4YDBA

Crystal structure of the r111k:y134f:t54v:r132q:p39q:r59y mutant of human cellular retinoic acid binding protein ii in complex with retinal at 2.03 angstrom -uv irradiated crystal- 3rd cycle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKQAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title A Photoisomerizing Rhodopsin Mimic Observed at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ydbA00
2WQ9A 4YFRA 3ELZA 3WJDA 1YWCA 3PH6A 2POAA 4YCEA 2R73A 4MVLA 1YWAA 3B2HA 4D6BA 1GM6A 4D6AA 4ORYA 4MVKA 4NNTA 4YDBA 3MBTA 1GGLA 1QFTA 1GT3A 1ZNHA 1EXSA 2ANSA 3B2JA 1D2UA 3NX1A 4NLJA 3EYCA 3JS1A 2MM3A 1DV9A 4AZNA 4ZFXA 4Y0QA 1CBRA 3UEWA 2WSJA 3JSQA 5LJGA 3NP1A 4QZUA 1JYJA 1EIIA 1MVGA 4A8ZA 1QY0A 2FLJA 3FR5A 1ML7A 4YBUA 1KXOA 3IFBA 1IFBA 2JU8A 1B56A 1ERBA 2R56A 4XMCA 3FENA 4IMOA 2P8GA 1EPBA 2K23A 4QGVA 4I3BA 3PECA 4MVIA 3OJYC 3O2YA 2PY1A 1BLRA 3I0AA 2W2AA 1N0SA 1LNMA 1BBPA 1MX7A 2XSTA 4YFPA 2JU3A 1U18A 2AT3X 4I3CA 3B2IA 1CJ5A 3PH5A 1GKAB 1GT4A 1G85A 3APVA 2FTBA 2HMBA 5D48A 5LJDA 1OEKA 3MVFA 1H91A 3KFIA 3O22A 4ORXA 4LZUA 3FLLA 2AT8X 2EU7X 3NQ9A 1T0VA 1GX9A 1S7DA 1VYFA 4NYRA 1JJJA 1BSOA 3FW4A 2N93A 5D8JA 1O8VA 5HA0A 3TF6A 1IKJA 5H9AA 1LPJA 2ACOA 4EFGA 2WR6A 5F7GA 1E06A 2FS6A 5L8NA 4YMYA 5C0NA 1X8NA 4XMGA 4OS8A 2WWPA 5EZ2A 4YH0A 4GRJA 5LKEA 3L4RA 5HCDC 4EEJA 3RZYA 1MUPA 4N7DA 4ZHDA 1ZRYA 4M6SA 1E02A 1EPAA 3FELA 4OS3A 3FA9A 5HZ5A 3QKGA 5HZ9A 5L8OA 2DM5A 1A2DA 1ZNLA 1LIEA 1JV4A 4IAXA 2AMMX 1S2PA 4DQ4A 1BSYA 1YIVA 1HN2A 4NYQA 2O62A 5L8IA 4Y0PA 3CWKA 2LBVA 5D45A 1P6PA 4RUUA 5BVTA 5FFHA 2LFOA 1QY1A 2FS7A 2QM9A 1ICMA 2AL0X 2GTFX 2LKKA 4YDAA 1G74A 3CQRA 1OPAA 3HWFA 2BLGA 2OVAA 3B2LA 4AZOA 1OEEA 4IMNA 3ZQ3A 2WQAE 1PM1X 1KT5A 4GNWA 4IB9A 2HZQA 4NLIA 5BVSA 1ZNGA 3HWEA 5AQ6A 1OBQA 4YGZA 2IFBA 4I9SA 4AYHA 3CR6A 1MX8A 1L6MA 4A60A 2ASNX 1R0UA 1TOWA 2WEWA 3FEKA 5B29A 2OFRX 1JJXA 2L67A 1BSQA 4N7CA 3TGAA 3U9PC 1CRBA 3BLGA 1NGLA 3WJEA 4HPAA 1X8QA 3KQ0A 3CBCA 1BJ7A 3FIQA 4OMWA 3NQ3A 4Y0RA 2FWVA 1YWBA 2FRSA 3KZAA 2CZUA 4ZH6A 4QAEA 3C76X 3BSZE 1FENA 4TKHA 2CM4A 1DFVA 4YKMA 1ZNEA 5H8TA 3BU9A 1OPBA 1SY2A 2WEXA 1E00A 1JZUA 4ZHCA 1QFVA 2MJIA 5FAZA 4ALBA 2HYSA 2NNDA 3STNA 4IBAA 3TZSA 1SXWA 4O9SA 1QG5A 1QWDA 4R0BA 1PBOA 4CK4A 1SXYA 1AELA 4AZQA 2FR3A 1OBUA 3C77X 2W2FA 4HPCA 5LJHA 4TKJA 1KOIA 4YFQA 2CBRA 3D96A 3FA7A 5F6BA 1SY0A 2RD7C 1ERXA 3FMZA 1ACDA 3WBGA 2AT6X 2A3FX 5HTEA 3K3LA 1EUOA 3P6DA 5DG4A 3UEVA 1BRPA 3AKMA 4I3DA 4BQUA 5HZ6A 1LIFA 1UZ2X 2HLVA 4TJZA 3WXQA 5F58A 1ICNA 4ES7A 1ZNKA 1IIUA 1SXUA 4M7MA 1HBPA 4OS0A 5HCCC 4IAWA 1LIBA 1FE3A 4PSQA 1FDQA 5HBSA 1BM5A 2LBAA 3BX7A 2Q4NA 2G79A 1I04A 1ADLA 3AKNA 5HTDA 3FA8A 4LZVA 3EM0A 3U0DA 4TKBA 3VG5A 1EALA 3BDRA 1DZKA 1HMSA 5F1EA 2CBSA 3WJCA 2X45A 3KFGA 3BU1A 1NP4A 2FR2A 3EBWA 3VG6A 1LKEA 5K06A 1X89A 3FR2A 2Q2MA 3UEUA 3BS2A 1AB0A 1DF3A 4AZRA 2JN3A 2Q39A 5HZQA 2JU7A 5KIDA 1U17A 4QGXA 5EDCA 4GE1A 2YG2A 1X8PA 1NP1A 1TW4A 2F73A 2CM9A 4NP1A 1FELA 1X8UA 3VG4A 5HZ8A 5LJKA 5EPQA 3GAQA 4WFVA 2NNEA 3P6CA 3P6GA 1YWDA 4GH7A 2E4JA 5D4AA 1I4UA 3HK1A 4UU2A 1D3SA 4ALOA 1S44A 2OZQA 3WJBA 1GT1A 3S26A 2AH7X 4XMDA 2LB6A 1IKEA 4ZCBA 2KT4B 5LKFA 1HQPA 3STKA 1I05A 1RLBE 1PMPA 1B8EA 3NX2A 4ORRA 4IB8A 4A1HA 4EXZA 1A57A 5CE4A 1O1VA 1GKAA 1A18A 1IFCA 2JOZA 4QGWA 1TVQA 4I9RA 5H9LA 3VG3A 4ZH9A 4YGHA 2GC9A 3ELXA 4YBPA 1B0OA 1OBPA 1DZJA 2ACPX 3APWA 3EMMA 4ZGUA 3U03A 4AZMA 1LFOA 1HMTA 1EQDA 2OVEA 2QO6A 4BOEA 4GNYA 1BWYA 3DSZA 2Q9SA 3I17A 3CQNA 1XKIA 4UU3A 1QABE 1KZWA 1U0XA 3IA8A 3FA6A 2ALLX 4GKCA 2WUTA 3RSWA 2OVDA 3VG7A 2OFMX 1SY3A 4ORWA 3BX8A 4IB7A 3P6HA 4Y0SA 5KHPA 2W2BA 2RCQA 1X8OA 2AKQA 4AW8A 2RCTA 2FT9A 4ZHFA 3G7XA 4YKOA 1EIOA 4RUNA 1AQBA 4HPDA 1KGLA 4XMEA 4ZJ0A 4ODDA 1PEEA 3HWGA 3P6FA 3SAOA 3NPOA 2QO5A 3KFHA 5D47A 1YP6A 2L9CA 5H9KA 3HWDA 1DC9A 4ZR2A 4NNSA 5KICA 3TGBA 2Q2PA 1QY2A 3DTQA 5DPQA 2NNQA 3FEPA 4LKPA 1A3YA 1IW2A 2A13A 3BY0A 3P6EA 4EDEA 5HA1A 5H9NA 1CBQA 4YCHA 1X71A 3D97A 1HBQA 4ZHHA 4ORSA 2HNXA 1SXXA 4XMHA 2RA6A 1MDCA 4ORUA 3PEDA 1FTPA 2K62A 1I06A 1LF7A 4QYNA 2AT0X 2R74A 1QQSA 5F6ZA 1LICA 5LJCA 4QYPA 3TGCA 2QO4A 1GXAA 4WBKA 3FR4A 4K19A 5LJBA 3NADA 4YGGA 2L68A 2XKLA 5EEEA 2RQ0A 1OEJA 1XCAA 5HCEC 3F8AA 1TXLA 1ALBA 4DQ3A 3VG2A 5FENA 1KQXA 1SY1A 3APUA 1O1UA 1T68X 5IO5A 5BVQA 3WVMA 3UEXA 2CZTA 1Z24A 3CBSA 1E5PA 3NR3A 4BVMA 1JBHA 1BEBA 1YUPA 4HPBA 1G7NA 3F9DA 5IO7A 1TOUA 4GETA 1DZPA 2G78A 3PP6A 4LKTA 1JYDA 5EDBA 1KT7A 2A2GA 5HAEA 1KT6A 5JR8A 2QOSC 1LIDA 1T8VA 4AZPA 1GT5A 1HMRA 3O19A 5HWZA 4A1YA 2G7BA 4OMXA 1CBSA 1KT4A 1YP7A 2A2UA 4ARHA 4HFOA 1GX8A 2A0AA 3WJFA 1FEMA 2AT5X 3CMPA 3FW5A 2KTDA 3C78X 1VPRA 4QZTA 1B4MA 2X46A 4WFUA 3BRNA 3STMX 4TLJA 3Q6LA 5B27A 1KQWA 1CBIA 2NP1A 1ZNDA 4ZHGA 2HZRA 4XMFA 1KT3A 3D95A 5EEDA 3KFFA 4IB6A 1DZMA 3PPTA 2L5PA 1VYGA 3APXA 4TNNA 1KZXA 3T1DA 3ZUIA 4TQ2A 1BRQA 3WJGA 1EW3A 5LJEA 4KIIA 1RBPA 5IO6A 3EBKA 2MO5A 1G5WA 1UREA 3B2KA 3ZUOA 2GJ5A 1SA8A 1AVGI
chains in the Genus database with same CATH superfamily
