4HFOA

Biogenic amine-binding protein selenomethionine derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
195
structure length
195
Chain Sequence
SGCSTVDTVKDFNKDNFFTGSWYMTHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYMYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Amine-binding protein
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
total genus 53
structure length 195
sequence length 195
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4hfoA00
4LKPA 3FEKA 4ZCBA 1MX7A 1NP4A 3P6GA 4NNTA 4XMHA 5FAZA 2JOZA 3MVFA 1BM5A 3KFGA 3EBKA 3CQNA 1AELA 1BJ7A 4GE1A 3EMMA 3FENA 3ZUOA 3FR4A 2OFRX 4MVIA 3WJGA 1S44A 4ZH9A 1BEBA 3VG2A 1QY1A 4ORWA 4A1YA 1JV4A 3C76X 3TGCA 1ICNA 1BSYA 1QY0A 1B56A 1ZNLA 1H91A 2WUTA 2N93A 3C77X 5KICA 2CM9A 4GNYA 4IMOA 4XMFA 2FS6A 1IFCA 3BRNA 5C0NA 4TLJA 5CE4A 1DZJA 1SA8A 5F7GA 4ZHDA 2W2AA 2GTFX 3D97A 1IKEA 3FMZA 3BX7A 3KFIA 4OMWA 2AH7X 2AT8X 2A3FX 3HK1A 2CZTA 3B2KA 3NR3A 4I3DA 1BSOA 4ES7A 4YGHA 4YKOA 5JR8A 2Q39A 4ZFXA 2OVEA 1QY2A 2AT5X 1DC9A 1MVGA 1I06A 3VG6A 2WQ9A 4DQ4A 4UU3A 1E02A 3NX2A 3BU9A 1AQBA 2CBRA 5H9KA 5HCDC 4YDAA 1BLRA 2WR6A 1MX8A 2OVAA 4TKJA 5HA0A 1JZUA 4YDBA 5KIDA 4Y0QA 5K06A 4R0BA 1X89A 1LNMA 4ZHHA 3NPOA 2JU3A 1BBPA 1X8OA 5BVSA 2LFOA 1VYGA 2FS7A 3PPTA 4HPAA 5HBSA 3KFHA 4ORYA 4ORUA 2WWPA 4PSQA 1TW4A 1ACDA 1DFVA 1KQWA 5LJDA 3BLGA 1SY3A 3P6FA 4IB6A 4O9SA 4ZGUA 3ELXA 3AKMA 2L9CA 1ADLA 4YGGA 2RD7C 3AKNA 2AT0X 2QM9A 1LIBA 4ODDA 3IFBA 4IMNA 5D47A 5FFHA 4AZQA 4M6SA 1SY2A 1ZNDA 1HBQA 5AQ6A 3BSZE 1VYFA 3ELZA 3WJFA 3JSQA 1DV9A 3O19A 1D3SA 4XMGA 4Y0SA 2NNQA 2XKLA 1CJ5A 5KHPA 4GKCA 5LKFA 5IO5A 4ARHA 4ZJ0A 2PY1A 2YG2A 4LZUA 1CBIA 4OS0A 5D8JA 1EIIA 3BY0A 4NYQA 4K19A 1RLBE 3WVMA 1GT5A 1QFTA 4AZNA 2ACOA 2F73A 4XMEA 5H8TA 4HPBA 5F58A 2MM3A 4YFQA 3C78X 3CWKA 1SXWA 2POAA 1PM1X 5D45A 1E5PA 1A2DA 5D4AA 2W2FA 3PH5A 2NP1A 3KZAA 1T68X 3ZQ3A 3PEDA 1SY1A 4QZUA 2AL0X 1HQPA 1ZNGA 1HMSA 1OBUA 5F6BA 1JBHA 3FR5A 1KOIA 3L4RA 2RA6A 3B2LA 1GGLA 1BRPA 1EPAA 1X8UA 2JU8A 5EEDA 4ORRA 3CR6A 2GJ5A 4A1HA 3FR2A 3TGBA 3T1DA 2JU7A 1B0OA 3CBSA 4GETA 4N7CA 4A60A 1LIFA 4EFGA 3NADA 2OZQA 2NNEA 4IAXA 3EBWA 1IFBA 1U17A 5B27A 4YFRA 3FW4A 1O1UA 1SXUA 5BVTA 3I17A 5L8NA 3U03A 5D48A 5HZ6A 4IB8A 3B2HA 2G79A 1QABE 1CBSA 2A2GA 3NQ9A 3DSZA 4GRJA 1OEEA 5IO6A 5FENA 3D95A 5IO7A 4HPCA 1O1VA 2RCTA 1YWBA 2RQ0A 3JS1A 3IA8A 5DPQA 4MVLA 2Q4NA 3QKGA 4HFOA 3APVA 3FELA 2G7BA 1LF7A 1YWCA 1IKJA 4D6BA 4ZHGA 3NX1A 1I04A 2K62A 3TGAA 5EZ2A 1PEEA 4TJZA 4YH0A 1ICMA 1FELA 2HNXA 1KT6A 2FLJA 2CBSA 1GM6A 1T8VA 4YBUA 2DM5A 3UEWA 3P6EA 1GX9A 1OEJA 5HZ8A 1PMPA 2CM4A 1XCAA 3B2IA 4NNSA 3MBTA 2R56A 1LICA 5L8IA 3Q6LA 1KT3A 2QO4A 1UREA 2OVDA 1YWAA 1EXSA 2G78A 1GT4A 1U0XA 3APXA 2AMMX 4QYPA 4KIIA 1GT1A 1D2UA 1O8VA 2R73A 2KTDA 1TVQA 3WJBA 1X8QA 2WSJA 1FDQA 2MJIA 5HA1A 3BX8A 3F8AA 1S2PA 2QO5A 3KQ0A 3OJYC 3P6HA 1YUPA 4Y0PA 3WJEA 4AZMA 3S26A 3U0DA 2Q2MA 1GXAA 1QQSA 2OFMX 4GNWA 4IBAA 5LKEA 1L6MA 3UEXA 4EEJA 3FLLA 4Y0RA 3K3LA 4GH7A 4QGWA 4AZRA 1X71A 3P6DA 4TKBA 1FENA 1HBPA 5F1EA 1ML7A 2AT6X 4AYHA 1MUPA 5EDBA 3APWA 3STNA 2LB6A 1B4MA 1IIUA 1OBQA 4YKMA 5H9AA 5LJKA 2ACPX 3CBCA 1KT4A 2XSTA 1HMTA 5EEEA 3I0AA 3RZYA 5LJCA 3FW5A 1SY0A 1A3YA 3O22A 1KZWA 