2DJGA

Re-determination of the native structure of human dipeptidyl peptidase i (cathepsin c)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
114
Chain Sequence
b'DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKKVTTYCNETMTGWVHDVLGRNWACFTGKKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 24
structure length 114
sequence length 118
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 2djgA00
4OELA 4CDDA 4CDEA 4CDCA 2DJGA 1K3BA 1JQPA 4OEMA 3PDFA 4CDFA 2DJFA
chains in the Genus database with same CATH superfamily
4OKAA 1STRB 4JGLA 5EEEA 1T0VA 1SY3A 1OBUA 3BS2A 1N0SA 1VWQB 3FR4A 4U3QA 3KZAA 2RTNB 5F1EA 4A1YA 4NNSA 5F2BA 1HQQA 2AT3X 1BM5A 1BWYA 1LCVA 1NDJA 2RTHB 4GK9A 4TNNA 5B3MO 3SLTA 1JYDA 3ZW0A 2BT9A 4ARHA 1GT5A 1CJ5A 2IZLB 3PP6A 1UYNX 2Q2PA 2IZJA 2WR6A 5EPQA 2FKGA 4Y0SA 3IFBA 3NP1A 3O19A 4TKHA 2IZEB 1VWFB 2CBSA 1E5PA 4C5PA 2CM9A 5F7GA 2NNEA 2HMBA 2VFCA 3FA9A 4QQ1A 5HZ9A 3T2XA 4BOEA 2X8TA 3FLLA 1W4TA 2C1SA 3BLGA 2FGSA 4GJSA 4RUUA 3WZQA 1CBSA 1Y53X 2G5LA 3LHNA 3FW4A 3P6EA 4IB9A 4QRLA 2FT9A 3D97A 1B4MA 1SWUA 2OFMX 2OFRX 1IIUA 3S26A 2N93A 3CQRA 4BBOA 3PEDA 5BVSA 1I4UA 2LFOA 4YCHA 4Z27A 2K62A 2ANSA 2M4LA 1KOIA 2W2BA 3OJYC 5D45A 1AVEA 3ZQ3A 1S7DA 4CPHB 4O4XA 2A3FX 4QYNA 1BSQA 2MJIA 3FIQA 1SRGA 3CBCA 2CZUA 4KCAA 4QGWA 3UEXA 4GH7A 3CMPA 3D4RA 3HOLA 4NV8A 1HMRA 4YGGA 3BDRA 3BY0A 4UU3A 2HZRA 4CDDA 1RXKA 4MVIA 5HBSA 3UEUA 3TGBA 4OEMA 5F58A 2Q2MA 4FBOA 2IZAA 1AQBA 1LIEA 1QY1A 3RDUA 4YBPA 4QZUA 2HYSA 2JW1A 1IJ8A 2R74A 5CHKA 1ZNEA 3N91A 2KT4B 4U8UO 4NV7A 4IMOA 4YDBA 4WBKA 2OYBO 1MDCA 3WJDA 1AVGI 3WYQA 4YFPA 5K06A 4I6SA 3WZOA 1D2UA 1CRBA 2RTLA 4IMNA 1SWGA 4DQ3A 1YWBA 1OBQA 1SWAA 3QKGA 5AJCA 1RBPA 4Y5DA 4ALBA 4YBUA 1LNMA 1SWQA 3BU1A 2YMSA 4MVEA 5EDBA 3T6FA 4IAWA 1LF7A 2G7BA 1QABE 2HKDA 1E2TA 3DTQA 3PPTA 3ZW2A 1MUPA 2QOMA 3P6DA 1YIVA 1MOYA 1SRIA 5AJBA 4O4OA 4ZH9A 4D6BA 3SZIA 4CPHA 2OVSA 5B5FA 4ZCBA 1ZRYA 1BSYA 3ZW1B 4HPBA 3VG2A 4DQ4A 1PTSA 4TLJA 4D6AA 3HWGA 1E06A 3MG5A 3WOVA 4BVMA 4BX6A 3STNA 1KZXA 5LJKA 2RTRB 1SLFB 2AKQA 2LBAA 3FEKA 3CQNA 3NADA 1BBPA 2LBVA 4CDFA 5HZQA 1JJUA 2RTPB 3NPOA 3WVMA 1SLGB 1HXLA 1SRJA 4MVKA 3H3IA 1SWRA 1VWDB 1VWJB 2POAA 4M7MA 1RSUB 2FR3A 2OFAA 3SOTA 4AZQA 5D47A 3LTWA 1VPRA 3VE1A 3PH6A 3RDOA 1EW3A 5L8OA 3U03A 3APWA 4UU2A 3BRNA 2CM4A 2VFBA 1TOUA 1GT1A 1VYFA 2JU7A 1P6PA 2MWHA 4LKTA 4TKBA 4ORSA 3VHIA 4ES7A 1OSPO 2CBRA 1FENA 3CR6A 3KQ0A 3S5VA 3STKA 1JBHA 3RZYA 