3LHNA 2RTJA 3WZOA 5CHKA 2WQ9A 3CKGA 4YFRA 3ELZA 3WJDA 1YWCA 3PH6A 3AUMO 2POAA 4YCEA 2R73A 4HWMA 2GTLO 1YWAA 4MVLA 2QMIA 4O3YA 3B2HA 3PQSA 4D6BA 1GM6A 1EI5A 4OEMA 3RY1A 4D6AA 3RE5A 4BX5A 4ORYA 3V8UA 4MVKA 4I6SA 4NNTA 1SWAA 4ZFXA 2RTQB 4YDBA 5IRUA 1AVEA 3MBTA 4WHIA 1GGLA 4KC7A 1QFTA 1GT3A 1ZNHA 1EXSA 2ANSA 3B2JA 1D2UA 3NX1A 2G8CO 4Z2OA 3SZJA 4NLJA 4I60A 3EW1A 2I5VO 3EYCA 3JS1A 2MM3A 4COTA 1DV9A 4AZNA 4CDCA 4Y0QA 1VYOA 1CBRA 2GH7A 3RDSA 1SMPI 2RN4A 2WSJA 3JSQA 3NP1A 5LJGA 4QZUA 2IZDB 3RBYA 1JYJA 4JHQA 2FKJA 1MVGA 1EIIA 4A8ZA 1QY0A 4U46A 2FLJA 1VWAB 2X55A 2DJGA 5FQ6E 4BX7B 3FR5A 1ML7A 2OL6O 4YBUA 1KXOA 3IFBA 1IFBA 1MM9A 2JU8A 1B56A 1ERBA 2R56A 4XMCA 5FQ8E 1SREA 3FENA 2OY7A 5FQ7E 4IMOA 2P8GA 1EPBA 4NV8A 2K23A 4QGVA 1SLFB 2OFBA 1HY2A 3PECA 4I3BA 4MVIA 3OJYC 3WOVA 1MEPA 3O2YA 1NC9A 2PY1A 2X32A 1BLRA 3I0AA 2W2AA 1N0SA 4FBOA 3VG7A 1LNMA 1BBPA 1MX7A 2XSTA 4YFPA 2JU3A 2Z4IA 3WYPA 1U18A 2AT3X 4I3CA 3B2IA 3F6ZB 1CJ5A 3PH5A 1GKAB 1GT4A 1G85A 3ZW1B 3APVA 3S5VA 2FTBA 4O4XA 2HMBA 5D48A 5LJDA 1OEKA 3SZHA 3MVFA 1H91A 1STSB 3KFIA 3WZNA 2BC3A 1STPA 3O22A 2I5ZO 4ORXA 4PJ2A 4LZUA 2RTDB 4Z6JA 3FLLA 3SLJA 2BHVA 2AT8X 2EU7X 2OL7A 3NQ9A 1T0VA 1GX9A 1S7DA 1LCVA 1VYFA 4NYRA 1JJJA 1BSOA 1K24A 3FW4A 1NQNA 1Y55X 2N93A 3RY2A 2Y3EA 5D8JA 1O8VA 5HA0A 3TF6A 1IKJA 5H9AA 1LPJA 2ACOA 4EFGA 2WR6A 3MM0A 2CAMA 1E06A 5F7GA 2FS6A 5L8NA 4LQZA 2IZEB 3RDQA 4YMYA 3RKGA 4B55A 5C0NA 1VWKB 4ID2A 3VPJE 1X8NA 3Q34A 4GDAA 4XMGA 4OS8A 2WWPA 5EZ2A 4YH0A 4GRJA 5LKEA 3L4RA 4EKVA 1HXZA 4CDFA 5HCDC 4EEJA 1I78A 3RZYA 1MUPA 3LTWA 4N7DA 4ZHDA 4DNEA 1ZRYA 4M6SA 2YMSA 1E02A 1EPAA 4MISA 3HOLA 2C1SA 3FELA 4OS3A 3FA9A 5HZ5A 3QKGA 5HZ9A 5L8OA 2DM5A 1Y53X 1N9MA 4O3ZA 3SLOA 3ZW0B 1A2DA 1ZNLA 1LIEA 1JV4A 4IAXA 2F09A 2AMMX 1S2PA 4DQ4A 1BSYA 1YIVA 3WZQA 4CPIA 1HN2A 4BX7A 1SWFA 4NYQA 2O62A 5L8IA 4Y0PA 1Y9TA 4CDDA 3CWKA 2RTEB 2A5BA 2LBVA 2F01A 2G5LA 5D45A 2IZFB 4U8UN 1P6PA 4RUUA 5BVTA 1SLDB 2RTRB 1VWRB 5FFHA 3WZPA 4CPHA 2LFOA 1QY1A 2FS7A 2QM9A 1ICMA 2BS5A 1VWCB 2AL0X 2GTFX 2OVSA 2VFBA 2LKKA 5B3MO 4YDAA 1G74A 1NBXA 1SLGB 3CQRA 1OPAA 3HWFA 1K3BA 2BLGA 2OVAA 4MEEA 3B2LA 4AZOA 1OEEA 4IMNA 3ZQ3A 2WQAE 1PM1X 3OD9A 1KT5A 4GNWA 2KW1A 4IB9A 2HZQA 4NLIA 4BGFA 5BVSA 1SWJA 2JGSA 1ZNGA 3HWEA 5AQ6A 1OBQA 1SWKA 3ZW1A 3RDOA 2GTLM 1N4JA 4YGZA 2OY5O 1W4TA 2IFBA 5BYPA 4I9SA 4AYHA 3ZW2A 3CR6A 1MX8A 1KL3A 1L6MA 4A60A 2ASNX 1R0UA 1TOWA 2WEWA 3FEKA 1VWNB 5B29A 2OFRX 3FDCA 1JJXA 2L67A 1BSQA 4N7CA 3TGAA 3U9PC 1CRBA 3BLGA 1NGLA 3PK2A 4GGRA 3WJEA 2OY1O 4HPAA 1X8QA 2IZKA 3KQ0A 3CBCA 3HOEA 1BJ7A 3FIQA 4OMWA 5B10O 3NQ3A 2A8GA 4Y0RA 2FWVA 2ZAIA 4Z2VA 1YWBA 2FRSA 3KZAA 2CZUA 3PQUA 3RE6A 4ZH6A 1LUQA 3C76X 3BSZE 4QAEA 1FENA 2AF5A 2CM4A 4TKHA 1DFVA 4YKMA 1I9HA 1ZNEA 5H8TA 3BU9A 1OPBA 1SLEB 1SY2A 2RTAA 2WEXA 1E00A 3LV4A 2MF6A 1JZUA 4ZHCA 1MK5A 1QFVA 2IZBA 3D9WA 1SWGA 2MJIA 5FAZA 4ALBA 2HYSA 2NNDA 1NQMA 3STNA 4IBAA 3TZSA 1SXWA 4O9SA 1QG5A 1QWDA 1Y9LA 4R0BA 1PBOA 4ON1A 3JQOA 2A5CA 4YVBA 4CK4A 4FGIB 2IZLB 1SXYA 2Z4HA 4AZQA 2RTMA 1AELA 3NBXX 4EQAC 2FR3A 1OBUA 5CSEA 3C77X 2W2FA 4HPCA 5B2AO 2UZ2A 3T2XA 3ZI8A 5LJHA 4TKJA 1BM5A 1KOIA 4YFQA 2CBRA 3D96A 3FA7A 5F6BA 1SY0A 1SWUA 2IZJA 2RD7C 3VU1A 1LCZA 3UAQA 1RXJA 1ERXA 3FIDA 3FMZA 1ACDA 3WBGA 2AT6X 2A3FX 5HTEA 3K3LA 4L3RA 5IRWA 2X34A 1EUOA 3P6DA 4GJVA 5DG4A 2X56A 1BRPA 1SWSA 3AKMA 4I3DA 3UEVA 1LIFA 4BQUA 5HZ6A 2RTFB 1UZ2X 2HLVA 4TJZA 4GGZA 3WXQA 4JO6A 5F58A 1ICNA 4ES7A 2AVIA 1RXKA 1SWDA 1KL4A 1ZNKA 3P24A 5F2BA 1IIUA 1SXUA 4M7MA 1HBPA 4OS0A 5HCCC 4IAWA 1LIBA 1FE3A 4PSQA 1FDQA 4Z28A 3RDUA 5HBSA 4IABA 4MVEA 4GJSA 2LBAA 3BX7A 4GD9A 4U8UO 5AJCA 2Q4NA 1VWFB 1I04A 1ADLA 2G79A 3AKNA 5HTDA 2OF9A 1SWHA 3FA8A 4LZVA 3EM0A 3U0DA 1HQQA 3VG5A 4TKBA 1EALA 4U9CA 2PI3O 3BDRA 1DZKA 1HMSA 4ML7B 4Y5DA 2CBSA 5F1EA 3WJCA 1N43A 4BCSA 3MX7A 2X45A 1AVDA 3KFGA 5L3YA 3H3IA 3MG5A 2KTSA 1W6FA 3BU1A 1NP4A 2FR2A 3EBWA 3VG6A 2JMBA 1LKEA 5K06A 4Y59A 1X89A 3FR2A 2Q2MA 3UEWA 3VE2A 3UEUA 3BS2A 1AB0A 4BBOA 1DF3A 4AZRA 1STRB 2JN3A 2Q39A 4OKAA 1VWGB 5HZQA 1NDJA 2JU7A 2OFAA 5KIDA 1U17A 4QGXA 3AEHA 5EDCA 4GE1A 2YG2A 1X8PA 5AEOA 1SWNA 3RDXA 1NP1A 1TW4A 2F73A 2IZCB 2CM9A 1RXHA 3GE2A 3HPEA 4NP1A 1FELA 1X8UA 3ZZVA 3VG4A 3EC5A 4O3WA 1VWMB 4BJ8A 2OF8A 5HZ8A 5LJKA 5EPQA 3GAQA 4WFVA 2FHNX 2NNEA 3P6GA 3P6CA 3E3CA 1YWDA 4GH7A 2E4JA 4JNJA 5D4AA 2ZSCA 3RSWA 5AJBA 1I4UA 1RAVA 3HK1A 4GK9A 4UU2A 1D3SA 1MOYA 1JQPA 4ALOA 5K67A 2BSZA 2M4LA 1S44A 2OZQA 4QNIA 4GDZA 3WJBA 1GT1A 5CYBA 2AH7X 3S26A 1JIWI 4XMDA 4KC8A 2LB6A 1IKEA 5IRAA 1SRFA 4ZCBA 2KT4B 1PBYA 5LKFA 3RWXA 1HQPA 3STKA 3VGWA 3ZWEA 1LDOA 1I05A 3SZIA 1RLBE 4O4OA 1PMPA 1B8EA 3NX2A 4ORRA 4IB8A 2FGSA 1VWDB 4A1HA 4EXZA 5CE4A 1A57A 1O1VA 1GKAA 2UYWA 1A18A 1IFCA 2JOZA 2OY8A 4QGWA 2IZHB 1N9YA 1TVQA 4I9RA 4L1NA 5H9LA 3VG3A 4MIRA 4YGHA 2WPUA 2GC9A 4ZH9A 3VHIA 3ELXA 1FJ1E 2ZAGA 1B0OA 4BX6B 4YBPA 1OBPA 1DZJA 2ACPX 3APWA 1SWTA 1E2TA 3EMMA 4ZGUA 3U03A 1SRJA 3SOTA 1LFOA 4AZMA 1HMTA 1EQDA 2OVEA 2QO6A 4C5PA 2IZIA 4O4SA 2RTHB 4GNYA 4BOEA 1BWYA 3DSZA 1SWLA 4NW4A 2Q9SA 3I17A 3CQNA 4Z27A 2JW1A 3FYFA 1XKIA 3T2WA 4UU3A 4CPEA 1QABE 3X00A 1KZWA 1U0XA 3IA8A 3FA6A 2ALLX 3D4RA 4GKCA 4KH8A 5IXGA 2QCBA 2WUTA 3EW2A 3OBLA 1W5RA 2OVDA 3CKFA 4I95A 2OFMX 1SY3A 4NV7A 4O4UA 4ORWA 4GGTA 3BX8A 4IB7A 3P6HA 4Y0SA 2IZGB 5KHPA 2W2BA 2RCQA 1X8OA 4DCBA 2AKQA 2RTBB 2OL8O 2Y3FA 4AW8A 2RCTA 2FT9A 3SLTA 4ZHFA 2BT9A 2LA7A 3G7XA 4YKOA 1EIOA 4RUNA 1AQBA 4FQBB 4HPDA 3T6FA 3NQKA 4XMEA 1KGLA 1SRHA 3WYQA 1VWBB 4ZJ0A 4CV7A 4INNA 4ODDA 4KCAA 3HWGA 3P6FA 1PEEA 3SAOA 3T6LA 3NPOA 2QO5A 3KFHA 5D47A 1YP6A 1SWCA 2KD2A 5B11O 2L9CA 5H9KA 3HWDA 1DC9A 1RSUB 4ZR2A 3ZW0A 4NNSA 1VWQB 1PTSA 5KICA 3TGBA 2Q2PA 1QY2A 3DTQA 5DPQA 2NNQA 3FEPA 4LKPA 1A3YA 1IW2A 2A13A 3BY0A 3P6EA 4EDEA 5HA1A 5H9NA 1CBQA 4YCHA 1X71A 3D97A 4CDEA 1VWHB 1HBQA 2RTOB 4ZHHA 4ORSA 4CPHB 2X8FA 2HNXA 1SXXA 2RTGB 4XMHA 2RA6A 1MDCA 3VE1A 4ORUA 3PEDA 3HTYA 1Y52X 1FTPA 2GTLN 1I06A 1LF7A 2K62A 4QYNA 2AT0X 2R74A 1QQSA 4U8UM 2X8SA 4QQ1A 5F6ZA 5B5FA 1LICA 2X4MA 