4I9SA 1ZNHA 5HAEA 1TXLA 1DZMA 3PP6A 2FT9A 2MO5A 1PBOA 3B2JA 4XMCA 1X8NA 2FR2A 3VG5A 3VG4A 4ALBA 1YWDA 4NYRA 3PH6A 3UEUA 4YBPA 4EDEA 1DZPA 1SXXA 2FRSA 2Q2PA 2QOSC 3FA8A 3RSWA 4NP1A 1QG5A 4ORSA 4WBKA 1T0VA 5L8OA 3KFFA 3CMPA 2HZRA 2L5PA 5B29A 5HZ5A 4ZHCA 4MVKA 4RUNA 2ASNX 3TZSA 4YFPA 3TF6A 1CRBA 3UEVA 3D96A 4NLIA 1BSQA 3DTQA 4AW8A 1YP6A 2R74A 4YMYA 1LFOA 1ZNKA 2A13A 5HTEA 3BU1A 1LPJA 2HYSA 4AZPA 1A18A 4LZVA 1FTPA 4YGZA 2QO6A 3HWFA 1SXYA 3BS2A 1TOUA 4EXZA 1HN2A 2ANSA 3NP1A 5LJHA 4IB9A 1N0SA 3VG3A 2HLVA 4ZR2A 4ORXA 4XMDA 4QGVA 2K23A 3EYCA 5F6ZA 2HZQA 2A2UA 2X45A 3SAOA 1RBPA 4TKHA 1AB0A 5EPQA 1CBQA 3U9PC 3FIQA 5LJGA 1ZNEA 1JYJA 2WQAE 3ZUIA 1KZXA 1ERXA 5HCEC 4ZH6A 5H9NA 1JJJA 4I3CA 1JYDA 4A8ZA 4BVMA 5DG4A 1R0UA 4N7DA 1JJXA 1EIOA 2WEWA 4M7MA 2BLGA 5BVQA 2Q9SA 1FE3A 2FWVA 3HWEA 1DF3A 1IW2A 1XKIA 2LKKA 2GC9A 1GT3A 5HZQA 3VG7A 1P6PA 2EU7X 2HMBA 4QGXA 2A0AA 3FA6A 4DQ3A 2IFBA 3HWGA 4TQ2A 5LJEA 2LBVA 3NQ3A 1KGLA 1G85A 1KQXA 2O62A 1YIVA 4CK4A 1ALBA 1OEKA 1YP7A 1G7NA 1S7DA 1TOWA 1E00A 4RUUA 3O2YA 4D6AA 5EDCA 1BWYA 1HMRA 1E06A 1UZ2X 2L68A 1B8EA 1GKAA 1GX8A 1I4UA 4HPDA 3STMX 1AVGI 1OPAA 2E4JA 3WJCA 4I9RA 2P8GA 1FEMA 3P6CA 2ALLX 4YCHA 4YCEA 1KT7A 3PECA 1ERBA 1I05A 1KXOA 4BQUA 1EPBA 4TNNA 4QAEA 1G5WA 1QFVA 1OPBA 2RCQA 4I3BA 1DZKA 4ZHFA 1EQDA 1ZRYA 4QZTA 3WJDA 1QWDA 1Z24A 2W2BA 2WEXA 2AKQA 1CBRA 3WBGA 4QYNA 1LIEA 1X8PA 1EALA 5HCCC 2JN3A 1LKEA 1OBPA 3FA9A 1EUOA 4IAWA 5HWZA 4BOEA 1VPRA 4WFVA 1KT5A 2CZUA 4OS8A 3STKA 2KT4B 4UU2A 3FEPA 5LJBA 5HTDA 1BRQA 1EW3A 1MDCA 2AT3X 4LKTA 4ALOA 3WXQA 3GAQA 1G74A 1A57A 5HZ9A 3APUA 1NGLA 3F9DA 1LIDA 4OS3A 4WFUA 1GKAB 3BDRA 3G7XA 3HWDA 4IB7A 3FA7A 2X46A 1NP1A 2FTBA 1U18A 4AZOA 2NNDA 2FR3A 4NLJA 2L67A 4OMXA 3CQRA 5H9LA 2LBAA 3EM0A
chains in the Genus database with same CATH superfamily
4LKPA 3FEKA 4ZCBA 2RTIB 4Z2OA 1MX7A 1NP4A 2IZHB 4O4UA 3P6GA 4JO6A 4NNTA 4XMHA 3OE3A 5FAZA 2JOZA 3MVFA 1BM5A 3KFGA 3EBKA 3CQNA 1AELA 1BJ7A 1VWBB 4GE1A 3EMMA 2IZEB 1VWCB 3FENA 3FR4A 2OFRX 3RY2A 3ZUOA 4MVIA 3WJGA 3T2WA 1S44A 4QRLA 2X8TA 4ZH9A 2RTJA 1VWIB 1UYNX 5JD2A 1BEBA 3T2XA 1SRIA 2OF8A 1QY1A 4ORWA 4U8UM 1JV4A 3C76X 3VG2A 4A1YA 3TGCA 1ICNA 4L1NA 3SZIA 3N91A 4ID2A 2JMBA 1BSYA 1QY0A 1B56A 1SWKA 1ZNLA 1H91A 2WUTA 1SRHA 3FYFA 2N93A 3C77X 5KICA 2CM9A 4GNYA 4IMOA 4XMFA 2FS6A 3VE1A 1IFCA 3BRNA 2IZBA 4U46A 4CV7A 2GTLM 4TLJA 5C0NA 1DZJA 5CE4A 1N9MA 4CPEA 1SA8A 3MX7A 3NQKA 5F7GA 3VPJE 3T6FA 4ZHDA 2W2AA 2GTFX 3D97A 1IKEA 3FMZA 2BS6A 4GDAA 3BX7A 3KFIA 4OMWA 2AH7X 2AT8X 2A3FX 3HK1A 2CZTA 3B2KA 3NR3A 5AEOA 4I3DA 1BSOA 4ES7A 2RTEB 4YGHA 4YKOA 5JR8A 2Q39A 3S5XA 4ZFXA 2OVEA 1AVDA 1PTSA 1N9YA 1QY2A 2AT5X 1DC9A 1MVGA 2RTRB 3HOEA 1I06A 3KVNA 3VG6A 2WQ9A 4DQ4A 1KL5A 1KL4A 1FJ1E 1E02A 2Y3EA 4KT5A 4UU3A 3NX2A 1MM9A 3VHMA 2C4IA 3WOVA 4CPHB 2Z4IA 3BU9A 1AQBA 2CBRA 4O4SA 3RDQA 5H9KA 5HCDC 4YDAA 1BLRA 2WR6A 1MX8A 2OVAA 4CDFA 4TKJA 1VWAB 5HA0A 4YDBA 1JZUA 1SRGA 4CSBA 1LCZA 4OELA 5KIDA 2UZ2A 4Y0QA 5K06A 4O4OA 1JQPA 2AVIA 4R0BA 1PBYA 5FQ8E 4DCBA 1X89A 4I60A 1LNMA 2FHLA 4NV8A 3VGWA 4ZHHA 2ZAIA 3WZOA 1HXZA 3MM0A 3NPOA 2JU3A 1BBPA 2RN4A 1NDJA 1X8OA 3LTWA 5BVSA 2LFOA 1VWQB 1VYGA 2FS7A 2MF6A 3PPTA 4HPAA 5HBSA 3KFHA 4ORYA 4ORUA 4EQAC 1E2TA 2WWPA 4PSQA 