3RBYA 1STPA 3RDXA 4XMCA 1X71A 2QO6A 3C76X 4NW4A 1RXJA 2RTJA 3UAQA 4U9CA 1Y9TA 2QO4A 3FELA 3APVA 3ZW0B 1MM9A 2X34A 2XSTA 4MEEA 3WJCA 2BLGA 2QMIA 3B2LA 3T2WA 2PI3O 4WFVA 5L3YA 1LCWA 1CBIA 3SAOA 4I9SA 1DZKA 1VWMB 4NYQA 1HMSA 2AL0X 4OS3A 2I5VO 1N43A 1NC9A 1SXYA 3JS1A 1SRFA 1CBRA 4TQ2A 2RN4A 5C0NA 1RSTB 2NNQA 2OL8O 2Q9SA 4YFRA 1SLEB 2OL7A 3RWXA 3RY1A 4Z2OA 4O3XB 3RY2A 3B2KA 3PH5A 4INNA 3ELZA 3RE6A 1EIIA 1TW4A 2BHVA 1Z24A 1SREA 5CE4A 4YGHA 2O62A 3ZZVA 2HLVA 5KICA 2C1QA 3I0AA 2OY7A 4OMXA 1R0UA 2A2GA 4JHQA 1D3SA 1ZNLA 2R73A 1RLBE 3UEWA 1KXOA 4ORUA 4AZNA 1Y52X 2AT0X 3RKGA 4DNEA 1FJ1E 1JIWI 3HTYA 2IZFB 2L5PA 3RDSA 3APUA 1HBPA 1KQXA 2X8FA 2HNXA 3JQOA 3NQ9A 3OBLA 1PBOA 2X46A 4HPCA 4ON1A 4XMFA 3EW1A 1MX8A 2AH7X 1JJXA 2OFBA 5LJHA 1IKEA 3MX7A 4HPDA 4FBRA 3VG3A 2E4JA 5LKEA 4N7CA 4GETA 1ZNHA 3HWDA 3D96A 5FQ8E 2FTBA 3QQ2A 3ELXA 5FENA 3BX8A 2UZ2A 5IO6A 4IBAA 1LFOA 3WJEA 1I04A 1QY0A 3B2HA 3ZUIA 3L4RA 3U0DA 1EALA 2UYWA 1BRQA 4AZOA 5HWZA 1A18A 1TOWA 1VWRB 3PK2A 1JYJA 1GX3A 4EFGA 4EKVA 2F73A 2ACPX 1BLRA 4A8ZA 1K3BA 2AF5A 1YUPA 2JU8A 1SXXA 3PECA 1GT3A 1KFFA 4PSQA 1WUBA 2OVEA 2QO5A 4GNWA 1ICNA 5L8NA 4YGZA 2AT6X 1JQPA 1DC9A 2RTEB 2ALLX 5EZ2A 4CPFA 1FTPA 1I06A 4M6SA 5K68A 5JR8A 2FWVA 1QFVA 2A5CA 5FFHA 1QQSA 4BX6B 2RTMA 3KFIA 1EXSA 4O4UA 1AB0A 5HAEA 3P6GA 1AVDA 1SY1A 3CKFA 2RD7C 1E00A 2G79A 4KIIA 1BSOA 1S44A 2ZAGA 2ZSCA 3FMZA 3WJGA 3Q34A 1EQDA 3EBKA 3EM0A 2NNDA 1GM6A 4O3ZA 3SLJA 5IO5A 1PMPA 1AELA 1X8NA 4BJ8A 4BX5A 4EQAC 4CPEA 1KT4A 2FLJA 4MISA 1DZJA 5AEOA 1SY0A 5EDCA 1OPBA 1E02A 2WQ9A 1LIDA 2L67A 4GKCA 4NP1A 1B8EA 3RDMA 3V8UA 2HZQA 5H9AA 2WPUA 5HA0A 5IXGA 2G78A 3AKMA 4EXZA 1DZMA 5D4AA 1BEBA 1HMTA 3KFFA 1JMXA 1MK5A 3F9DA 5HA1A 2L9CA 5LJCA 2VDFA 3VHMA 2MM3A 4ZFXA 4TKJA 4EDEA 1SLDB 2OY8A 1UREA 1SWCA 5LJDA 1N9YA 1O1UA 5IO7A 4XMDA 5H9KA 5H9LA 4HWMA 1JMZA 4LKPA 1GKAA 2YG2A 1LELA 2MO5A 1VWCB 1VWPB 4ALOA 5KHPA 4CDCA 1DF3A 1KZWA 2L68A 2OL6O 3KFGA 1G85A 4OS0A 3B2JA 4XMGA 3U9PC 2OVDA 2FR2A 3NBXX 5D48A 3VHHA 3PDFA 4ORYA 2WWPA 1KL4A 2JOZA 1ADLA 3KVNA 4I95A 1GT4A 3FA6A 3MVFA 1OEEA 4QGVA 4YKOA 1LPJA 1UZ2X 1SWPA 1LDOA 2KW1A 2OVAA 2OY1O 4GZVA 4O3WA 1X8OA 1X8PA 2G8CO 4LQZA 3APXA 1VYOA 4GGTA 4JNJA 2W2AA 2WUTA 4ZH6A 2X32A 3SLOA 4A1HA 1EUOA 4KC7A 4I3CA 4L3RA 3TGCA 1QY2A 3HWEA 2JGSA 1O8VA 4ZGFA 1KL3A 2C4IA 2RTOB 3O22A 2KD2A 1VWIB 4KT5A 1SWJA 1FEMA 1U0XA 2A13A 2Q39A 4GJVA 3EW2A 1Y55X 4AYHA 5EEDA 1B0OA 2JN3A 1QFTA 2K23A 4OELA 4XMEA 3UEVA 