5LJCA 2C4IA 2BS6A 4KT5A 4QYPA 3TGCA 1SWPA 1KFFA 2QO4A 1GXAA 1UYNX 3N91A 4Z2PA 4WBKA 3FR4A 4K19A 5LJBA 1VWPB 1SRGA 1Y0GA 3NADA 4YGGA 2L68A 4GUZA 2XKLA 5EEEA 2RQ0A 4O3XB 1OEJA 1XCAA 5HCEC 1N7YA 3S60A 2RTIB 3F8AA 1TXLA 1ALBA 4BX6A 4DQ3A 1SWQA 3VG2A 5FENA 1KQXA 3S5XA 1SY1A 4GU8A 3APUA 4BX5B 1O1UA 1T68X 5IO5A 1SWBA 2MHDA 2QOMA 5BVQA 3WVMA 1HXLA 1JMXA 2C1QA 3UEXA 2CZTA 1IJ8A 3VHHA 2MWHA 1Z24A 3CBSA 1WUBA 2VDFA 1E5PA 1LCWA 3NR3A 4QRLA 4BVMA 4CSBA 1JBHA 2FHLA 1BEBA 4ZGFA 1YUPA 1VWJB 4HPBA 1G7NA 2RTNB 3F9DA 5IO7A 1TOUA 2FKGA 4GETA 1DZPA 1VWEB 1SRIA 2G78A 3PP6A 4LKTA 4OELA 1JYDA 3OE3A 5EDBA 1KT7A 2A2GA 1DF8A 5HAEA 1GX3A 1KT6A 5JR8A 1LDQA 2QOSC 1LIDA 3P02A 2Y32A 1T8VA 5B5GA 3VHMA 3KVNA 1GT5A 1HMRA 3O19A 4AZPA 4A1YA 2G7BA 5HWZA 1LELA 4OMXA 4U3QA 5JD2A 1KL5A 1CBSA 1KT4A 1YP7A 2A2UA 5K68A 4HFOA 4ARHA 2OYBO 1GX8A 4O49A 2A0AA 3WJFA 1FEMA 2AT5X 3CMPA 3FW5A 2KTDA 3C78X 1VPRA 1OSPO 4QZTA 2RTPB 2DJFA 1B4MA 2X46A 4WFUA 1JMZA 4JGLA 3BRNA 3STMX 1RSTB 4TLJA 3Q6LA 5B27A 4FBVA 1KQWA 1CBIA 2VFCA 2NP1A 1ZNDA 4ZHGA 1SWOA 2HZRA 4XMFA 1KT3A 3D95A 5EEDA 3KFFA 4IB6A 1DZMA 2RTCB 3PPTA 2L5PA 1JJUA 1VYGA 3APXA 2HKDA 4TNNA 1KZXA 3T1DA 3ZUIA 3PDFA 4CPFA 4TQ2A 1BRQA 3WJGA 1UYOX 1EW3A 1SWRA 3QQ2A 2RTKA 4FBRA 1VWLB 1VWIB 4GZVA 1VWOB 4IRWA 4KIIA 5LJEA 1RBPA 1WBIA 5IO6A 3EBKA 2RTLA 3RDMA 2MO5A 1G5WA 2IZAA 1UREA 3B2KA 3ZUOA 2GJ5A 1SA8A 2X8TA 1AVGI 1SWEA
chains in the Genus database with same CATH topology
3LHNA 2WQ9A 4YFRA 3ELZA 3WJDA 1YWCA 3PH6A 2POAA 4YCEA 2R73A 4HWMA 2GTLO 1YWAA 4MVLA 2QMIA 4O3YA 3B2HA 3PQSA 4D6BA 1GM6A 1EI5A 4D6AA 4ORYA 3V8UA 4MVKA 4I6SA 4NNTA 4YDBA 3MBTA 4WHIA 1GGLA 4KC7A 1QFTA 1GT3A 1ZNHA 1EXSA 2ANSA 3B2JA 1D2UA 3NX1A 4NLJA 3EYCA 3JS1A 2MM3A 4COTA 1DV9A 4AZNA 4ZFXA 4Y0QA 1CBRA 3UEWA 1SMPI 2RN4A 2WSJA 3JSQA 3NP1A 5LJGA 4QZUA 3RBYA 1JYJA 1EIIA 1MVGA 4A8ZA 1QY0A 2FLJA 5FQ6E 3FR5A 1ML7A 4YBUA 1KXOA 3IFBA 1IFBA 2JU8A 1B56A 1ERBA 2R56A 4XMCA 5FQ8E 3FENA 5FQ7E 4IMOA 2P8GA 1EPBA 2K23A 4QGVA 4I3BA 3PECA 4MVIA 3OJYC 3O2YA 2PY1A 1BLRA 3I0AA 2W2AA 1N0SA 4FBOA 1LNMA 1BBPA 1MX7A 2XSTA 4YFPA 2JU3A 2Z4IA 1U18A 2AT3X 4I3CA 3B2IA 3F6ZB 1CJ5A 3PH5A 1GKAB 1GT4A 1G85A 3ZW1B 3APVA 3S5VA 2FTBA 4O4XA 2HMBA 5D48A 5LJDA 1OEKA 3MVFA 1H91A 3KFIA 3O22A 4ORXA 4PJ2A 4LZUA 3FLLA 2BHVA 2AT8X 2EU7X 3NQ9A 1T0VA 1GX9A 1S7DA 1VYFA 4NYRA 1JJJA 1BSOA 3FW4A 2N93A 5D8JA 1O8VA 5HA0A 3TF6A 1IKJA 5H9AA 1LPJA 2ACOA 4EFGA 2WR6A 5F7GA 1E06A 2FS6A 5L8NA 4LQZA 4YMYA 3RKGA 5C0NA 4ID2A 3VPJE 1X8NA 4XMGA 4OS8A 2WWPA 5EZ2A 4YH0A 4GRJA 5LKEA 3L4RA 5HCDC 4EEJA 3RZYA 1MUPA 4N7DA 4ZHDA 1ZRYA 4M6SA 2YMSA 1E02A 1EPAA 4MISA 3HOLA 3FELA 4OS3A 3FA9A 5HZ5A 3QKGA 5HZ9A 5L8OA 2DM5A 4O3ZA 3ZW0B 1A2DA 1ZNLA 1LIEA 1JV4A 4IAXA 2F09A 2AMMX 1S2PA 4DQ4A 1BSYA 1YIVA 1HN2A 4NYQA 2O62A 5L8IA 4Y0PA 1Y9TA 3CWKA 2LBVA 5D45A 4U8UN 1P6PA 4RUUA 5BVTA 5FFHA 2LFOA 1QY1A 2FS7A 2QM9A 1ICMA 2BS5A 2AL0X 2GTFX 2OVSA 2LKKA 4YDAA 1G74A 3CQRA 1OPAA 3HWFA 2BLGA 2OVAA 3B2LA 4AZOA 1OEEA 4IMNA 3ZQ3A 2WQAE 1PM1X 3OD9A 1KT5A 4GNWA 2KW1A 4IB9A 2HZQA 4NLIA 5BVSA 1ZNGA 3HWEA 5AQ6A 1OBQA 3ZW1A 2GTLM 4YGZA 2IFBA 5BYPA 4I9SA 4AYHA 3ZW2A 3CR6A 1MX8A 1L6MA 4A60A 2ASNX 1R0UA 1TOWA 2WEWA 3FEKA 5B29A 2OFRX 1JJXA 2L67A 1BSQA 4N7CA 3TGAA 3U9PC 1CRBA 3BLGA 1NGLA 3WJEA 4HPAA 1X8QA 3KQ0A 3CBCA 3HOEA 1BJ7A 3FIQA 4OMWA 3NQ3A 4Y0RA 2FWVA 2ZAIA 1YWBA 2FRSA 3KZAA 2CZUA 3PQUA 4ZH6A 4QAEA 3C76X 3BSZE 1FENA 4TKHA 2CM4A 1DFVA 4YKMA 1ZNEA 5H8TA 3BU9A 1OPBA 1SY2A 2WEXA 1E00A 3LV4A 1JZUA 4ZHCA 1QFVA 2MJIA 5FAZA 4ALBA 2HYSA 2NNDA 3STNA 4IBAA 3TZSA 1SXWA 4O9SA 1QG5A 1QWDA 1Y9LA 4R0BA 1PBOA 4ON1A 3JQOA 4CK4A 4FGIB 1SXYA 2Z4HA 4AZQA 1AELA 3NBXX 4EQAC 2FR3A 1OBUA 3C77X 2W2FA 4HPCA 3ZI8A 5LJHA 4TKJA 1KOIA 4YFQA 2CBRA 3D96A 3FA7A 5F6BA 1SY0A 3VU1A 2RD7C 3UAQA 1ERXA 3FMZA 1ACDA 3WBGA 2AT6X 2A3FX 5HTEA 3K3LA 4L3RA 1EUOA 3P6DA 5DG4A 3UEVA 1BRPA 3AKMA 4I3DA 4BQUA 5HZ6A 1LIFA 1UZ2X 2HLVA 4TJZA 3WXQA 5F58A 1ICNA 4ES7A 1ZNKA 3P24A 1IIUA 1SXUA 4M7MA 1HBPA 4OS0A 5HCCC 4IAWA 1LIBA 1FE3A 4PSQA 1FDQA 5HBSA 4IABA 4MVEA 4U8UO 2LBAA 3BX7A 5AJCA 1BM5A 2Q4NA 2G79A 1I04A 1ADLA 3AKNA 5HTDA 3FA8A 4LZVA 3EM0A 3U0DA 4TKBA 3VG5A 1EALA 4U9CA 3BDRA 1DZKA 1HMSA 4ML7B 5F1EA 2CBSA 3WJCA 3MX7A 2X45A 3KFGA 3H3IA 2KTSA 3BU1A 1NP4A 2FR2A 3EBWA 3VG6A 2JMBA 1LKEA 5K06A 1X89A 3FR2A 2Q2MA 3VE2A 3UEUA 3BS2A 1AB0A 1DF3A 4AZRA 2JN3A 2Q39A 5HZQA 2JU7A 5KIDA 1U17A 4QGXA 5EDCA 4GE1A 2YG2A 1X8PA 5AEOA 1NP1A 1TW4A 2F73A 2CM9A 3GE2A 4NP1A 1FELA 1X8UA 3ZZVA 3VG4A 4O3WA 5HZ8A 5LJKA 5EPQA 3GAQA 4WFVA 2NNEA 3P6CA 3P6GA 3E3CA 1YWDA 4GH7A 2E4JA 5D4AA 5AJBA 1I4UA 3HK1A 4UU2A 4GK9A 1D3SA 4ALOA 2M4LA 1S44A 2OZQA 4QNIA 4GDZA 3WJBA 1GT1A 5CYBA 2AH7X 3S26A 1JIWI 4XMDA 4KC8A 2LB6A 1IKEA 4ZCBA 2KT4B 5LKFA 3RWXA 1HQPA 3STKA 3ZWEA 1I05A 1RLBE 4O4OA 1PMPA 1B8EA 3NX2A 4ORRA 4IB8A 4A1HA 4EXZA 1A57A 5CE4A 1O1VA 1GKAA 1A18A 1IFCA 2JOZA 4QGWA 1TVQA 4I9RA 4L1NA 5H9LA 3VG3A 4MIRA 4YGHA 4ZH9A 2GC9A 3WOVA 3ELXA 4YBPA 2ZAGA 1B0OA 1OBPA 1DZJA 2ACPX 3APWA 3EMMA 4ZGUA 3U03A 4AZMA 3SOTA 1LFOA 1HMTA 1EQDA 2OVEA 2QO6A 4O4SA 4BOEA 4GNYA 1BWYA 3DSZA 4NW4A 2Q9SA 3I17A 3CQNA 2JW1A 3FYFA 1XKIA 4UU3A 1QABE 1KZWA 1U0XA 3IA8A 3FA6A 2ALLX 3D4RA 4GKCA 4KH8A 2WUTA 4I95A 3OBLA 2OVDA 3RSWA 3VG7A 2OFMX 1SY3A 4O4UA 4ORWA 3BX8A 4IB7A 3P6HA 4Y0SA 5KHPA 2W2BA 2RCQA 1X8OA 2AKQA 4AW8A 2RCTA 2FT9A 4ZHFA 2BT9A 2LA7A 3G7XA 4YKOA 1EIOA 4RUNA 1AQBA 4FQBB 4HPDA 1KGLA 3NQKA 4XMEA 4ZJ0A 4CV7A 4INNA 4ODDA 4KCAA 3HWGA 3P6FA 1PEEA 3SAOA 3NPOA 2QO5A 3KFHA 