1TW4A 1ACDA 1DFVA 1KQWA 5LJDA 3BLGA 1SY3A 3P6FA 4IB6A 4O9SA 1SRJA 4ZGUA 3RKGA 1GX3A 3ELXA 1LUQA 1Y55X 3AKMA 2L9CA 4YVBA 1SWHA 2MHDA 1ADLA 2OL6O 4CPFA 4YGGA 2RD7C 3AKNA 1VWLB 2AT0X 4IABA 2QM9A 1LIBA 1VYOA 2QMIA 4ODDA 2OY1O 3IFBA 4U8UN 4IMNA 5D47A 5FFHA 4AZQA 4M6SA 1SY2A 1ZNDA 2IZIA 1HBQA 5AQ6A 3BSZE 1VYFA 3ELZA 3WJFA 4INNA 1VWJB 2OL7A 4FBRA 3JSQA 1DV9A 3O19A 1D3SA 2KD2A 4XMGA 4Y0SA 2NNQA 2XKLA 1CJ5A 2VDFA 5KHPA 4GKCA 2GTLN 5LKFA 4ARHA 4ZJ0A 1LCWA 2PY1A 2YG2A 1CBIA 4LZUA 4MEEA 4OS0A 2Y3FA 5D8JA 3BY0A 3U0DA 4NYQA 1SWPA 2YMSA 4K19A 1RLBE 3WVMA 1GT5A 1QFTA 1RSTB 3ZW2A 4AZNA 2ACOA 2F73A 4XMEA 4ON1A 5H8TA 4HPBA 5F58A 2IZLB 2MM3A 2RTOB 3C78X 1N4JA 3CWKA 4YFQA 2RTAA 4Z2VA 1SXWA 1Y0GA 2POAA 1PM1X 1SWJA 5D45A 1K24A 1E5PA 4AZMA 1A2DA 5D4AA 2W2FA 5B10O 1SWAA 3PH5A 2NP1A 3KZAA 1T68X 3ZQ3A 2I5ZO 1SY1A 3PEDA 2AL0X 4QZUA 2OY7A 3LV4A 1HQPA 5CHKA 3SLOA 3SZHA 1ZNGA 1MK5A 2IZFB 1SWEA 1HMSA 1OBUA 5F6BA 2X32A 1JBHA 4GZVA 1AVEA 2BC3A 2JW1A 3V8UA 4EKVA 2OF9A 1VWHB 3FR5A 4CPHA 1KOIA 3L4RA 2RA6A 4O3ZA 3B2LA 2ZSCA 5IO5A 1GGLA 3WYPA 1BRPA 1EPAA 1STPA 1X8UA 2JU8A 5EEDA 4O3WA 4ORRA 3CR6A 2GJ5A 4A1HA 5FQ7E 3FR2A 3TGBA 4BGFA 2IZDB 3FIDA 3T1DA 2JU7A 1B0OA 3CBSA 4GETA 4N7CA 4A60A 1LIFA 4Z28A 2Y32A 3NADA 2OZQA 4GJVA 2NNEA 1SWCA 1Y9LA 4IAXA 3EBWA 1UYOX 5B2AO 2FGSA 2OY5O 3SZJA 3VHIA 1IFBA 1RXKA 4Z6JA 1U17A 5B27A 1STSB 4YFRA 3FW4A 5IRUA 3EW2A 1O1UA 1SXUA 3NBXX 5BVTA 5K67A 3I17A 5L8NA 2OY8A 2RTCB 3U03A 5D48A 5HZ6A 3D4RA 4KCAA 2PI3O 4IB8A 3B2HA 2G79A 1QABE 2BSZA 1CBSA 1SLFB 2A2GA 3NQ9A 4MIRA 1SWFA 2MWHA 3DSZA 1VWPB 1W4TA 4GRJA 1OEEA 4CPIA 5IO6A 5FENA 4O3XB 1JJUA 2RTGB 3D95A 5IO7A 4HPCA 1O1VA 2RCTA 1YWBA 3RWXA 2RQ0A 4GDZA 1KL3A 3P02A 3JS1A 3IA8A 5DPQA 4Y59A 4MVLA 2Q4NA 3QKGA 5B5GA 3SOTA 3EW1A 4HFOA 3APVA 3FELA 1SLGB 2G7BA 1LF7A 3WZPA 1VWFB 4L3RA 1YWCA 2QOMA 2RTQB 1IKJA 4D6BA 1VWDB 1SLEB 1SWNA 1VWRB 1W5RA 3NX1A 4ZHGA 1I04A 2K62A 4Z2PA 3TGAA 5F2BA 3WZNA 1Y52X 5EZ2A 5B5FA 1PEEA 4TJZA 4YH0A 1ICMA 1SREA 1FELA 2HNXA 1KT6A 2FLJA 2CBSA 1GM6A 1T8VA 4OEMA 3F6ZB 4YBUA 4KC8A 1LELA 2C1SA 2DM5A 4NW4A 3UEWA 3P6EA 3ZW1A 1GX9A 1OEJA 5HZ8A 1PMPA 3CKGA 1XCAA 2CM4A 3B2IA 2RTPB 4NNSA 3MBTA 2DJFA 2R56A 1LICA 5L8IA 3Q6LA 4C5PA 1MOYA 1KT3A 2QO4A 2G5LA 1UREA 2I5VO 2OVDA 1Y9TA 1YWAA 1EXSA 2G78A 1GT4A 1U0XA 3APXA 2AMMX 4QYPA 1VWNB 3RDSA 4KIIA 1SWBA 1JMZA 1D2UA 1GT1A 1O8VA 3Q34A 2R73A 3HTYA 2KTDA 3E3CA 3OBLA 2OVSA 1TVQA 3WJBA 3D9WA 4QGVA 1X8QA 3GE2A 2WSJA 1FDQA 2MJIA 5HA1A 3BX8A 3F8AA 1S2PA 2QO5A 3KQ0A 3OJYC 3P6HA 1YUPA 2OFAA 2X8SA 3CKFA 4GGRA 3S26A 2Q2MA 1GXAA 1QQSA 2OFMX 4GNWA 1NQNA 4IBAA 4MVEA 4PJ2A 1L6MA 5LKEA 3UEXA 4EEJA 3FLLA 4Y0RA 3K3LA 4GH7A 4QGWA 2LA7A 1X71A 3P6DA 1SMPI 4AZRA 4TKBA 1FENA 1HBPA 2IZGB 3P24A 4Y5DA 5F1EA 1ML7A 2AT6X 4AYHA 1MUPA 2VFCA 3EC5A 5EDBA 3APWA 3MG5A 2LB6A 2M4LA 3FDCA 1NBXA 4MISA 1IIUA 2RTDB 1OBQA 1B4MA 4YKMA 4O3YA 3RDOA 5FQ6E 5H9AA 5LJKA 5CYBA 2ACPX 5L3YA 3CBCA 1KT4A 2XSTA 1RXHA 1HMTA 5EEEA 3I0AA 2A8GA 3RZYA 2KTSA 3FW5A 1SY0A 1A3YA 3O22A 3ZW0A 3ZW1B 4BBOA 1KZWA 4I9SA 1ZNHA 5HAEA 1TXLA 1DZMA 3PP6A 2FT9A 2MO5A 1PBOA 3B2JA 4XMCA 1LDQA 3ZWEA 1VWEB 4GUZA 3HOLA 2C1QA 2GH7A 2IZKA 1X8NA 2FR2A 3VG5A 3VG4A 2IZJA 4ALBA 1YWDA 4NYRA 2BHVA 3PH6A 5B3MO 