1STSB 4BGFA 1YWCA 3FA8A 4GDAA 1LIFA 1N7YA 1SY2A 2A8GA 4BX7B 1EIOA 1BJ7A 3CBSA 1SWNA 1PM1X 2DJGA 2X8SA 1G7NA 2QOSC 3P6FA 2NP1A 4GNYA 3WYPA 4ZHFA 3TZSA 5KIDA 1T8VA 4I9RA 1SWOA 1ZNKA 1LICA 4IRWA 1DFVA 4MVLA 5F6ZA 5JD2A 5LJGA 3VG5A 4OMWA 2ACOA 1QWDA 5B27A 1PBYA 5HZ8A 5B10O 3VG4A 1OEKA 1BRPA 1G74A 4I3BA 3AUMO 1GX9A 2I5ZO 1N9MA 1OEJA 4ORRA 4YKMA 3PQSA 5IRAA 1NBXA 3P6CA 3VGWA 4GE1A 4YCEA 4RUNA 4AZRA 2FS7A 4GRJA 2BC3A 2RTDB 3AEHA 4ORXA 4XMHA 4R0BA 2RCTA 5BVTA 2CZTA 2OF8A 4QAEA 5BVQA 3VPJE 1B56A 2RTIB 4ORWA 1YP6A 4WHIA 2Y3EA 1LKEA 1SWLA 3LV4A 5HTDA 2IZKA 1VWKB 3GAQA 1SWHA 3I17A 1KGLA 3PQUA 1W5RA 2AT5X 1NQNA 2MHDA 2ZAIA 3WBGA 3WZPA 4BX7A 3OD9A 4GGRA 4YH0A 4KH8A 2CAMA 1SWFA 1ZNGA 4BX5B 2QM9A 3EMMA 2A5BA 5HCEC 1EI5A 1ACDA 4AZPA 3EYCA 1VWHB 4YVBA 4AW8A 5LJBA 1NGLA 3WXQA 4ZHHA 1FDQA 1HN2A 5HTEA 1SWKA 3NQKA 4IB6A 4NNTA 1KL5A 4ID2A 1H91A 1LUQA 2GTLN 1VYGA 5IRUA 2RTBB 2Y3FA 2BSZA 4IAXA 1T68X 1NP1A 5F6BA 1SMPI 2F01A 5DG4A 1EPBA 5K67A 3RDQA 3VG7A 2GC9A 2GH7A 1CBQA 3B2IA 4ZHCA 4JO6A 1VWOB 2X4MA 1YWDA 3WJFA 1GKAB 1I9HA 1W6FA 2KTDA 4I3DA 1RAVA 1SRHA 1VWAB 2X45A 3Q6LA 2LB6A 4HPAA 4ZR2A 1VWNB 3FW5A 2AT8X 2Y32A 3NR3A 2RCQA 4FQBB 4BQUA 2RTAA 4WFUA 4Y59A 4AZMA 3CKGA 3FIDA 3JSQA 3NX1A 2AVIA 2GTLM 1HQPA 3D9WA 3GE2A 4FBVA 1OPAA 4CV7A 4CPIA 4GU8A 2LA7A 3MM0A 1SWTA 3KFHA 1K24A 4LZUA 3WZNA 1XKIA 4ZGUA 1RXHA 3STMX 4O4SA 2DM5A 3FYFA 1NP4A 5LJEA 3MBTA 3WJBA 4K19A 4NLJA 4FGIB 4ZHGA 4IABA 1GXAA 1Y9LA 2EU7X 3NQ3A 1DV9A 3FENA 2OF9A 2GTFX 4O9SA 4OS8A 3RE5A 1ALBA 1HXZA 2WEWA 4IB8A 4Z2VA 4GGZA 4ODDA 1G5WA 3SZJA 4A60A 4ML7B 3T1DA 1SXWA 4CSBA 3C77X 5B5GA 4B55A 4EEJA 4COTA 1LDQA 1SA8A 5HZ5A 2FHNX 1ERBA 1O1VA 1ZNDA 2DJFA 3EC5A 3SZHA 1DF8A 2RTQB 1LCZA 2FS6A 3K3LA 3HPEA 4L1NA 5BYPA 4YMYA 2Z4IA 3FR2A 1MX7A 4Y0QA 2IZHB 3VE2A 1HY2A 3VU1A 1PEEA 3HK1A 3HOEA 2AMMX 4CK4A 5IRWA 1X8UA 2RTKA 4YFQA 5DPQA 1VWBB 1SWSA 3ZI8A 1KT7A 3EBWA 2FHLA 1KQWA 1VWGB 4U8UN 3G7XA 3FEPA 4KC8A 2FKJA 2Q4NA 2JU3A 2WSJA 3OE3A 4TJZA 5AQ6A 2LKKA 2OZQA 2F09A 1GGLA 2XKLA 3P6HA 1KT5A 4QGXA 1A57A 2IZDB 5B11O 5L8IA 1HBQA 4O3YA 3TGAA 2JMBA 4DCBA 4N7DA 4Y0PA 1TXLA 2IZGB 3IA8A 2W2FA 4PJ2A 3P24A 3E3CA 1Y0GA 4NYRA 1KT3A 3BU9A 2RQ0A 1LIBA 3ZWEA 2IZIA 2IZCB 1DZPA 1GX8A 1X89A 2WEXA 3DSZA 4QYPA 5FAZA 5FQ7E 1EPAA 4GDZA 2IZBA 3S5XA 1N4JA 2X56A 1YP7A 2WQAE 4U8UM 3T6LA 1ML7A 1VWLB 2ASNX 2RTCB 1OBPA 4QNIA 4MIRA 2PY1A 5HCCC 4ZJ0A 3FR5A 2OY5O 3F6ZB 2BS5A 4U46A 1SWEA 3FDCA 5CYBA 2RA6A 