5D47A 1YP6A 2KD2A 2L9CA 5H9KA 3HWDA 1DC9A 4ZR2A 3ZW0A 4NNSA 5KICA 3TGBA 2Q2PA 1QY2A 3DTQA 5DPQA 2NNQA 3FEPA 4LKPA 1A3YA 1IW2A 2A13A 3BY0A 3P6EA 4EDEA 5HA1A 5H9NA 1CBQA 4YCHA 1X71A 3D97A 1HBQA 4ZHHA 4ORSA 2X8FA 2HNXA 1SXXA 3VE1A 4XMHA 2RA6A 1MDCA 4ORUA 3PEDA 3HTYA 1FTPA 2GTLN 1I06A 1LF7A 2K62A 4QYNA 2AT0X 2R74A 1QQSA 4U8UM 2X8SA 4QQ1A 5F6ZA 1LICA 5LJCA 4QYPA 2BS6A 4KT5A 3TGCA 2QO4A 1GXAA 3N91A 4WBKA 3FR4A 4K19A 5LJBA 3NADA 4YGGA 2L68A 2XKLA 5EEEA 2RQ0A 4O3XB 1OEJA 1XCAA 5HCEC 3S60A 3F8AA 1TXLA 1ALBA 4DQ3A 3VG2A 5FENA 1KQXA 3S5XA 1SY1A 4GU8A 3APUA 1O1UA 1T68X 5IO5A 5BVQA 2MHDA 3WVMA 3UEXA 2CZTA 2MWHA 1Z24A 3CBSA 1E5PA 3NR3A 4QRLA 4BVMA 4CSBA 1JBHA 1BEBA 4ZGFA 1YUPA 4HPBA 1G7NA 3F9DA 5IO7A 1TOUA 4GETA 1DZPA 2G78A 3PP6A 4LKTA 1JYDA 3OE3A 5EDBA 1KT7A 2A2GA 5HAEA 1KT6A 5JR8A 2QOSC 1LIDA 3P02A 1T8VA 4AZPA 1GT5A 1HMRA 3O19A 5HWZA 4A1YA 2G7BA 4OMXA 4U3QA 1CBSA 1KT4A 1YP7A 2A2UA 4ARHA 4HFOA 1GX8A 4O49A 2A0AA 3WJFA 1FEMA 2AT5X 3CMPA 3FW5A 2KTDA 3C78X 1VPRA 4QZTA 1B4MA 2X46A 4WFUA 4JGLA 3BRNA 3STMX 4TLJA 3Q6LA 5B27A 4FBVA 1KQWA 1CBIA 2NP1A 1ZNDA 4ZHGA 2HZRA 4XMFA 1KT3A 3D95A 5EEDA 3KFFA 4IB6A 1DZMA 3PPTA 2L5PA 1VYGA 3APXA 4TNNA 1KZXA 3T1DA 3ZUIA 4TQ2A 1BRQA 3WJGA 1EW3A 4FBRA 4GZVA 5LJEA 4KIIA 1RBPA 5IO6A 3EBKA 2MO5A 1G5WA 1UREA 3B2KA 3ZUOA 2GJ5A 1SA8A 2X8TA 1AVGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQ9 A;  4YFR A;  3ELZ A;  3WJD A;  1YWC A;  3PH6 A;  2POA A;  4YCE A;  2R73 A;  4MVL A;  1YWA A;  3B2H A;  4D6B A;  1GM6 A;  4D6A A;  4ORY A;  4MVK A;  4NNT A;  4YDB A;  3MBT A;  1GGL A;  1QFT A;  1GT3 A;  1ZNH A;  1EXS A;  2ANS A;  3B2J A;  1D2U A;  3NX1 A;  4NLJ A;  3EYC A;  3JS1 A;  2MM3 A;  1DV9 A;  4AZN A;  4ZFX A;  4Y0Q A;  1CBR A;  3UEW A;  2WSJ A;  3JSQ A;  5LJG A;  3NP1 A;  4QZU A;  1JYJ A;  1EII A;  1MVG A;  4A8Z A;  1QY0 A;  2FLJ A;  3FR5 A;  1ML7 A;  4YBU A;  1KXO A;  3IFB A;  1IFB A;  2JU8 A;  1B56 A;  1ERB A;  2R56 A;  4XMC A;  3FEN A;  4IMO A;  2P8G A;  1EPB A;  2K23 A;  4QGV A;  4I3B A;  3PEC A;  4MVI A;  3OJY C;  3O2Y A;  2PY1 A;  1BLR A;  3I0A A;  2W2A A;  1N0S A;  1LNM A;  1BBP A;  1MX7 A;  2XST A;  4YFP A;  2JU3 A;  1U18 A;  2AT3 X;  4I3C A;  3B2I A;  1CJ5 A;  3PH5 A;  1GKA B;  1GT4 A;  1G85 A;  3APV A;  2FTB A;  2HMB A;  5D48 A;  5LJD A;  1OEK A;  3MVF A;  1H91 A;  3KFI A;  3O22 A;  4ORX A;  4LZU A;  3FLL A;  2AT8 X;  2EU7 X;  3NQ9 A;  1T0V A;  1GX9 A;  1S7D A;  1VYF A;  4NYR A;  1JJJ A;  1BSO A;  3FW4 A;  2N93 A;  5D8J A;  1O8V A;  5HA0 A;  3TF6 A;  1IKJ A;  5H9A A;  1LPJ A;  2ACO A;  4EFG A;  2WR6 A;  5F7G A;  1E06 A;  2FS6 A;  5L8N A;  4YMY A;  5C0N A;  1X8N A;  4XMG A;  4OS8 A;  2WWP A;  5EZ2 A;  4YH0 A;  4GRJ A;  5LKE A;  3L4R A;  5HCD C;  4EEJ A;  3RZY A;  1MUP A;  4N7D A;  4ZHD A;  1ZRY A;  4M6S A;  1E02 A;  1EPA A;  3FEL A;  4OS3 A;  3FA9 A;  5HZ5 A;  3QKG A;  5HZ9 A;  5L8O A;  2DM5 A;  1A2D A;  1ZNL A;  1LIE A;  1JV4 A;  4IAX A;  2AMM X;  1S2P A;  4DQ4 A;  1BSY A;  1YIV A;  1HN2 A;  4NYQ A;  2O62 A;  5L8I A;  4Y0P A;  3CWK A;  2LBV A;  5D45 A;  1P6P A;  4RUU A;  5BVT A;  5FFH A;  2LFO A;  1QY1 A;  2FS7 A;  2QM9 A;  1ICM A;  2AL0 X;  2GTF X;  2LKK A;  4YDA A;  1G74 A;  3CQR A;  1OPA A;  3HWF A;  2BLG A;  2OVA A;  3B2L A;  4AZO A;  1OEE A;  4IMN A;  3ZQ3 A;  2WQA E;  1PM1 X;  1KT5 A;  4GNW A;  4IB9 A;  2HZQ A;  4NLI A;  5BVS A;  1ZNG A;  3HWE A;  5AQ6 A;  1OBQ A;  4YGZ A;  2IFB A;  4I9S A;  4AYH A;  3CR6 A;  1MX8 A;  1L6M A;  4A60 A;  2ASN X;  1R0U A;  1TOW A;  2WEW A;  3FEK A;  5B29 A;  2OFR X;  1JJX A;  2L67 A;  1BSQ A;  4N7C A;  3TGA A;  3U9P C;  1CRB A;  3BLG A;  1NGL A;  3WJE A;  4HPA A;  1X8Q A;  3KQ0 A;  3CBC A;  1BJ7 A;  3FIQ A;  4OMW A;  3NQ3 A;  4Y0R A;  2FWV A;  1YWB A;  2FRS A;  3KZA A;  2CZU A;  4ZH6 A;  4QAE A;  3C76 X;  3BSZ E;  1FEN A;  4TKH A;  2CM4 A;  1DFV A;  4YKM A;  1ZNE A;  5H8T A;  3BU9 A;  1OPB A;  1SY2 A;  2WEX A;  1E00 A;  1JZU A;  4ZHC A;  1QFV A;  2MJI A;  5FAZ A;  4ALB A;  2HYS A;  2NND A;  3STN A;  4IBA A;  3TZS A;  1SXW A;  4O9S A;  1QG5 A;  1QWD A;  4R0B A;  1PBO A;  4CK4 A;  1SXY A;  1AEL A;  4AZQ A;  2FR3 A;  1OBU A;  3C77 X;  2W2F A;  4HPC A;  5LJH A;  4TKJ A;  1KOI A;  4YFQ A;  2CBR A;  3D96 A;  3FA7 A;  5F6B A;  1SY0 A;  2RD7 C;  1ERX A;  3FMZ A;  1ACD A;  3WBG A;  2AT6 X;  2A3F X;  5HTE A;  3K3L A;  1EUO A;  3P6D A;  5DG4 A;  3UEV A;  1BRP A;  3AKM A;  4I3D A;  4BQU A;  5HZ6 A;  1LIF A;  1UZ2 X;  2HLV A;  4TJZ A;  3WXQ A;  5F58 A;  1ICN A;  4ES7 A;  1ZNK A;  1IIU A;  1SXU A;  4M7M A;  1HBP A;  4OS0 A;  5HCC C;  4IAW A;  1LIB A;  1FE3 A;  4PSQ A;  1FDQ A;  5HBS A;  1BM5 A;  2LBA A;  3BX7 A;  2Q4N A;  2G79 A;  1I04 A;  1ADL A;  3AKN A;  5HTD A;  3FA8 A;  4LZV A;  3EM0 A;  3U0D A;  4TKB A;  3VG5 A;  1EAL A;  3BDR A;  1DZK A;  1HMS A;  5F1E A;  2CBS A;  3WJC A;  2X45 A;  3KFG A;  3BU1 A;  1NP4 A;  2FR2 A;  3EBW A;  3VG6 A;  1LKE A;  5K06 A;  1X89 A;  3FR2 A;  2Q2M A;  3UEU A;  3BS2 A;  1AB0 A;  1DF3 A;  4AZR A;  2JN3 A;  2Q39 A;  5HZQ A;  2JU7 A;  5KID A;  1U17 A;  4QGX A;  5EDC A;  4GE1 A;  2YG2 A;  1X8P A;  1NP1 A;  1TW4 A;  2F73 A;  2CM9 A;  4NP1 A;  1FEL A;  1X8U A;  3VG4 A;  5HZ8 A;  5LJK A;  5EPQ A;  3GAQ A;  4WFV A;  2NNE A;  3P6C A;  3P6G A;  1YWD A;  4GH7 A;  2E4J A;  5D4A A;  1I4U A;  3HK1 A;  4UU2 A;  1D3S A;  4ALO A;  1S44 A;  2OZQ A;  3WJB A;  1GT1 A;  3S26 A;  2AH7 X;  4XMD A;  2LB6 A;  1IKE A;  4ZCB A;  2KT4 B;  5LKF A;  1HQP