3UEUA 4YBPA 3PQUA 1HXLA 3RDMA 1DZPA 1SXXA 2FRSA 2Q2PA 2QOSC 3FA8A 3RSWA 4EDEA 4ZGFA 4NP1A 1QG5A 4ORSA 4WBKA 1T0VA 2X56A 3KFFA 5L8OA 3CMPA 2HZRA 3LHNA 2L5PA 5B29A 5HZ5A 4ZHCA 3H3IA 4MVKA 1WBIA 4IRWA 4RUNA 2ASNX 1MEPA 4GD9A 4NV7A 4BCSA 3TZSA 4YFPA 2OYBO 1CRBA 3TF6A 5K68A 3UEVA 3VHHA 4BX7B 1OSPO 1SWTA 2AF5A 3D96A 3VE2A 3ZW0B 4NLIA 4I95A 1BSQA 3DTQA 4AW8A 1YP6A 2R74A 4YMYA 2FHNX 1LFOA 1ZNKA 2A13A 2RTKA 3BU1A 5AJCA 5HTEA 3RE5A 1IJ8A 1LPJA 4BX5B 2HYSA 3S5VA 4AZPA 1A18A 1SWRA 4LZVA 1FTPA 2A5BA 4YGZA 2A5CA 2QO6A 3HWFA 3AEHA 2JGSA 1SXYA 1LCVA 1SLDB 3BS2A 4WHIA 1K3BA 4O49A 1TOUA 4EXZA 2X34A 4COTA 1HN2A 2ANSA 2IZCB 3NP1A 3JQOA 4B55A 5LJHA 4IB9A 1N0SA 4QQ1A 3VG3A 5LJCA 2RTLA 2HLVA 4ZR2A 1EIIA 3X00A 4ORXA 4XMDA 1RXJA 1WUBA 2K23A 2UYWA 3EYCA 4KC7A 1HQQA 2HZQA 2A2UA 2X45A 5F6ZA 1RBPA 1SWQA 4TKHA 3RBYA 3SAOA 1AB0A 5EPQA 1CBQA 3U9PC 1N7YA 3FIQA 4GU8A 5LJGA 3S60A 1ZNEA 3WYQA 1JYJA 3STNA 2WQAE 1RSUB 2RTBB 3ZUIA 1W6FA 1SWDA 2Z4HA 1ERXA 1JMXA 1HY2A 5HCEC 3WZQA 4CDCA 1KZXA 4O4XA 5H9NA 4ZH6A 1SWOA 1JJJA 4BX6A 4HWMA 4I3CA 1JYDA 4A8ZA 4BVMA 3PK2A 5DG4A 1R0UA 4N7DA 1JJXA 1EIOA 2WEWA 4M7MA 2IZAA 2BLGA 4CDEA 5BVQA 1JIWI 2Q9SA 4FBOA 1FE3A 2FWVA 4FGIB 2RTHB 3SLTA 4Z27A 3HWEA 2BS5A 4FQBB 1DF3A 1IW2A 1XKIA 2LKKA 3ZZVA 2GC9A 3RE6A 2ZAGA 1GT3A 5HZQA 3VG7A 1P6PA 3PQSA 2RTNB 2EU7X 2HMBA 4QGXA 2A0AA 3RDXA 3FA6A 4DQ3A 2IFBA 3PDFA 3HWGA 4GGZA 4TQ2A 5LJEA 2LBVA 3NQ3A 1VWMB 1KGLA 1G85A 1KQXA 2O62A 1YIVA 4CK4A 1ALBA 1NQMA 1OEKA 3RY1A 1YP7A 1G7NA 1S7DA 1VWGB 2OL8O 4OKAA 5IRAA 5BYPA 1TOWA 1E00A 4RUUA 1SWLA 3O2YA 4D6AA 5EDCA 1BWYA 1HMRA 1EI5A 3OD9A 2HKDA 1E06A 1UZ2X 1B8EA 1GKAA 1GX8A 1I4UA 2L68A 2QCBA 4GGTA 4HPDA 1AVGI 1OPAA 2E4JA 1LDOA 4I6SA 3RDUA 4I9RA 3STMX 3WJCA 5AJBA 2P8GA 1FEMA 2F09A 1NC9A 3P6CA 2ALLX 4YCHA 4YCEA 2X4MA 1KT7A 3VU1A 4CDDA 3PECA 1ERBA 1I05A 1KXOA 2BT9A 1EPBA 4GK9A 2CAMA 4QAEA 4TNNA 2VFBA 3ZI8A 4BQUA 4BX7A 1G5WA 1QFVA 1OPBA 4BX6B 2RCQA 4I3BA 4EFGA 4QNIA 1DZKA 5B11O 3WJEA 1VWKB 4ZHFA 1EQDA 1ZRYA 4QZTA 3HPEA 3WJDA 1QWDA 4U8UO 1Z24A 2W2BA 2WEXA 2AKQA 4DNEA 4FBVA 1VWOB 4BX5A 4U9CA 1CBRA 3T6LA 4Y0PA 3WBGA 2DJGA 2RTFB 1LIEA 4QYNA 4BJ8A 1X8PA 2FKGA 1EALA 3UAQA 5HCCC 2JN3A 1LKEA 2OFBA 4JNJA 1OBPA 1SWSA 1EUOA 2KW1A 2X55A 3FA9A 4IAWA 3SLJA 5HWZA 1Y53X 1SWGA 1N43A 2GTLO 4BOEA 1VPRA 4JHQA 4WFVA 1KT5A 2CZUA 4KH8A 3AUMO 4OS8A 3STKA 2KT4B 4UU2A 1STRB 3FEPA 5LJBA 5IRWA 2RTMA 4JGLA 5HTDA 1SRFA 1KFFA 1BRQA 1EW3A 1MDCA 2AT3X 4LKTA 4LQZA 4U3QA 5CSEA 3WXQA 3GAQA 1DF8A 4ALOA 2WPUA 2G8CO 1SWUA 1G74A 1I9HA 1A57A 5HZ9A 3APUA 1NGLA 3F9DA 1LIDA 4OS3A 1RAVA 4ML7B 4WFUA 1GKAB 3BDRA 3G7XA 3HWDA 4IB7A 2FKJA 3FA7A 2X46A 1NP1A 2FTBA 2F01A 1U18A 4AZOA 2NNDA 1I78A 5IXGA 2X8FA 2FR3A 4NLJA 2L67A 3QQ2A 4OMXA 3CQRA 5H9LA 2LBAA 3EM0A 4GJSA
chains in the Genus database with same CATH topology