3P02A 1I78A 1MEPA 1IKJA 5LKFA 1KT6A 4QZTA 1WBIA 3S60A 3FA7A 4ZHDA 2GJ5A 4CDEA 5H8TA 1NQMA 5D8JA 1U18A 1JV4A 5H9NA 1S2PA 5FQ6E 2BS6A 5B29A 1IFCA 4Y0RA 1VWEB 3BX7A 4GUZA 3BSZE 3ZW1A 3ZUOA 3RSWA 5CSEA 4I60A 2RTFB 2P8GA 2QCBA 1I05A 1YWAA 4GD9A 3C78X 1U17A 2Z4HA 1TVQA 1UYOX 2A2UA 1FELA 3O2YA 5HZ6A 4Z6JA 4BCSA 1SWDA 4IB7A 1IFBA 2MF6A 3AKNA 4NLIA 3VG6A 1A3YA 2FRSA 3HWFA 1SXUA 1FE3A 1IW2A 1MVGA 1ICMA 1QG5A 4O49A 4YDAA 3TF6A 4Z28A 2A0AA 5HCDC 1JZUA 2R56A 1XCAA 4HFOA 1SWBA 1JJJA 3D95A 2GTLO 5B2AO 2KTSA 3X00A 1ERXA 2X55A 1L6MA 2RTGB 3CWKA 4LZVA 4Z2PA 1X8QA 2IFBA 1A2DA 3F8AA 3NX2A
chains in the Genus database with same CATH topology
4OELA 4CDDA 4CDEA 4CDCA 2DJGA 1K3BA 1JQPA 4OEMA 3PDFA 4CDFA 2DJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL A;  4CDD A;  4CDE A;  4CDC A;  2DJG A;  1K3B A;  1JQP A;  4OEM A;  3PDF A;  4CDF A;  2DJF A; 
#chains in the Genus database with same CATH topology
 4OKA A;  1STR B;  4JGL A;  5EEE A;  1T0V A;  1SY3 A;  1OBU A;  3BS2 A;  1N0S A;  1VWQ B;  3FR4 A;  4U3Q A;  3KZA A;  2RTN B;  5F1E A;  4A1Y A;  4NNS A;  5F2B A;  1HQQ A;  2AT3 X;  1BM5 A;  1BWY A;  1LCV A;  1NDJ A;  2RTH B;  4GK9 A;  4TNN A;  5B3M O;  3SLT A;  1JYD A;  3ZW0 A;  2BT9 A;  4ARH A;  1GT5 A;  1CJ5 A;  2IZL B;  3PP6 A;  1UYN X;  2Q2P A;  2IZJ A;  2WR6 A;  5EPQ A;  2FKG A;  4Y0S A;  3IFB A;  3NP1 A;  3O19 A;  4TKH A;  2IZE B;  1VWF B;  2CBS A;  1E5P A;  4C5P A;  2CM9 A;  5F7G A;  2NNE A;  2HMB A;  2VFC A;  3FA9 A;  4QQ1 A;  5HZ9 A;  3T2X A;  4BOE A;  2X8T A;  3FLL A;  1W4T A;  2C1S A;  3BLG A;  2FGS A;  4GJS A;  4RUU A;  3WZQ A;  1CBS A;  1Y53 X;  2G5L A;  3LHN A;  3FW4 A;  3P6E A;  4IB9 A;  4QRL A;  2FT9 A;  3D97 A;  1B4M A;  1SWU A;  2OFM X;  2OFR X;  1IIU A;  3S26 A;  2N93 A;  3CQR A;  4BBO A;  3PED A;  5BVS A;  1I4U A;  2LFO A;  4YCH A;  4Z27 A;  2K62 A;  2ANS A;  2M4L A;  1KOI A;  2W2B A;  3OJY C;  5D45 A;  1AVE A;  3ZQ3 A;  1S7D A;  4CPH B;  4O4X A;  2A3F X;  4QYN A;  1BSQ A;  2MJI A;  3FIQ A;  1SRG A;  3CBC A;  2CZU A;  4KCA A;  4QGW A;  3UEX A;  4GH7 A;  3CMP A;  3D4R A;  3HOL A;  4NV8 A;  1HMR A;  4YGG A;  3BDR A;  3BY0 A;  4UU3 A;  2HZR A;  4CDD A;  1RXK A;  4MVI A;  5HBS A;  3UEU A;  3TGB A;  4OEM A;  5F58 A;  2Q2M A;  4FBO A;  2IZA A;  1AQB A;  1LIE A;  1QY1 A;  3RDU A;  4YBP A;  4QZU A;  2HYS A;  2JW1 A;  1IJ8 A;  2R74 A;  5CHK A;  1ZNE A;  3N91 A;  2KT4 B;  4U8U O;  4NV7 A;  4IMO