS2 A;  1Y9L A;  3NR3 A;  3PEC A;  2OFR X;  3TGC A;  1QY2 A;  1GT1 A;  1MX8 A;  3F8A A;  1GKA A;  3RZY A;  4AW8 A;  4YDB A;  1EPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...