4LKPA 3FEKA 4ZCBA 1MX7A 1NP4A 4O4UA 3P6GA 4NNTA 4XMHA 3OE3A 5FAZA 2JOZA 3MVFA 1BM5A 3KFGA 3EBKA 3CQNA 1AELA 1BJ7A 4GE1A 3EMMA 3FENA 3ZUOA 3FR4A 2OFRX 4MVIA 3WJGA 1S44A 4QRLA 2X8TA 4ZH9A 1BEBA 3VG2A 1QY1A 4ORWA 4U8UM 1JV4A 3C76X 4A1YA 3TGCA 1ICNA 4L1NA 3N91A 4ID2A 2JMBA 1BSYA 1QY0A 1B56A 1ZNLA 1H91A 2WUTA 3FYFA 2N93A 3C77X 5KICA 2CM9A 4GNYA 4IMOA 4XMFA 2FS6A 3VE1A 1IFCA 3BRNA 4CV7A 2GTLM 4TLJA 5C0NA 1DZJA 5CE4A 1SA8A 3MX7A 3NQKA 5F7GA 3VPJE 4ZHDA 2W2AA 2GTFX 3D97A 1IKEA 3FMZA 2BS6A 3BX7A 3KFIA 4OMWA 2AH7X 2AT8X 2A3FX 3HK1A 2CZTA 3B2KA 3NR3A 5AEOA 4I3DA 1BSOA 4ES7A 4YGHA 4YKOA 5JR8A 2Q39A 3S5XA 4ZFXA 2OVEA 1QY2A 2AT5X 1DC9A 1MVGA 3HOEA 1I06A 3VG6A 2WQ9A 4DQ4A 4KT5A 4UU3A 1E02A 3NX2A 3WOVA 2Z4IA 3BU9A 1AQBA 2CBRA 4O4SA 5H9KA 5HCDC 4YDAA 1BLRA 2WR6A 1MX8A 2OVAA 4TKJA 5HA0A 1JZUA 4YDBA 4CSBA 5KIDA 4Y0QA 5K06A 4O4OA 4R0BA 5FQ8E 1X89A 1LNMA 4ZHHA 2ZAIA 3NPOA 2JU3A 1BBPA 2RN4A 1X8OA 5BVSA 2LFOA 1VYGA 2FS7A 3PPTA 4HPAA 5HBSA 3KFHA 4ORYA 4ORUA 4EQAC 2WWPA 4PSQA 1TW4A 1ACDA 1DFVA 1KQWA 5LJDA 3BLGA 1SY3A 3P6FA 4IB6A 4O9SA 4ZGUA 3RKGA 3ELXA 3AKMA 2L9CA 2MHDA 1ADLA 4YGGA 2RD7C 3AKNA 2AT0X 4IABA 2QM9A 1LIBA 2QMIA 4ODDA 3IFBA 4U8UN 4IMNA 5D47A 5FFHA 4AZQA 4M6SA 1SY2A 1ZNDA 1HBQA 5AQ6A 3BSZE 1VYFA 3ELZA 3WJFA 4INNA 4FBRA 3JSQA 1DV9A 3O19A 1D3SA 2KD2A 4XMGA 4Y0SA 2NNQA 2XKLA 1CJ5A 5KHPA 4GKCA 2GTLN 5LKFA 4ARHA 4ZJ0A 2PY1A 2YG2A 4LZUA 1CBIA 4OS0A 5D8JA 3U0DA 3BY0A 4NYQA 2YMSA 3ZW2A 4K19A 1RLBE 3WVMA 1GT5A 1QFTA 4AZNA 2ACOA 2F73A 4XMEA 4ON1A 5H8TA 4HPBA 5F58A 2MM3A 4YFQA 3C78X 3CWKA 1SXWA 2POAA 1PM1X 5D45A 1E5PA 1A2DA 5D4AA 2W2FA 3PH5A 2NP1A 3KZAA 1T68X 3ZQ3A 3PEDA 1SY1A 4QZUA 2AL0X 3LV4A 1HQPA 1ZNGA 1HMSA 1OBUA 5F6BA 1JBHA 4GZVA 2JW1A 3V8UA 3FR5A 1KOIA 3L4RA 2RA6A 4O3ZA 3B2LA 5IO5A 1GGLA 1BRPA 1EPAA 1X8UA 2JU8A 5EEDA 4O3WA 4ORRA 3CR6A 2GJ5A 4A1HA 5FQ7E 3FR2A 3TGBA 3T1DA 2JU7A 1B0OA 3CBSA 4GETA 4N7CA 4A60A 1LIFA 4EFGA 3NADA 2OZQA 2NNEA 1Y9LA 4IAXA 3EBWA 1IFBA 1U17A 5B27A 4YFRA 3FW4A 1O1UA 1SXUA 3NBXX 5BVTA 3I17A 5L8NA 3U03A 5D48A 5HZ6A 3D4RA 4KCAA 4IB8A 3B2HA 2G79A 1QABE 1CBSA 2A2GA 3NQ9A 4MIRA 2MWHA 3DSZA 4GRJA 1OEEA 5IO6A 5FENA 4O3XB 3D95A 5IO7A 4HPCA 1O1VA 2RCTA 1YWBA 3RWXA 2RQ0A 4GDZA 3P02A 3JS1A 3IA8A 5DPQA 4MVLA 2Q4NA 3QKGA 3SOTA 4HFOA 3APVA 3FELA 2G7BA 1LF7A 4L3RA 1YWCA 1IKJA 4D6BA 4ZHGA 3NX1A 1I04A 2K62A 3TGAA 5EZ2A 1PEEA 4TJZA 4YH0A 1ICMA 1FELA 2HNXA 1KT6A 2FLJA 2CBSA 1GM6A 1T8VA 4YBUA 3F6ZB 4KC8A 2DM5A 4NW4A 3UEWA 3P6EA 3ZW1A 1GX9A 1OEJA 5HZ8A 1PMPA 2CM4A 1XCAA 3B2IA 4NNSA 3MBTA 2R56A 1LICA 5L8IA 3Q6LA 1KT3A 2QO4A 1UREA 2OVDA 1Y9TA 1YWAA 1EXSA 2G78A 1GT4A 1U0XA 3APXA 2AMMX 4QYPA 4KIIA 1GT1A 1D2UA 1O8VA 2R73A 3HTYA 2KTDA 3E3CA 3OBLA 2OVSA 1TVQA 3WJBA 1X8QA 3GE2A 2WSJA 1FDQA 2MJIA 5HA1A 3BX8A 3F8AA 1S2PA 2QO5A 3KQ0A 3OJYC 3P6HA 1YUPA 4Y0PA 2X8SA 3WJEA 3S26A 4AZMA 2Q2MA 1GXAA 1QQSA 2OFMX 4GNWA 4IBAA 4MVEA 4PJ2A 5LKEA 1L6MA 3UEXA 4EEJA 3FLLA 4Y0RA 3K3LA 4GH7A 4QGWA 2LA7A 1X71A 3P6DA 1SMPI 4AZRA 4TKBA 1FENA 1HBPA 3P24A 5F1EA 1ML7A 2AT6X 4AYHA 1MUPA 5EDBA 3APWA 3STNA 2LB6A 2M4LA 4MISA 3ZW0A 1B4MA 1IIUA 1OBQA 4YKMA 4O3YA 5FQ6E 5H9AA 5LJKA 5CYBA 2ACPX 3CBCA 1KT4A 2XSTA 1HMTA 5EEEA 3I0AA 3RZYA 5LJCA 2KTSA 3FW5A 1SY0A 1A3YA 3O22A 3ZW1B 1KZWA 4I9SA 1ZNHA 5HAEA 1TXLA 1DZMA 3PP6A 2FT9A 2MO5A 1PBOA 3B2JA 4XMCA 3ZWEA 3HOLA 1X8NA 2FR2A 3VG5A 3VG4A 4ALBA 1YWDA 4NYRA 2BHVA 3PH6A 3UEUA 4YBPA 3PQUA 4EDEA 1DZPA 1SXXA 2FRSA 2Q2PA 2QOSC 3FA8A 3RSWA 4ZGFA 4NP1A 1QG5A 4ORSA 4WBKA 1T0VA 5L8OA 3KFFA 3CMPA 2HZRA 3LHNA 2L5PA 5B29A 5HZ5A 4ZHCA 3H3IA 4MVKA 4RUNA 2ASNX 3TZSA 4YFPA 3TF6A 1CRBA 3UEVA 3D96A 3VE2A 3ZW0B 