A;  4YDB A;  4WBK A;  2OYB O;  1MDC A;  3WJD A;  1AVG I;  3WYQ A;  4YFP A;  5K06 A;  4I6S A;  3WZO A;  1D2U A;  1CRB A;  2RTL A;  4IMN A;  1SWG A;  4DQ3 A;  1YWB A;  1OBQ A;  1SWA A;  3QKG A;  5AJC A;  1RBP A;  4Y5D A;  4ALB A;  4YBU A;  1LNM A;  1SWQ A;  3BU1 A;  2YMS A;  4MVE A;  5EDB A;  3T6F A;  4IAW A;  1LF7 A;  2G7B A;  1QAB E;  2HKD A;  1E2T A;  3DTQ A;  3PPT A;  3ZW2 A;  1MUP A;  2QOM A;  3P6D A;  1YIV A;  1MOY A;  1SRI A;  5AJB A;  4O4O A;  4ZH9 A;  4D6B A;  3SZI A;  4CPH A;  2OVS A;  5B5F A;  4ZCB A;  1ZRY A;  1BSY A;  3ZW1 B;  4HPB A;  3VG2 A;  4DQ4 A;  1PTS A;  4TLJ A;  4D6A A;  3HWG A;  1E06 A;  3MG5 A;  3WOV A;  4BVM A;  4BX6 A;  3STN A;  1KZX A;  5LJK A;  2RTR B;  1SLF B;  2AKQ A;  2LBA A;  3FEK A;  3CQN A;  3NAD A;  1BBP A;  2LBV A;  4CDF A;  5HZQ A;  1JJU A;  2RTP B;  3NPO A;  3WVM A;  1SLG B;  1HXL A;  1SRJ A;  4MVK A;  3H3I A;  1SWR A;  1VWD B;  1VWJ B;  2POA A;  4M7M A;  1RSU B;  2FR3 A;  2OFA A;  3SOT A;  4AZQ A;  5D47 A;  3LTW A;  1VPR A;  3VE1 A;  3PH6 A;  3RDO A;  1EW3 A;  5L8O A;  3U03 A;  3APW A;  4UU2 A;  3BRN A;  2CM4 A;  2VFB A;  1TOU A;  1GT1 A;  1VYF A;  2JU7 A;  1P6P A;  2MWH A;  4LKT A;  4TKB A;  4ORS A;  3VHI A;  4ES7 A;  1OSP O;  2CBR A;  1FEN A;  3CR6 A;  3KQ0 A;  3S5V A;  3STK A;  1JBH A;  3RZY A;  3RBY A;  1STP A;  3RDX A;  4XMC A;  1X71 A;  2QO6 A;  3C76 X;  4NW4 A;  1RXJ A;  2RTJ A;  3UAQ A;  4U9C A;  1Y9T A;  2QO4 A;  3FEL A;  3APV A;  3ZW0 B;  1MM9 A;  2X34 A;  2XST A;  4MEE A;  3WJC A;  2BLG A;  2QMI A;  3B2L A;  3T2W A;  2PI3 O;  4WFV A;  5L3Y A;  1LCW A;  1CBI A;  3SAO A;  4I9S A;  1DZK A;  1VWM B;  4NYQ A;  1HMS A;  2AL0 X;  4OS3 A;  2I5V O;  1N43 A;  1NC9 A;  1SXY A;  3JS1 A;  1SRF A;  1CBR A;  4TQ2 A;  2RN4 A;  5C0N A;  1RST B;  2NNQ A;  2OL8 O;  2Q9S A;  4YFR A;  1SLE B;  2OL7 A;  3RWX A;  3RY1 A;  4Z2O A;  4O3X B;  3RY2 A;  3B2K A;  3PH5 A;  4INN A;  3ELZ A;  3RE6 A;  1EII A;  1TW4 A;  2BHV A;  1Z24 A;  1SRE A;  5CE4 A;  4YGH A;  2O62 A;  3ZZV A;  2HLV A;  5KIC A;  2C1Q A;  3I0A A;  2OY7 A;  4OMX A;  1R0U A;  2A2G A;  4JHQ A;  1D3S A;  1ZNL A;  2R73 A;  1RLB E;  3UEW A;  1KXO A;  4ORU A;  4AZN A;  1Y52 X;  2AT0 X;  3RKG A;  4DNE A;  1FJ1 E;  1JIW I;  3HTY A;  2IZF B;  2L5P A;  3RDS A;  3APU A;  1HBP A;  1KQX A;  2X8F A;  2HNX A;  3JQO A;  3NQ9 A;  3OBL A;  1PBO A;  2X46 A;  4HPC A;  4ON1 A;  4XMF A;  3EW1 A;  1MX8 A;  2AH7 X;  1JJX A;  