A;  3STK A;  1I05 A;  1RLB E;  1PMP A;  1B8E A;  3NX2 A;  4ORR A;  4IB8 A;  4A1H A;  4EXZ A;  1A57 A;  5CE4 A;  1O1V A;  1GKA A;  1A18 A;  1IFC A;  2JOZ A;  4QGW A;  1TVQ A;  4I9R A;  5H9L A;  3VG3 A;  4ZH9 A;  4YGH A;  2GC9 A;  3ELX A;  4YBP A;  1B0O A;  1OBP A;  1DZJ A;  2ACP X;  3APW A;  3EMM A;  4ZGU A;  3U03 A;  4AZM A;  1LFO A;  1HMT A;  1EQD A;  2OVE A;  2QO6 A;  4BOE A;  4GNY A;  1BWY A;  3DSZ A;  2Q9S A;  3I17 A;  3CQN A;  1XKI A;  4UU3 A;  1QAB E;  1KZW A;  1U0X A;  3IA8 A;  3FA6 A;  2ALL X;  4GKC A;  2WUT A;  3RSW A;  2OVD A;  3VG7 A;  2OFM X;  1SY3 A;  4ORW A;  3BX8 A;  4IB7 A;  3P6H A;  4Y0S A;  5KHP A;  2W2B A;  2RCQ A;  1X8O A;  2AKQ A;  4AW8 A;  2RCT A;  2FT9 A;  4ZHF A;  3G7X A;  4YKO A;  1EIO A;  4RUN A;  1AQB A;  4HPD A;  1KGL A;  4XME A;  4ZJ0 A;  4ODD A;  1PEE A;  3HWG A;  3P6F A;  3SAO A;  3NPO A;  2QO5 A;  3KFH A;  5D47 A;  1YP6 A;  2L9C A;  5H9K A;  3HWD A;  1DC9 A;  4ZR2 A;  4NNS A;  5KIC A;  3TGB A;  2Q2P A;  1QY2 A;  3DTQ A;  5DPQ A;  2NNQ A;  3FEP A;  4LKP A;  1A3Y A;  1IW2 A;  2A13 A;  3BY0 A;  3P6E A;  4EDE A;  5HA1 A;  5H9N A;  1CBQ A;  4YCH A;  1X71 A;  3D97 A;  1HBQ A;  4ZHH A;  4ORS A;  2HNX A;  1SXX A;  4XMH A;  2RA6 A;  1MDC A;  4ORU A;  3PED A;  1FTP A;  2K62 A;  1I06 A;  1LF7 A;  4QYN A;  2AT0 X;  2R74 A;  1QQS A;  5F6Z A;  1LIC A;  5LJC A;  4QYP A;  3TGC A;  2QO4 A;  1GXA A;  4WBK A;  3FR4 A;  4K19 A;  5LJB A;  3NAD A;  4YGG A;  2L68 A;  2XKL A;  5EEE A;  2RQ0 A;  1OEJ A;  1XCA A;  5HCE C;  3F8A A;  1TXL A;  1ALB A;  4DQ3 A;  3VG2 A;  5FEN A;  1KQX A;  1SY1 A;  3APU A;  1O1U A;  1T68 X;  5IO5 A;  5BVQ A;  3WVM A;  3UEX A;  2CZT A;  1Z24 A;  3CBS A;  1E5P A;  3NR3 A;  4BVM A;  1JBH A;  1BEB A;  1YUP A;  4HPB A;  1G7N A;  3F9D A;  5IO7 A;  1TOU A;  4GET A;  1DZP A;  2G78 A;  3PP6 A;  4LKT A;  1JYD A;  5EDB A;  1KT7 A;  2A2G A;  5HAE A;  1KT6 A;  5JR8 A;  2QOS C;  1LID A;  1T8V A;  4AZP A;  1GT5 A;  1HMR A;  3O19 A;  5HWZ A;  4A1Y A;  2G7B A;  4OMX A;  1CBS A;  1KT4 A;  1YP7 A;  2A2U A;  4ARH A;  4HFO A;  1GX8 A;  2A0A A;  3WJF A;  1FEM A;  2AT5 X;  3CMP A;  3FW5 A;  2KTD A;  3C78 X;  1VPR A;  4QZT A;  1B4M A;  2X46 A;  4WFU A;  3BRN A;  3STM X;  4TLJ A;  3Q6L A;  5B27 A;  1KQW A;  1CBI A;  2NP1 A;  1ZND A;  4ZHG A;  2HZR A;  4XMF A;  1KT3 A;  3D95 A;  5EED A;  3KFF A;  4IB6 A;  1DZM A;  3PPT A;  2L5P A;  1VYG A;  3APX A;  4TNN A;  1KZX A;  3T1D A;  3ZUI A;  4TQ2 A;  1BRQ A;  3WJG A;  1EW3 A;  5LJE A;  4KII A;  1RBP A;  5IO6 A;  3EBK A;  2MO5 A;  1G5W A;  1URE A;  3B2K A;  3ZUO A;  2GJ5 A;  1SA8 A;  1AVG I; 
#chains in the Genus database with same CATH topology
 3LHN A;  2RTJ A;  3WZO A;  5CHK A;  2WQ9 A;  3CKG A;  4YFR A;  3ELZ A;  3WJD A;  1YWC A;  3PH6 A;  3AUM O;  2POA A;  4YCE A;  2R73 A;  4HWM A;  2GTL O;  1YWA A;  4MVL A;  2QMI A;  4O3Y A;  3B2H A;  3PQS A;  4D6B A;  1GM6 A;  1EI5 A;  4OEM A;  3RY1 A;  4D6A A;  3RE5 A;  4BX5 A;  4ORY A;  3V8U A;  4MVK A;  4I6S A;  4NNT A;  1SWA A;  4ZFX A;  2RTQ B;  4YDB A;  5IRU A;  1AVE A;  3MBT A;  4WHI A;  1GGL A;  4KC7 A;  1QFT A;  1GT3 A;  1ZNH A;  1EXS A;  2ANS A;  3B2J A;  1D2U A;  3NX1 A;  2G8C O;  4Z2O A;  3SZJ A;  4NLJ A;  4I60 A;  3EW1 A;  2I5V O;  3EYC A;  3JS1 A;  2MM3 A;  4COT A;  1DV9 A;  4AZN A;  4CDC A;  4Y0Q A;  1VYO A;  1CBR A;  2GH7 A;  3RDS A;  1SMP I;  2RN4 A;  2WSJ A;  3JSQ A;  3NP1 A;  5LJG A;  4QZU A;  2IZD B;  3RBY A;  1JYJ A;  4JHQ A;  2FKJ A;  1MVG A;  1EII A;  4A8Z A;  1QY0 A;  4U46 A;  2FLJ A;  1VWA B;  2X55 A;  2DJG A;  5FQ6 E;  4BX7 B;  3FR5 A;  1ML7 A;  2OL6 O;  4YBU A;  1KXO A;  3IFB A;  1IFB A;  1MM9 A;  2JU8 A;  1B56 A;  1ERB A;  2R56 A;  4XMC A;  5FQ8 E;  1SRE A;  3FEN A;  2OY7 A;  5FQ7 E;  4IMO A;  2P8G A;  1EPB A;  4NV8 A;  2K23 A;  4QGV A;  1SLF B;  2OFB A;  1HY2 A;  3PEC A;  4I3B A;  4MVI A;  3OJY C;  3WOV A;  1MEP A;  3O2Y A;  1NC9 A;  2PY1 A;  2X32 A;  1BLR A;  3I0A A;  2W2A A;  1N0S A;  4FBO A;  3VG7 A;  1LNM A;  1BBP A;  1MX7 A;  2XST A;  4YFP A;  2JU3 A;  2Z4I A;  3WYP A;  1U18 A;  2AT3 X;  4I3C A;  3B2I A;  3F6Z B;  1CJ5 A;  3PH5 A;  1GKA B;  1GT4 A;  1G85 A;  3ZW1 B;  3APV A;  3S5V A;  2FTB A;  4O4X A;  2HMB A;  5D48 A;  5LJD A;  1OEK A;  3SZH A;  3MVF A;  1H91 A;  1STS B;  3KFI A;  3WZN A;  2BC3 A;  1STP A;  3O22 A;  2I5Z O;  4ORX A;  4PJ2 A;  4LZU A;  2RTD B;  4Z6J A;  3FLL A;  3SLJ A;  2BHV A;  2AT8 X;  2EU7 X;  2OL7 A;  3NQ9 A;  1T0V A;  1GX9 A;  1S7D A;  1LCV A;  1VYF A;  4NYR A;  1JJJ A;  1BSO A;  1K24 A;  3FW4 A;  1NQN A;  1Y55 X;  2N93 A;  3RY2 A;  2Y3E A;  5D8J A;  1O8V A;  5HA0 A;  3TF6 A;  1IKJ A;  5H9A A;  1LPJ A;  2ACO A;  4EFG A;  2WR6 A;  3MM0 A;  2CAM A;  1E06 A;  5F7G A;  2FS6 A;  5L8N A;  4LQZ A;  2IZE B;  3RDQ A;  4YMY A;  3RKG A;  4B55 A;  5C0N A;  1VWK B;  4ID2 A;  3VPJ E;  1X8N A;  3Q34 A;  4GDA A;  4XMG A;  4OS8 A;  2WWP A;  5EZ2 A;  4YH0 A;  4GRJ A;  5LKE A;  3L4R A;  4EKV A;  1HXZ A;  4CDF A;  5HCD C;  4EEJ A;  1I78 A;  3RZY A;  1MUP A;  3LTW A;  4N7D A;  4ZHD A;  4DNE A;  1ZRY A;  4M6S A;  2YMS A;  1E02 A;  1EPA A;  4MIS A;  3HOL A;  2C1S A;  3FEL A;  4OS3 A;  3FA9 A;  5HZ5 A;  3QKG A;  5HZ9 A;  5L8O A;  2DM5 A;  1Y53 X;  1N9M A;  4O3Z A;  3SLO A;  3ZW0 B;  1A2D A;  1ZNL A;  1LIE A;  1JV4 A;  4IAX A;  2F09 A;  2AMM X;  1S2P A;  4DQ4 A;  1BSY A;  1YIV A;  3WZQ A;  4CPI A;  1HN2 A;  4BX7 A;  1SWF A;  4NYQ A;  2O62 A;  5L8I A;  4Y0P A;  1Y9T A;  4CDD A;  