4NLIA 4I95A 1BSQA 3DTQA 4AW8A 1YP6A 2R74A 4YMYA 1LFOA 1ZNKA 2A13A 5HTEA 3BU1A 5AJCA 1LPJA 2HYSA 3S5VA 4AZPA 1A18A 4LZVA 1FTPA 4YGZA 2QO6A 3HWFA 4WHIA 1SXYA 3BS2A 4O49A 1TOUA 4EXZA 4COTA 1HN2A 2ANSA 3NP1A 3JQOA 5LJHA 4IB9A 1N0SA 4QQ1A 3VG3A 2HLVA 4ZR2A 1EIIA 4ORXA 4XMDA 4QGVA 2K23A 3EYCA 5F6ZA 4KC7A 3RBYA 2HZQA 2A2UA 2X45A 3SAOA 1RBPA 4TKHA 1AB0A 5EPQA 1CBQA 3U9PC 4GU8A 3FIQA 5LJGA 3S60A 1ZNEA 1JYJA 2WQAE 3ZUIA 1KZXA 2Z4HA 1ERXA 5HCEC 4O4XA 5H9NA 4ZH6A 1JJJA 4HWMA 4I3CA 1JYDA 4A8ZA 4BVMA 5DG4A 1R0UA 4N7DA 1JJXA 1EIOA 2WEWA 4M7MA 2BLGA 5BVQA 1JIWI 2Q9SA 4FBOA 1FE3A 2FWVA 4FGIB 3HWEA 2BS5A 4FQBB 1DF3A 1IW2A 1XKIA 2LKKA 3ZZVA 2GC9A 2ZAGA 1GT3A 5HZQA 3VG7A 1P6PA 3PQSA 2EU7X 2HMBA 4QGXA 2A0AA 3FA6A 4DQ3A 2IFBA 3HWGA 4TQ2A 5LJEA 2LBVA 3NQ3A 1KGLA 1G85A 1KQXA 2O62A 1YIVA 4CK4A 1ALBA 1OEKA 1YP7A 1G7NA 1S7DA 5BYPA 1TOWA 1E00A 4RUUA 3O2YA 4D6AA 5EDCA 1BWYA 1HMRA 1EI5A 3OD9A 1E06A 1UZ2X 2L68A 1B8EA 1GKAA 1GX8A 1I4UA 4HPDA 3STMX 1AVGI 1OPAA 2E4JA 4I6SA 3WJCA 4I9RA 5AJBA 2P8GA 1FEMA 2F09A 3P6CA 2ALLX 4YCHA 4YCEA 1KT7A 3VU1A 3PECA 1ERBA 1I05A 1KXOA 2BT9A 1EPBA 4GK9A 4QAEA 4TNNA 3ZI8A 4BQUA 1G5WA 1QFVA 1OPBA 2RCQA 4I3BA 4QNIA 1DZKA 4ZHFA 1EQDA 1ZRYA 4QZTA 3WJDA 1QWDA 4U8UO 1Z24A 2W2BA 2WEXA 2AKQA 4FBVA 4U9CA 1CBRA 3WBGA 4QYNA 1LIEA 1X8PA 1EALA 3UAQA 5HCCC 2JN3A 1LKEA 1OBPA 2KW1A 1EUOA 3FA9A 4IAWA 5HWZA 2GTLO 4BOEA 1VPRA 4WFVA 1KT5A 2CZUA 4KH8A 4OS8A 3STKA 2KT4B 4UU2A 3FEPA 5LJBA 4JGLA 5HTDA 1BRQA 1EW3A 1MDCA 2AT3X 4LKTA 4LQZA 4U3QA 4ALOA 3WXQA 3GAQA 1G74A 1A57A 5HZ9A 3APUA 1NGLA 3F9DA 1LIDA 4OS3A 4ML7B 4WFUA 1GKAB 3BDRA 3G7XA 3HWDA 4IB7A 3FA7A 2X46A 1NP1A 2FTBA 1U18A 4AZOA 2NNDA 2X8FA 2FR3A 4NLJA 2L67A 4OMXA 3CQRA 5H9LA 2LBAA 3EM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKP A;  3FEK A;  4ZCB A;  1MX7 A;  1NP4 A;  3P6G A;  4NNT A;  4XMH A;  5FAZ A;  2JOZ A;  3MVF A;  1BM5 A;  3KFG A;  3EBK A;  3CQN A;  1AEL A;  1BJ7 A;  4GE1 A;  3EMM A;  3FEN A;  3ZUO A;  3FR4 A;  2OFR X;  4MVI A;  3WJG A;  1S44 A;  4ZH9 A;  1BEB A;  3VG2 A;  1QY1 A;  4ORW A;  4A1Y A;  1JV4 A;  3C76 X;  3TGC A;  1ICN A;  1BSY A;  1QY0 A;  1B56 A;  1ZNL A;  1H91 A;  2WUT A;  2N93 A;  3C77 X;  5KIC A;  2CM9 A;  4GNY A;  4IMO A;  4XMF A;  2FS6 A;  1IFC A;  3BRN A;  5C0N A;  4TLJ A;  5CE4 A;  1DZJ A;  1SA8 A;  5F7G A;  4ZHD A;  2W2A A;  2GTF X;  3D97 A;  1IKE A;  3FMZ A;  3BX7 A;  3KFI A;  4OMW A;  2AH7 X;  2AT8 X;  2A3F X;  3HK1 A;  2CZT A;  3B2K A;  3NR3 A;  4I3D A;  1BSO A;  4ES7 A;  4YGH A;  4YKO A;  5JR8 A;  2Q39 A;  4ZFX A;  2OVE A;  1QY2 A;  2AT5 X;  1DC9 A;  1MVG A;  1I06 A;  3VG6 A;  2WQ9 A;  4DQ4 A;  4UU3 A;  1E02 A;  3NX2 A;  3BU9 A;  1AQB A;  2CBR A;  5H9K A;  5HCD C;  4YDA A;  1BLR A;  2WR6 A;  1MX8 A;  2OVA A;  4TKJ A;  5HA0 A;  1JZU A;  4YDB A;  5KID A;  4Y0Q A;  5K06 A;  4R0B A;  1X89 A;  1LNM A;  4ZHH A;  3NPO A;  2JU3 A;  1BBP A;  1X8O A;  5BVS A;  2LFO A;  1VYG A;  2FS7 A;  3PPT A;  4HPA A;  5HBS A;  3KFH A;  4ORY A;  4ORU A;  2WWP A;  4PSQ A;  1TW4 A;  1ACD A;  1DFV A;  1KQW A;  5LJD A;  3BLG A;  1SY3 A;  3P6F A;  4IB6 A;  4O9S A;  4ZGU A;  3ELX A;  3AKM A;  2L9C A;  1ADL A;  4YGG A;  2RD7 C;  3AKN A;  2AT0 X;  2QM9 A;  1LIB