2OFB A;  5LJH A;  1IKE A;  3MX7 A;  4HPD A;  4FBR A;  3VG3 A;  2E4J A;  5LKE A;  4N7C A;  4GET A;  1ZNH A;  3HWD A;  3D96 A;  5FQ8 E;  2FTB A;  3QQ2 A;  3ELX A;  5FEN A;  3BX8 A;  2UZ2 A;  5IO6 A;  4IBA A;  1LFO A;  3WJE A;  1I04 A;  1QY0 A;  3B2H A;  3ZUI A;  3L4R A;  3U0D A;  1EAL A;  2UYW A;  1BRQ A;  4AZO A;  5HWZ A;  1A18 A;  1TOW A;  1VWR B;  3PK2 A;  1JYJ A;  1GX3 A;  4EFG A;  4EKV A;  2F73 A;  2ACP X;  1BLR A;  4A8Z A;  1K3B A;  2AF5 A;  1YUP A;  2JU8 A;  1SXX A;  3PEC A;  1GT3 A;  1KFF A;  4PSQ A;  1WUB A;  2OVE A;  2QO5 A;  4GNW A;  1ICN A;  5L8N A;  4YGZ A;  2AT6 X;  1JQP A;  1DC9 A;  2RTE B;  2ALL X;  5EZ2 A;  4CPF A;  1FTP A;  1I06 A;  4M6S A;  5K68 A;  5JR8 A;  2FWV A;  1QFV A;  2A5C A;  5FFH A;  1QQS A;  4BX6 B;  2RTM A;  3KFI A;  1EXS A;  4O4U A;  1AB0 A;  5HAE A;  3P6G A;  1AVD A;  1SY1 A;  3CKF A;  2RD7 C;  1E00 A;  2G79 A;  4KII A;  1BSO A;  1S44 A;  2ZAG A;  2ZSC A;  3FMZ A;  3WJG A;  3Q34 A;  1EQD A;  3EBK A;  3EM0 A;  2NND A;  1GM6 A;  4O3Z A;  3SLJ A;  5IO5 A;  1PMP A;  1AEL A;  1X8N A;  4BJ8 A;  4BX5 A;  4EQA C;  4CPE A;  1KT4 A;  2FLJ A;  4MIS A;  1DZJ A;  5AEO A;  1SY0 A;  5EDC A;  1OPB A;  1E02 A;  2WQ9 A;  1LID A;  2L67 A;  4GKC A;  4NP1 A;  1B8E A;  3RDM A;  3V8U A;  2HZQ A;  5H9A A;  2WPU A;  5HA0 A;  5IXG A;  2G78 A;  3AKM A;  4EXZ A;  1DZM A;  5D4A A;  1BEB A;  1HMT A;  3KFF A;  1JMX A;  1MK5 A;  3F9D A;  5HA1 A;  2L9C A;  5LJC A;  2VDF A;  3VHM A;  2MM3 A;  4ZFX A;  4TKJ A;  4EDE A;  1SLD B;  2OY8 A;  1URE A;  1SWC A;  5LJD A;  1N9Y A;  1O1U A;  5IO7 A;  4XMD A;  5H9K A;  5H9L A;  4HWM A;  1JMZ A;  4LKP A;  1GKA A;  2YG2 A;  1LEL A;  2MO5 A;  1VWC B;  1VWP B;  4ALO A;  5KHP A;  4CDC A;  1DF3 A;  1KZW A;  2L68 A;  2OL6 O;  3KFG A;  1G85 A;  4OS0 A;  3B2J A;  4XMG A;  3U9P C;  2OVD A;  2FR2 A;  3NBX X;  5D48 A;  3VHH A;  3PDF A;  4ORY A;  2WWP A;  1KL4 A;  2JOZ A;  1ADL A;  3KVN A;  4I95 A;  1GT4 A;  3FA6 A;  3MVF A;  1OEE A;  4QGV A;  4YKO A;  1LPJ A;  1UZ2 X;  1SWP A;  1LDO A;  2KW1 A;  2OVA A;  2OY1 O;  4GZV A;  4O3W A;  1X8O A;  1X8P A;  2G8C O;  4LQZ A;  3APX A;  1VYO A;  4GGT A;  4JNJ A;  2W2A A;  2WUT A;  4ZH6 A;  2X32 A;  3SLO A;  4A1H A;  1EUO A;  4KC7 A;  4I3C A;  4L3R A;  3TGC A;  1QY2 A;  3HWE A;  2JGS A;  1O8V A;  4ZGF A;  1KL3 A;  2C4I A;  2RTO B;  3O22 A;  2KD2 A;  1VWI B;  4KT5 A;  1SWJ A;  1FEM A;  1U0X A;  2A13 A;  2Q39 A;  4GJV A;  