3CWK A;  2RTE B;  2A5B A;  2LBV A;  2F01 A;  2G5L A;  5D45 A;  2IZF B;  4U8U N;  1P6P A;  4RUU A;  5BVT A;  1SLD B;  2RTR B;  1VWR B;  5FFH A;  3WZP A;  4CPH A;  2LFO A;  1QY1 A;  2FS7 A;  2QM9 A;  1ICM A;  2BS5 A;  1VWC B;  2AL0 X;  2GTF X;  2OVS A;  2VFB A;  2LKK A;  5B3M O;  4YDA A;  1G74 A;  1NBX A;  1SLG B;  3CQR A;  1OPA A;  3HWF A;  1K3B A;  2BLG A;  2OVA A;  4MEE A;  3B2L A;  4AZO A;  1OEE A;  4IMN A;  3ZQ3 A;  2WQA E;  1PM1 X;  3OD9 A;  1KT5 A;  4GNW A;  2KW1 A;  4IB9 A;  2HZQ A;  4NLI A;  4BGF A;  5BVS A;  1SWJ A;  2JGS A;  1ZNG A;  3HWE A;  5AQ6 A;  1OBQ A;  1SWK A;  3ZW1 A;  3RDO A;  2GTL M;  1N4J A;  4YGZ A;  2OY5 O;  1W4T A;  2IFB A;  5BYP A;  4I9S A;  4AYH A;  3ZW2 A;  3CR6 A;  1MX8 A;  1KL3 A;  1L6M A;  4A60 A;  2ASN X;  1R0U A;  1TOW A;  2WEW A;  3FEK A;  1VWN B;  5B29 A;  2OFR X;  3FDC A;  1JJX A;  2L67 A;  1BSQ A;  4N7C A;  3TGA A;  3U9P C;  1CRB A;  3BLG A;  1NGL A;  3PK2 A;  4GGR A;  3WJE A;  2OY1 O;  4HPA A;  1X8Q A;  2IZK A;  3KQ0 A;  3CBC A;  3HOE A;  1BJ7 A;  3FIQ A;  4OMW A;  5B10 O;  3NQ3 A;  2A8G A;  4Y0R A;  2FWV A;  2ZAI A;  4Z2V A;  1YWB A;  2FRS A;  3KZA A;  2CZU A;  3PQU A;  3RE6 A;  4ZH6 A;  1LUQ A;  3C76 X;  3BSZ E;  4QAE A;  1FEN A;  2AF5 A;  2CM4 A;  4TKH A;  1DFV A;  4YKM A;  1I9H A;  1ZNE A;  5H8T A;  3BU9 A;  1OPB A;  1SLE B;  1SY2 A;  2RTA A;  2WEX A;  1E00 A;  3LV4 A;  2MF6 A;  1JZU A;  4ZHC A;  1MK5 A;  1QFV A;  2IZB A;  3D9W A;  1SWG A;  2MJI A;  5FAZ A;  4ALB A;  2HYS A;  2NND A;  1NQM A;  3STN A;  4IBA A;  3TZS A;  1SXW A;  4O9S A;  1QG5 A;  1QWD A;  1Y9L A;  4R0B A;  1PBO A;  4ON1 A;  3JQO A;  2A5C A;  4YVB A;  4CK4 A;  4FGI B;  2IZL B;  1SXY A;  2Z4H A;  4AZQ A;  2RTM A;  1AEL A;  3NBX X;  4EQA C;  2FR3 A;  1OBU A;  5CSE A;  3C77 X;  2W2F A;  4HPC A;  5B2A O;  2UZ2 A;  3T2X A;  3ZI8 A;  5LJH A;  4TKJ A;  1BM5 A;  1KOI A;  4YFQ A;  2CBR A;  3D96 A;  3FA7 A;  5F6B A;  1SY0 A;  1SWU A;  2IZJ A;  2RD7 C;  3VU1 A;  1LCZ A;  3UAQ A;  1RXJ A;  1ERX A;  3FID A;  3FMZ A;  1ACD A;  3WBG A;  2AT6 X;  2A3F X;  5HTE A;  3K3L A;  4L3R A;  5IRW A;  2X34 A;  1EUO A;  3P6D A;  4GJV A;  5DG4 A;  2X56 A;  1BRP A;  1SWS A;  3AKM A;  4I3D A;  3UEV A;  1LIF A;  4BQU A;  5HZ6 A;  2RTF B;  1UZ2 X;  2HLV A;  4TJZ A;  4GGZ A;  3WXQ A;  4JO6 A;  5F58 A;  1ICN A;  4ES7 A;  2AVI A;  1RXK A;  1SWD A;  1KL4 A;  1ZNK A;  3P24 A;  5F2B A;  1IIU A;  1SXU A;  4M7M A;  1HBP A;  4OS0 A;  5HCC C;  4IAW A;  1LIB A;  1FE3 A;  4PSQ A;  1FDQ A;  4Z28 A;  3RDU A;  5HBS A;  4IAB A;  4MVE A;  4GJS A;  2LBA A;  3BX7 A;  4GD9 A;  4U8U O;  5AJC A;  2Q4N A;  1VWF B;  1I04 A;  1ADL A;  2G79 A;  3AKN A;  5HTD A;  2OF9 A;  1SWH A;  3FA8 A;  4LZV A;  3EM0 A;  3U0D A;  1HQQ A;  3VG5 A;  4TKB A;  1EAL A;  4U9C A;  2PI3 O;  3BDR A;  1DZK A;  1HMS A;  4ML7 B;  4Y5D A;  2CBS A;  5F1E A;  3WJC A;  1N43 A;  4BCS A;  3MX7 A;  2X45 A;  1AVD A;  3KFG A;  5L3Y A;  3H3I A;  3MG5 A;  2KTS A;  1W6F A;  3BU1 A;  1NP4 A;  2FR2 A;  3EBW A;  3VG6 A;  2JMB A;  1LKE A;  5K06 A;  4Y59 A;  1X89 A;  3FR2 A;  2Q2M A;  3UEW A;  3VE2 A;  3UEU A;  3BS2 A;  1AB0 A;  4BBO A;  1DF3 A;  4AZR A;  1STR B;  2JN3 A;  2Q39 A;  4OKA A;  1VWG B;  5HZQ A;  1NDJ A;  2JU7 A;  2OFA A;  5KID A;  1U17 A;  4QGX A;  3AEH A;  5EDC A;  4GE1 A;  2YG2 A;  1X8P A;  5AEO A;  1SWN A;  3RDX A;  1NP1 A;  1TW4 A;  2F73 A;  2IZC B;  2CM9 A;  1RXH A;  3GE2 A;  3HPE A;  4NP1 A;  1FEL A;  1X8U A;  3ZZV A;  3VG4 A;  3EC5 A;  4O3W A;  1VWM B;  4BJ8 A;  2OF8 A;  5HZ8 A;  5LJK A;  5EPQ A;  3GAQ A;  4WFV A;  2FHN X;  2NNE A;  3P6G A;  3P6C A;  3E3C A;  1YWD A;  4GH7 A;  2E4J A;  4JNJ A;  5D4A A;  2ZSC A;  3RSW A;  5AJB A;  1I4U A;  1RAV A;  3HK1 A;  4GK9 A;  4UU2 A;  1D3S A;  1MOY A;  1JQP A;  4ALO A;  5K67 A;  2BSZ A;  2M4L A;  1S44 A;  2OZQ A;  4QNI A;  4GDZ A;  3WJB A;  1GT1 A;  5CYB A;  2AH7 X;  3S26 A;  1JIW I;  4XMD A;  4KC8 A;  2LB6 A;  1IKE A;  5IRA A;  1SRF A;  4ZCB A;  2KT4 B;  1PBY A;  5LKF A;  3RWX A;  1HQP A;  3STK A;  3VGW A;  3ZWE A;  1LDO A;  1I05 A;  3SZI A;  1RLB E;  4O4O A;  1PMP A;  1B8E A;  3NX2 A;  4ORR A;  4IB8 A;  2FGS A;  1VWD B;  4A1H A;  4EXZ A;  5CE4 A;  1A57 A;  1O1V A;  1GKA A;  2UYW A;  1A18 A;  1IFC A;  2JOZ A;  2OY8 A;  4QGW A;  2IZH B;  1N9Y A;  1TVQ A;  4I9R A;  4L1N A;  5H9L A;  3VG3 A;  4MIR A;  4YGH A;  2WPU A;  2GC9 A;  4ZH9 A;  3VHI A;  3ELX A;  1FJ1 E;  2ZAG A;  1B0O A;  4BX6 B;  4YBP A;  1OBP A;  1DZJ A;  2ACP X;  3APW A;  1SWT A;  1E2T A;  3EMM A;  4ZGU A;  3U03 A;  1SRJ A;  3SOT A;  1LFO A;  4AZM A;  1HMT A;  1EQD A;  2OVE A;  2QO6 A;  4C5P A;  2IZI A;  4O4S A;  2RTH B;  4GNY A;  4BOE A;  1BWY A;  3DSZ A;  1SWL A;  4NW4 A;  2Q9S A;  3I17 A;  3CQN A;  4Z27 A;  2JW1 A;  3FYF A;  1XKI A;  3T2W A;  4UU3 A;  4CPE A;  1QAB E;  3X00 A;  1KZW A;  1U0X A;  3IA8 A;  3FA6 A;  2ALL X;  3D4R A;  4GKC A;  4KH8 A;  5IXG A;  2QCB A;  2WUT A;  3EW2 A;  3OBL A;  1W5R A;  2OVD A;  3CKF A;  4I95 A;  2OFM X;  1SY3 A;  4NV7 A;  4O4U A;  4ORW A;  4GGT A;  3BX8 A;  4IB7 A;  3P6H A;  4Y0S A;  2IZG B;  5KHP A;  2W2B A;  2RCQ A;  1X8O A;  4DCB A;  2AKQ A;  2RTB B;  2OL8 O;  2Y3F A;  4AW8 A;  2RCT A;  2FT9 A;  3SLT A;  4ZHF A;  2BT9 A;  2LA7 A;  3G7X A;  4YKO A;  1EIO A;  4RUN A;  1AQB A;  4FQB B;  4HPD A;  3T6F A;  3NQK A;  4XME A;  1KGL A;  1SRH A;  3WYQ A;  1VWB B;  4ZJ0 A;  4CV7 A;  4INN A;  4ODD A;  4KCA A;  3HWG A;  3P6F A;  1PEE A;  3SAO A;  3T6L