A;  4ODD A;  3IFB A;  4IMN A;  5D47 A;  5FFH A;  4AZQ A;  4M6S A;  1SY2 A;  1ZND A;  1HBQ A;  5AQ6 A;  3BSZ E;  1VYF A;  3ELZ A;  3WJF A;  3JSQ A;  1DV9 A;  3O19 A;  1D3S A;  4XMG A;  4Y0S A;  2NNQ A;  2XKL A;  1CJ5 A;  5KHP A;  4GKC A;  5LKF A;  5IO5 A;  4ARH A;  4ZJ0 A;  2PY1 A;  2YG2 A;  4LZU A;  1CBI A;  4OS0 A;  5D8J A;  1EII A;  3BY0 A;  4NYQ A;  4K19 A;  1RLB E;  3WVM A;  1GT5 A;  1QFT A;  4AZN A;  2ACO A;  2F73 A;  4XME A;  5H8T A;  4HPB A;  5F58 A;  2MM3 A;  4YFQ A;  3C78 X;  3CWK A;  1SXW A;  2POA A;  1PM1 X;  5D45 A;  1E5P A;  1A2D A;  5D4A A;  2W2F A;  3PH5 A;  2NP1 A;  3KZA A;  1T68 X;  3ZQ3 A;  3PED A;  1SY1 A;  4QZU A;  2AL0 X;  1HQP A;  1ZNG A;  1HMS A;  1OBU A;  5F6B A;  1JBH A;  3FR5 A;  1KOI A;  3L4R A;  2RA6 A;  3B2L A;  1GGL A;  1BRP A;  1EPA A;  1X8U A;  2JU8 A;  5EED A;  4ORR A;  3CR6 A;  2GJ5 A;  4A1H A;  3FR2 A;  3TGB A;  3T1D A;  2JU7 A;  1B0O A;  3CBS A;  4GET A;  4N7C A;  4A60 A;  1LIF A;  4EFG A;  3NAD A;  2OZQ A;  2NNE A;  4IAX A;  3EBW A;  1IFB A;  1U17 A;  5B27 A;  4YFR A;  3FW4 A;  1O1U A;  1SXU A;  5BVT A;  3I17 A;  5L8N A;  3U03 A;  5D48 A;  5HZ6 A;  4IB8 A;  3B2H A;  2G79 A;  1QAB E;  1CBS A;  2A2G A;  3NQ9 A;  3DSZ A;  4GRJ A;  1OEE A;  5IO6 A;  5FEN A;  3D95 A;  5IO7 A;  4HPC A;  1O1V A;  2RCT A;  1YWB A;  2RQ0 A;  3JS1 A;  3IA8 A;  5DPQ A;  4MVL A;  2Q4N A;  3QKG A;  4HFO A;  3APV A;  3FEL A;  2G7B A;  1LF7 A;  1YWC A;  1IKJ A;  4D6B A;  4ZHG A;  3NX1 A;  1I04 A;  2K62 A;  3TGA A;  5EZ2 A;  1PEE A;  4TJZ A;  4YH0 A;  1ICM A;  1FEL A;  2HNX A;  1KT6 A;  2FLJ A;  2CBS A;  1GM6 A;  1T8V A;  4YBU A;  2DM5 A;  3UEW A;  3P6E A;  1GX9 A;  1OEJ A;  5HZ8 A;  1PMP A;  2CM4 A;  1XCA A;  3B2I A;  4NNS A;  3MBT A;  2R56 A;  1LIC A;  5L8I A;  3Q6L A;  1KT3 A;  2QO4 A;  1URE A;  2OVD A;  1YWA A;  1EXS A;  2G78 A;  1GT4 A;  1U0X A;  3APX A;  2AMM X;  4QYP A;  4KII A;  1GT1 A;  1D2U A;  1O8V A;  2R73 A;  2KTD A;  1TVQ A;  3WJB A;  1X8Q A;  2WSJ A;  1FDQ A;  2MJI A;  5HA1 A;  3BX8 A;  3F8A A;  1S2P A;  2QO5 A;  3KQ0 A;  3OJY C;  3P6H A;  1YUP A;  4Y0P A;  3WJE A;  4AZM A;  3S26 A;  3U0D A;  2Q2M A;  1GXA A;  1QQS A;  2OFM X;  4GNW A;  4IBA A;  5LKE A;  1L6M A;  3UEX A;  4EEJ A;  3FLL A;  4Y0R A;  3K3L A;  4GH7 A;  4QGW A;  4AZR A;  1X71 A;  3P6D A;  4TKB A;  1FEN A;  1HBP A;  5F1E A;  1ML7 A;  2AT6 X;  4AYH A;  1MUP A;  5EDB A;  3APW A;  3STN A;  2LB6 A;  1B4M A;  1IIU A;  1OBQ A;  4YKM A;  5H9A A;  5LJK A;  2ACP X;  3CBC A;  1KT4 A;  2XST A;  1HMT A;  5EEE A;  3I0A A;  3RZY A;  5LJC A;  3FW5 A;  1SY0 A;  1A3Y A;  3O22 A;  1KZW A;  4I9S A;  1ZNH A;  5HAE A;  1TXL A;  1DZM A;  3PP6 A;  2FT9 A;  2MO5 A;  1PBO A;  3B2J A;  4XMC A;  1X8N A;  2FR2 A;  3VG5 A;  3VG4 A;  4ALB A;  1YWD A;  4NYR A;  3PH6 A;  3UEU A;  4YBP A;  4EDE A;  1DZP A;  1SXX A;  2FRS A;  2Q2P A;  2QOS C;  3FA8 A;  3RSW A;  4NP1 A;  1QG5 A;  4ORS A;  4WBK A;  1T0V A;  5L8O A;  3KFF A;  3CMP A;  2HZR A;  2L5P A;  5B29 A;  5HZ5 A;  4ZHC A;  4MVK A;  4RUN A;  2ASN X;  3TZS A;  4YFP A;  3TF6 A;  1CRB A;  3UEV A;  3D96 A;  4NLI A;  1BSQ A;  3DTQ A;  4AW8 A;  1YP6 A;  2R74 A;  4YMY A;  1LFO A;  1ZNK A;  2A13 A;  5HTE A;  