3EW2 A;  1Y55 X;  4AYH A;  5EED A;  1B0O A;  2JN3 A;  1QFT A;  2K23 A;  4OEL A;  4XME A;  3UEV A;  1STS B;  4BGF A;  1YWC A;  3FA8 A;  4GDA A;  1LIF A;  1N7Y A;  1SY2 A;  2A8G A;  4BX7 B;  1EIO A;  1BJ7 A;  3CBS A;  1SWN A;  1PM1 X;  2DJG A;  2X8S A;  1G7N A;  2QOS C;  3P6F A;  2NP1 A;  4GNY A;  3WYP A;  4ZHF A;  3TZS A;  5KID A;  1T8V A;  4I9R A;  1SWO A;  1ZNK A;  1LIC A;  4IRW A;  1DFV A;  4MVL A;  5F6Z A;  5JD2 A;  5LJG A;  3VG5 A;  4OMW A;  2ACO A;  1QWD A;  5B27 A;  1PBY A;  5HZ8 A;  5B10 O;  3VG4 A;  1OEK A;  1BRP A;  1G74 A;  4I3B A;  3AUM O;  1GX9 A;  2I5Z O;  1N9M A;  1OEJ A;  4ORR A;  4YKM A;  3PQS A;  5IRA A;  1NBX A;  3P6C A;  3VGW A;  4GE1 A;  4YCE A;  4RUN A;  4AZR A;  2FS7 A;  4GRJ A;  2BC3 A;  2RTD B;  3AEH A;  4ORX A;  4XMH A;  4R0B A;  2RCT A;  5BVT A;  2CZT A;  2OF8 A;  4QAE A;  5BVQ A;  3VPJ E;  1B56 A;  2RTI B;  4ORW A;  1YP6 A;  4WHI A;  2Y3E A;  1LKE A;  1SWL A;  3LV4 A;  5HTD A;  2IZK A;  1VWK B;  3GAQ A;  1SWH A;  3I17 A;  1KGL A;  3PQU A;  1W5R A;  2AT5 X;  1NQN A;  2MHD A;  2ZAI A;  3WBG A;  3WZP A;  4BX7 A;  3OD9 A;  4GGR A;  4YH0 A;  4KH8 A;  2CAM A;  1SWF A;  1ZNG A;  4BX5 B;  2QM9 A;  3EMM A;  2A5B A;  5HCE C;  1EI5 A;  1ACD A;  4AZP A;  3EYC A;  1VWH B;  4YVB A;  4AW8 A;  5LJB A;  1NGL A;  3WXQ A;  4ZHH A;  1FDQ A;  1HN2 A;  5HTE A;  1SWK A;  3NQK A;  4IB6 A;  4NNT A;  1KL5 A;  4ID2 A;  1H91 A;  1LUQ A;  2GTL N;  1VYG A;  5IRU A;  2RTB B;  2Y3F A;  2BSZ A;  4IAX A;  1T68 X;  1NP1 A;  5F6B A;  1SMP I;  2F01 A;  5DG4 A;  1EPB A;  5K67 A;  3RDQ A;  3VG7 A;  2GC9 A;  2GH7 A;  1CBQ A;  3B2I A;  4ZHC A;  4JO6 A;  1VWO B;  2X4M A;  1YWD A;  3WJF A;  1GKA B;  1I9H A;  1W6F A;  2KTD A;  4I3D A;  1RAV A;  1SRH A;  1VWA B;  2X45 A;  3Q6L A;  2LB6 A;  4HPA A;  4ZR2 A;  1VWN B;  3FW5 A;  2AT8 X;  2Y32 A;  3NR3 A;  2RCQ A;  4FQB B;  4BQU A;  2RTA A;  4WFU A;  4Y59 A;  4AZM A;  3CKG A;  3FID A;  3JSQ A;  3NX1 A;  2AVI A;  2GTL M;  1HQP A;  3D9W A;  3GE2 A;  4FBV A;  1OPA A;  4CV7 A;  4CPI A;  4GU8 A;  2LA7 A;  3MM0 A;  1SWT A;  3KFH A;  1K24 A;  4LZU A;  3WZN A;  1XKI A;  4ZGU A;  1RXH A;  3STM X;  4O4S A;  2DM5 A;  3FYF A;  1NP4 A;  5LJE A;  3MBT A;  3WJB A;  4K19 A;  4NLJ A;  4FGI B;  4ZHG A;  4IAB A;  1GXA A;  1Y9L A;  2EU7 X;  3NQ3 A;  1DV9 A;  3FEN A;  2OF9 A;  2GTF X;  4O9S A;  4OS8 A;  3RE5 A;  1ALB A;  1HXZ A;  2WEW A;  4IB8 A;  4Z2V A;  4GGZ A;  4ODD A;  1G5W