A;  3NPO A;  2QO5 A;  3KFH A;  5D47 A;  1YP6 A;  1SWC A;  2KD2 A;  5B11 O;  2L9C A;  5H9K A;  3HWD A;  1DC9 A;  1RSU B;  4ZR2 A;  3ZW0 A;  4NNS A;  1VWQ B;  1PTS A;  5KIC A;  3TGB A;  2Q2P A;  1QY2 A;  3DTQ A;  5DPQ A;  2NNQ A;  3FEP A;  4LKP A;  1A3Y A;  1IW2 A;  2A13 A;  3BY0 A;  3P6E A;  4EDE A;  5HA1 A;  5H9N A;  1CBQ A;  4YCH A;  1X71 A;  3D97 A;  4CDE A;  1VWH B;  1HBQ A;  2RTO B;  4ZHH A;  4ORS A;  4CPH B;  2X8F A;  2HNX A;  1SXX A;  2RTG B;  4XMH A;  2RA6 A;  1MDC A;  3VE1 A;  4ORU A;  3PED A;  3HTY A;  1Y52 X;  1FTP A;  2GTL N;  1I06 A;  1LF7 A;  2K62 A;  4QYN A;  2AT0 X;  2R74 A;  1QQS A;  4U8U M;  2X8S A;  4QQ1 A;  5F6Z A;  5B5F A;  1LIC A;  2X4M A;  5LJC A;  2C4I A;  2BS6 A;  4KT5 A;  4QYP A;  3TGC A;  1SWP A;  1KFF A;  2QO4 A;  1GXA A;  1UYN X;  3N91 A;  4Z2P A;  4WBK A;  3FR4 A;  4K19 A;  5LJB A;  1VWP B;  1SRG A;  1Y0G A;  3NAD A;  4YGG A;  2L68 A;  4GUZ A;  2XKL A;  5EEE A;  2RQ0 A;  4O3X B;  1OEJ A;  1XCA A;  5HCE C;  1N7Y A;  3S60 A;  2RTI B;  3F8A A;  1TXL A;  1ALB A;  4BX6 A;  4DQ3 A;  1SWQ A;  3VG2 A;  5FEN A;  1KQX A;  3S5X A;  1SY1 A;  4GU8 A;  3APU A;  4BX5 B;  1O1U A;  1T68 X;  5IO5 A;  1SWB A;  2MHD A;  2QOM A;  5BVQ A;  3WVM A;  1HXL A;  1JMX A;  2C1Q A;  3UEX A;  2CZT A;  1IJ8 A;  3VHH A;  2MWH A;  1Z24 A;  3CBS A;  1WUB A;  2VDF A;  1E5P A;  1LCW A;  3NR3 A;  4QRL A;  4BVM A;  4CSB A;  1JBH A;  2FHL A;  1BEB A;  4ZGF A;  1YUP A;  1VWJ B;  4HPB A;  1G7N A;  2RTN B;  3F9D A;  5IO7 A;  1TOU A;  2FKG A;  4GET A;  1DZP A;  1VWE B;  1SRI A;  2G78 A;  3PP6 A;  4LKT A;  4OEL A;  1JYD A;  3OE3 A;  5EDB A;  1KT7 A;  2A2G A;  1DF8 A;  5HAE A;  1GX3 A;  1KT6 A;  5JR8 A;  1LDQ A;  2QOS C;  1LID A;  3P02 A;  2Y32 A;  1T8V A;  5B5G A;  3VHM A;  3KVN A;  1GT5 A;  1HMR A;  3O19 A;  4AZP A;  4A1Y A;  2G7B A;  5HWZ A;  1LEL A;  4OMX A;  4U3Q A;  5JD2 A;  1KL5 A;  1CBS A;  1KT4 A;  1YP7 A;  2A2U A;  5K68 A;  4HFO A;  4ARH A;  2OYB O;  1GX8 A;  4O49 A;  2A0A A;  3WJF A;  1FEM A;  2AT5 X;  3CMP A;  3FW5 A;  2KTD A;  3C78 X;  1VPR A;  1OSP O;  4QZT A;  2RTP B;  2DJF A;  1B4M A;  2X46 A;  4WFU A;  1JMZ A;  4JGL A;  3BRN A;  3STM X;  1RST B;  4TLJ A;  3Q6L A;  5B27 A;  4FBV A;  1KQW A;  1CBI A;  2VFC A;  2NP1 A;  1ZND A;  4ZHG A;  1SWO A;  2HZR A;  4XMF A;  1KT3 A;  3D95 A;  5EED A;  3KFF A;  4IB6 A;  1DZM A;  2RTC B;  3PPT A;  2L5P A;  1JJU A;  1VYG A;  3APX A;  2HKD A;  4TNN A;  1KZX A;  3T1D A;  3ZUI A;  3PDF A;  4CPF A;  4TQ2 A;  1BRQ A;  3WJG A;  1UYO X;  1EW3 A;  1SWR A;  3QQ2 A;  2RTK A;  4FBR A;  1VWL B;  1VWI B;  4GZV A;  1VWO B;  4IRW A;  4KII A;  5LJE A;  1RBP A;  1WBI A;  5IO6 A;  3EBK A;  2RTL A;  3RDM A;  2MO5 A;  1G5W A;  2IZA A;  1URE A;  3B2K A;  3ZUO A;  2GJ5 A;  1SA8 A;  2X8T A;  1AVG I;  1SWE A; 
#chains in the Genus database with same CATH homology
 3LHN A;  2WQ9 A;  4YFR A;  3ELZ A;  3WJD A;  1YWC A;  3PH6 A;  2POA A;  4YCE A;  2R73 A;  4HWM A;  2GTL O;  1YWA A;  4MVL A;  2QMI A;  4O3Y A;  3B2H A;  3PQS A;  4D6B A;  1GM6 A;  1EI5 A;  4D6A A;  4ORY A;  3V8U A;  4MVK A;  4I6S A;  4NNT A;  4YDB A;  3MBT A;  4WHI A;  1GGL A;  4KC7 A;  1QFT A;  1GT3 A;  1ZNH A;  1EXS A;  2ANS A;  3B2J A;  1D2U A;  3NX1 A;  4NLJ A;  3EYC A;  3JS1 A;  2MM3 A;  4COT A;  1DV9 A;  4AZN A;  4ZFX A;  4Y0Q A;  1CBR A;  3UEW A;  1SMP I;  2RN4 A;  2WSJ A;  3JSQ A;  3NP1 A;  5LJG A;  4QZU A;  3RBY A;  1JYJ A;  1EII A;  1MVG A;  4A8Z A;  1QY0 A;  2FLJ A;  5FQ6 E;  3FR5 A;  1ML7 A;  4YBU A;  1KXO A;  3IFB A;  1IFB A;  2JU8 A;  1B56 A;  1ERB A;  2R56 A;  4XMC A;  5FQ8 E;  3FEN A;  5FQ7 E;  4IMO A;  2P8G A;  1EPB A;  2K23 A;  4QGV A;  4I3B A;  3PEC A;  4MVI A;  3OJY C;  3O2Y A;  2PY1 A;  1BLR A;  3I0A A;  2W2A A;  1N0S A;  4FBO A;  1LNM A;  1BBP A;  1MX7 A;  2XST A;  4YFP A;  2JU3 A;  2Z4I A;  1U18 A;  2AT3 X;  4I3C A;  3B2I A;  3F6Z B;  1CJ5 A;  3PH5 A;  1GKA B;  1GT4 A;  1G85 A;  3ZW1 B;  3APV A;  3S5V A;  2FTB A;  4O4X A;  2HMB A;  5D48 A;  5LJD A;  1OEK A;  3MVF A;  1H91 A;  3KFI A;  3O22 A;  4ORX A;  4PJ2 A;  4LZU A;  3FLL A;  2BHV A;  2AT8 X;  2EU7 X;  3NQ9 A;  1T0V A;  1GX9 A;  1S7D A;  1VYF A;  4NYR A;  1JJJ A;  1BSO A;  3FW4 A;  2N93 A;  5D8J A;  1O8V A;  5HA0 A;  3TF6 A;  1IKJ A;  5H9A A;  1LPJ A;  2ACO A;  4EFG A;  2WR6 A;  5F7G A;  1E06 A;  2FS6 A;  5L8N A;  4LQZ A;  4YMY A;  3RKG A;  5C0N A;  4ID2 A;  3VPJ E;  1X8N A;  4XMG A;  4OS8 A;  2WWP A;  5EZ2 A;  4YH0 A;  4GRJ A;  5LKE A;  3L4R A;  5HCD C;  4EEJ A;  3RZY A;  1MUP A;  4N7D A;  4ZHD A;  1ZRY A;  4M6S A;  2YMS A;  1E02 A;  1EPA A;  4MIS A;  3HOL A;  3FEL A;  4OS3 A;  3FA9 A;  5HZ5 A;  3QKG A;  5HZ9 A;  5L8O A;  2DM5 A;  4O3Z A;  3ZW0 B;  1A2D A;  1ZNL A;  1LIE A;  1JV4 A;  4IAX A;  2F09 A;  2AMM X;  1S2P A;  4DQ4 A;  1BSY A;  1YIV A;  1HN2 A;  4NYQ A;  2O62 A;  5L8I A;  4Y0P A;  1Y9T A;  3CWK A;  2LBV A;  5D45 A;  4U8U N;  1P6P A;  4RUU A;  5BVT A;  5FFH A;  2LFO A;  1QY1 A;  2FS7 A;  2QM9 A;  1ICM A;  2BS5 A;  2AL0 X;  2GTF X;  2OVS A;  2LKK A;  4YDA A;  1G74 A;  3CQR A;  1OPA A;  3HWF A;  2BLG A;  2OVA A;  3B2L A;  4AZO A;  1OEE A;  4IMN A;  3ZQ3 A;  2WQA E;  1PM1 X;  3OD9 A;  1KT5 A;  4GNW A;  2KW1 A;  4IB9 A;  2HZQ A;  4NLI A;  5BVS A;  1ZNG A;  3HWE A;  5AQ6 A;  1OBQ A;  3ZW1 A;  2GTL M;  4YGZ A;  2IFB A;  5BYP A;  4I9S A;  4AYH A;  3ZW2 A;  3CR6 A;  1MX8 A;  1L6M A;  4A60 A;  2ASN X;  1R0U A;  1TOW A;  2WEW A;  3FEK A;  5B29 A;  2OFR X;  