A;  3SZJ A;  4A60 A;  4ML7 B;  3T1D A;  1SXW A;  4CSB A;  3C77 X;  5B5G A;  4B55 A;  4EEJ A;  4COT A;  1LDQ A;  1SA8 A;  5HZ5 A;  2FHN X;  1ERB A;  1O1V A;  1ZND A;  2DJF A;  3EC5 A;  3SZH A;  1DF8 A;  2RTQ B;  1LCZ A;  2FS6 A;  3K3L A;  3HPE A;  4L1N A;  5BYP A;  4YMY A;  2Z4I A;  3FR2 A;  1MX7 A;  4Y0Q A;  2IZH B;  3VE2 A;  1HY2 A;  3VU1 A;  1PEE A;  3HK1 A;  3HOE A;  2AMM X;  4CK4 A;  5IRW A;  1X8U A;  2RTK A;  4YFQ A;  5DPQ A;  1VWB B;  1SWS A;  3ZI8 A;  1KT7 A;  3EBW A;  2FHL A;  1KQW A;  1VWG B;  4U8U N;  3G7X A;  3FEP A;  4KC8 A;  2FKJ A;  2Q4N A;  2JU3 A;  2WSJ A;  3OE3 A;  4TJZ A;  5AQ6 A;  2LKK A;  2OZQ A;  2F09 A;  1GGL A;  2XKL A;  3P6H A;  1KT5 A;  4QGX A;  1A57 A;  2IZD B;  5B11 O;  5L8I A;  1HBQ A;  4O3Y A;  3TGA A;  2JMB A;  4DCB A;  4N7D A;  4Y0P A;  1TXL A;  2IZG B;  3IA8 A;  2W2F A;  4PJ2 A;  3P24 A;  3E3C A;  1Y0G A;  4NYR A;  1KT3 A;  3BU9 A;  2RQ0 A;  1LIB A;  3ZWE A;  2IZI A;  2IZC B;  1DZP A;  1GX8 A;  1X89 A;  2WEX A;  3DSZ A;  4QYP A;  5FAZ A;  5FQ7 E;  1EPA A;  4GDZ A;  2IZB A;  3S5X A;  1N4J A;  2X56 A;  1YP7 A;  2WQA E;  4U8U M;  3T6L A;  1ML7 A;  1VWL B;  2ASN X;  2RTC B;  1OBP A;  4QNI A;  4MIR A;  2PY1 A;  5HCC C;  4ZJ0 A;  3FR5 A;  2OY5 O;  3F6Z B;  2BS5 A;  4U46 A;  1SWE A;  3FDC A;  5CYB A;  2RA6 A;  3P02 A;  1I78 A;  1MEP A;  1IKJ A;  5LKF A;  1KT6 A;  4QZT A;  1WBI A;  3S60 A;  3FA7 A;  4ZHD A;  2GJ5 A;  4CDE A;  5H8T A;  1NQM A;  5D8J A;  1U18 A;  1JV4 A;  5H9N A;  1S2P A;  5FQ6 E;  2BS6 A;  5B29 A;  1IFC A;  4Y0R A;  1VWE B;  3BX7 A;  4GUZ A;  3BSZ E;  3ZW1 A;  3ZUO A;  3RSW A;  5CSE A;  4I60 A;  2RTF B;  2P8G A;  2QCB A;  1I05 A;  1YWA A;  4GD9 A;  3C78 X;  1U17 A;  2Z4H A;  1TVQ A;  1UYO X;  2A2U A;  1FEL A;  3O2Y A;  5HZ6 A;  4Z6J A;  4BCS A;  1SWD A;  4IB7 A;  1IFB A;  2MF6 A;  3AKN A;  4NLI A;  3VG6 A;  1A3Y A;  2FRS A;  3HWF A;  1SXU A;  1FE3 A;  1IW2 A;  1MVG A;  1ICM A;  1QG5 A;  4O49 A;  4YDA A;  3TF6 A;  4Z28 A;  2A0A A;  5HCD C;  1JZU A;  2R56 A;  1XCA A;  4HFO A;  1SWB A;  1JJJ A;  3D95 A;  2GTL O;  5B2A O;  2KTS A;  3X00 A;  1ERX A;  2X55 A;  1L6M A;  2RTG B;  3CWK A;  4LZV A;  4Z2P A;  1X8Q A;  2IFB A;  1A2D A;  3F8A A;  3NX2 A; 
#chains in the Genus database with same CATH homology
 4OEL A;  4CDD A;  4CDE A;  4CDC A;  2DJG A;  1K3B A;  1JQP A;  4OEM A;  3PDF A;  4CDF A;  2DJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...