1JJX A;  2L67 A;  1BSQ A;  4N7C A;  3TGA A;  3U9P C;  1CRB A;  3BLG A;  1NGL A;  3WJE A;  4HPA A;  1X8Q A;  3KQ0 A;  3CBC A;  3HOE A;  1BJ7 A;  3FIQ A;  4OMW A;  3NQ3 A;  4Y0R A;  2FWV A;  2ZAI A;  1YWB A;  2FRS A;  3KZA A;  2CZU A;  3PQU A;  4ZH6 A;  4QAE A;  3C76 X;  3BSZ E;  1FEN A;  4TKH A;  2CM4 A;  1DFV A;  4YKM A;  1ZNE A;  5H8T A;  3BU9 A;  1OPB A;  1SY2 A;  2WEX A;  1E00 A;  3LV4 A;  1JZU A;  4ZHC A;  1QFV A;  2MJI A;  5FAZ A;  4ALB A;  2HYS A;  2NND A;  3STN A;  4IBA A;  3TZS A;  1SXW A;  4O9S A;  1QG5 A;  1QWD A;  1Y9L A;  4R0B A;  1PBO A;  4ON1 A;  3JQO A;  4CK4 A;  4FGI B;  1SXY A;  2Z4H A;  4AZQ A;  1AEL A;  3NBX X;  4EQA C;  2FR3 A;  1OBU A;  3C77 X;  2W2F A;  4HPC A;  3ZI8 A;  5LJH A;  4TKJ A;  1KOI A;  4YFQ A;  2CBR A;  3D96 A;  3FA7 A;  5F6B A;  1SY0 A;  3VU1 A;  2RD7 C;  3UAQ A;  1ERX A;  3FMZ A;  1ACD A;  3WBG A;  2AT6 X;  2A3F X;  5HTE A;  3K3L A;  4L3R A;  1EUO A;  3P6D A;  5DG4 A;  3UEV A;  1BRP A;  3AKM A;  4I3D A;  4BQU A;  5HZ6 A;  1LIF A;  1UZ2 X;  2HLV A;  4TJZ A;  3WXQ A;  5F58 A;  1ICN A;  4ES7 A;  1ZNK A;  3P24 A;  1IIU A;  1SXU A;  4M7M A;  1HBP A;  4OS0 A;  5HCC C;  4IAW A;  1LIB A;  1FE3 A;  4PSQ A;  1FDQ A;  5HBS A;  4IAB A;  4MVE A;  4U8U O;  2LBA A;  3BX7 A;  5AJC A;  1BM5 A;  2Q4N A;  2G79 A;  1I04 A;  1ADL A;  3AKN A;  5HTD A;  3FA8 A;  4LZV A;  3EM0 A;  3U0D A;  4TKB A;  3VG5 A;  1EAL A;  4U9C A;  3BDR A;  1DZK A;  1HMS A;  4ML7 B;  5F1E A;  2CBS A;  3WJC A;  3MX7 A;  2X45 A;  3KFG A;  3H3I A;  2KTS A;  3BU1 A;  1NP4 A;  2FR2 A;  3EBW A;  3VG6 A;  2JMB A;  1LKE A;  5K06 A;  1X89 A;  3FR2 A;  2Q2M A;  3VE2 A;  3UEU A;  3BS2 A;  1AB0 A;  1DF3 A;  4AZR A;  2JN3 A;  2Q39 A;  5HZQ A;  2JU7 A;  5KID A;  1U17 A;  4QGX A;  5EDC A;  4GE1 A;  2YG2 A;  1X8P A;  5AEO A;  1NP1 A;  1TW4 A;  2F73 A;  2CM9 A;  3GE2 A;  4NP1 A;  1FEL A;  1X8U A;  3ZZV A;  3VG4 A;  4O3W A;  5HZ8 A;  5LJK A;  5EPQ A;  3GAQ A;  4WFV A;  2NNE A;  3P6C A;  3P6G A;  3E3C A;  1YWD A;  4GH7 A;  2E4J A;  5D4A A;  5AJB A;  1I4U A;  3HK1 A;  4UU2 A;  4GK9 A;  1D3S A;  4ALO A;  2M4L A;  1S44 A;  2OZQ A;  4QNI A;  4GDZ A;  3WJB A;  1GT1 A;  5CYB A;  2AH7 X;  3S26 A;  1JIW I;  4XMD A;  4KC8 A;  2LB6 A;  1IKE A;  4ZCB A;  2KT4 B;  5LKF A;  3RWX A;  1HQP A;  3STK A;  3ZWE A;  1I05 A;  1RLB E;  4O4O A;  1PMP A;  1B8E A;  3NX2 A;  4ORR A;  4IB8 A;  4A1H A;  4EXZ A;  1A57 A;  5CE4 A;  1O1V A;  1GKA A;  1A18 A;  1IFC A;  2JOZ A;  4QGW A;  1TVQ A;  4I9R A;  4L1N A;  5H9L A;  3VG3 A;  4MIR A;  4YGH A;  4ZH9 A;  2GC9 A;  3WOV A;  3ELX A;  4YBP A;  2ZAG A;  1B0O A;  1OBP A;  1DZJ A;  2ACP X;  3APW A;  3EMM A;  4ZGU A;  3U03 A;  4AZM A;  3SOT A;  1LFO A;  1HMT A;  1EQD A;  2OVE A;  2QO6 A;  4O4S A;  4BOE A;  4GNY A;  1BWY A;  3DSZ A;  4NW4 A;  2Q9S A;  3I17 A;  3CQN A;  2JW1 A;  3FYF A;  1XKI A;  4UU3 A;  1QAB E;  1KZW A;  1U0X A;  3IA8 A;  3FA6 A;  2ALL X;  3D4R A;  4GKC A;  4KH8 A;  2WUT A;  4I95 A;  3OBL A;  2OVD A;  3RSW A;  3VG7 A;  2OFM X;  1SY3 A;  4O4U A;  4ORW A;  3BX8 A;  4IB7 A;  3P6H A;  4Y0S A;  5KHP A;  2W2B A;  2RCQ A;  1X8O A;  2AKQ A;  4AW8 A;  2RCT A;  2FT9 A;  4ZHF A;  2BT9 A;  2LA7 A;  3G7X A;  4YKO A;  1EIO A;  4RUN A;  1AQB A;  4FQB B;  4HPD A;  1KGL A;  3NQK A;  4XME A;  4ZJ0 A;  4CV7 A;  4INN A;  4ODD A;  4KCA A;  3HWG A;  3P6F A;  1PEE A;  3SAO A;  3NPO A;  2QO5 A;  3KFH A;  5D47 A;  1YP6 A;  2KD2 A;  2L9C A;  5H9K A;  3HWD A;  1DC9 A;  4ZR2 A;  3ZW0 A;  4NNS A;  5KIC A;  3TGB A;  2Q2P A;  1QY2 A;  3DTQ A;  5DPQ A;  2NNQ A;  3FEP A;  4LKP A;  1A3Y A;  1IW2 A;  2A13 A;  3BY0 A;  3P6E A;  4EDE A;  5HA1 A;  5H9N A;  1CBQ A;  4YCH A;  1X71 A;  3D97 A;  1HBQ A;  4ZHH A;  4ORS A;  2X8F A;  2HNX A;  1SXX A;  3VE1 A;  4XMH A;  2RA6 A;  1MDC A;  4ORU A;  3PED A;  3HTY A;  1FTP A;  2GTL N;  1I06 A;  1LF7 A;  2K62 A;  4QYN A;  2AT0 X;  2R74 A;  1QQS A;  4U8U M;  2X8S A;  4QQ1 A;  5F6Z A;  1LIC A;  5LJC A;  4QYP A;  2BS6 A;  4KT5 A;  3TGC A;  2QO4 A;  1GXA A;  3N91 A;  4WBK A;  3FR4 A;  4K19 A;  5LJB A;  3NAD A;  4YGG A;  2L68 A;  2XKL A;  5EEE A;  2RQ0 A;  4O3X B;  1OEJ A;  1XCA A;  5HCE C;  3S60 A;  3F8A A;  1TXL A;  1ALB A;  4DQ3 A;  3VG2 A;  5FEN A;  1KQX A;  3S5X A;  1SY1 A;  4GU8 A;  3APU A;  1O1U A;  1T68 X;  5IO5 A;  5BVQ A;  2MHD A;  3WVM A;  3UEX A;  2CZT A;  2MWH A;  1Z24 A;  3CBS A;  1E5P A;  3NR3 A;  4QRL A;  4BVM A;  4CSB A;  1JBH A;  1BEB A;  4ZGF A;  1YUP A;  4HPB A;  1G7N A;  3F9D A;  5IO7 A;  1TOU A;  4GET A;  1DZP A;  2G78 A;  3PP6 A;  4LKT A;  1JYD A;  3OE3 A;  5EDB A;  1KT7 A;  2A2G A;  5HAE A;  1KT6 A;  5JR8 A;  2QOS C;  1LID A;  3P02 A;  1T8V A;  4AZP A;  1GT5 A;  1HMR A;  3O19 A;  5HWZ A;  4A1Y A;  2G7B A;  4OMX A;  4U3Q A;  1CBS A;  1KT4 A;  1YP7 A;  2A2U A;  4ARH A;  4HFO A;  1GX8 A;  4O49 A;  2A0A A;  3WJF A;  1FEM A;  2AT5 X;  3CMP A;  3FW5 A;  2KTD A;  3C78 X;  1VPR A;  4QZT A;  1B4M A;  2X46 A;  4WFU A;  4JGL A;  3BRN A;  3STM X;  4TLJ A;  3Q6L A;  5B27 A;  4FBV A;  1KQW A;  1CBI A;  2NP1 A;  1ZND A;  4ZHG A;  2HZR A;  4XMF A;  1KT3 A;  3D95 A;  5EED A;  3KFF A;  4IB6 A;  1DZM A;  3PPT A;  2L5P A;  1VYG A;  3APX A;  4TNN A;  1KZX A;  3T1D A;  3ZUI A;  4TQ2 A;  1BRQ A;  3WJG A;  1EW3 A;  4FBR A;  4GZV A;  5LJE A;  4KII A;  1RBP A;  5IO6 A;  3EBK A;  2MO5 A;  1G5W A;  1URE A;  3B2K A;  3ZUO A;  2GJ5 A;  1SA8 A;  2X8T A;  1AVG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...