3BU1 A;  1LPJ A;  2HYS A;  4AZP A;  1A18 A;  4LZV A;  1FTP A;  4YGZ A;  2QO6 A;  3HWF A;  1SXY A;  3BS2 A;  1TOU A;  4EXZ A;  1HN2 A;  2ANS A;  3NP1 A;  5LJH A;  4IB9 A;  1N0S A;  3VG3 A;  2HLV A;  4ZR2 A;  4ORX A;  4XMD A;  4QGV A;  2K23 A;  3EYC A;  5F6Z A;  2HZQ A;  2A2U A;  2X45 A;  3SAO A;  1RBP A;  4TKH A;  1AB0 A;  5EPQ A;  1CBQ A;  3U9P C;  3FIQ A;  5LJG A;  1ZNE A;  1JYJ A;  2WQA E;  3ZUI A;  1KZX A;  1ERX A;  5HCE C;  4ZH6 A;  5H9N A;  1JJJ A;  4I3C A;  1JYD A;  4A8Z A;  4BVM A;  5DG4 A;  1R0U A;  4N7D A;  1JJX A;  1EIO A;  2WEW A;  4M7M A;  2BLG A;  5BVQ A;  2Q9S A;  1FE3 A;  2FWV A;  3HWE A;  1DF3 A;  1IW2 A;  1XKI A;  2LKK A;  2GC9 A;  1GT3 A;  5HZQ A;  3VG7 A;  1P6P A;  2EU7 X;  2HMB A;  4QGX A;  2A0A A;  3FA6 A;  4DQ3 A;  2IFB A;  3HWG A;  4TQ2 A;  5LJE A;  2LBV A;  3NQ3 A;  1KGL A;  1G85 A;  1KQX A;  2O62 A;  1YIV A;  4CK4 A;  1ALB A;  1OEK A;  1YP7 A;  1G7N A;  1S7D A;  1TOW A;  1E00 A;  4RUU A;  3O2Y A;  4D6A A;  5EDC A;  1BWY A;  1HMR A;  1E06 A;  1UZ2 X;  2L68 A;  1B8E A;  1GKA A;  1GX8 A;  1I4U A;  4HPD A;  3STM X;  1AVG I;  1OPA A;  2E4J A;  3WJC A;  4I9R A;  2P8G A;  1FEM A;  3P6C A;  2ALL X;  4YCH A;  4YCE A;  1KT7 A;  3PEC A;  1ERB A;  1I05 A;  1KXO A;  4BQU A;  1EPB A;  4TNN A;  4QAE A;  1G5W A;  1QFV A;  1OPB A;  2RCQ A;  4I3B A;  1DZK A;  4ZHF A;  1EQD A;  1ZRY A;  4QZT A;  3WJD A;  1QWD A;  1Z24 A;  2W2B A;  2WEX A;  2AKQ A;  1CBR A;  3WBG A;  4QYN A;  1LIE A;  1X8P A;  1EAL A;  5HCC C;  2JN3 A;  1LKE A;  1OBP A;  3FA9 A;  1EUO A;  4IAW A;  5HWZ A;  4BOE A;  1VPR A;  4WFV A;  1KT5 A;  2CZU A;  4OS8 A;  3STK A;  2KT4 B;  4UU2 A;  3FEP A;  5LJB A;  5HTD A;  1BRQ A;  1EW3 A;  1MDC A;  2AT3 X;  4LKT A;  4ALO A;  3WXQ A;  3GAQ A;  1G74 A;  1A57 A;  5HZ9 A;  3APU A;  1NGL A;  3F9D A;  1LID A;  4OS3 A;  4WFU A;  1GKA B;  3BDR A;  3G7X A;  3HWD A;  4IB7 A;  3FA7 A;  2X46 A;  1NP1 A;  2FTB A;  1U18 A;  4AZO A;  2NND A;  2FR3 A;  4NLJ A;  2L67 A;  4OMX A;  3CQR A;  5H9L A;  2LBA A;  3EM0 A; 
#chains in the Genus database with same CATH topology
 4LKP A;  3FEK A;  4ZCB A;  2RTI B;  4Z2O A;  1MX7 A;  1NP4 A;  2IZH B;  4O4U A;  3P6G A;  4JO6 A;  4NNT A;  4XMH A;  3OE3 A;  5FAZ A;  2JOZ A;  3MVF A;  1BM5 A;  3KFG A;  3EBK A;  3CQN A;  1AEL A;  1BJ7 A;  1VWB B;  4GE1 A;  3EMM A;  2IZE B;  1VWC B;  3FEN A;  3FR4 A;  2OFR X;  3RY2 A;  3ZUO A;  4MVI A;  3WJG A;  3T2W A;  1S44 A;  4QRL A;  2X8T A;  4ZH9 A;  2RTJ A;  1VWI B;  1UYN X;  5JD2 A;  1BEB A;  3T2X A;  1SRI A;  2OF8 A;  1QY1 A;  4ORW A;  4U8U M;  1JV4 A;  3C76 X;  3VG2 A;  4A1Y A;  3TGC A;  1ICN A;  4L1N A;  3SZI A;  3N91 A;  4ID2 A;  2JMB A;  1BSY A;  1QY0 A;  1B56 A;  1SWK A;  1ZNL A;  1H91 A;  2WUT A;  1SRH A;  3FYF A;  2N93 A;  3C77 X;  5KIC A;  2CM9 A;  4GNY A;  4IMO A;  4XMF A;  2FS6 A;  3VE1 A;  1IFC A;  3BRN A;  2IZB A;  4U46 A;  4CV7 A;  2GTL M;  4TLJ A;  5C0N A;  1DZJ A;  5CE4 A;  1N9M A;  4CPE A;  1SA8 A;  3MX7 A;  3NQK A;  5F7G A;  3VPJ E;  3T6F A;  4ZHD A;  2W2A A;  2GTF X;  3D97 A;  1IKE A;  3FMZ A;  2BS6 A;  4GDA A;  3BX7 A;  3KFI A;  4OMW A;  2AH7 X;  2AT8 X;  2A3F X;  3HK1 A;  2CZT A;  3B2K A;  3NR3 A;  5AEO A;  4I3D A;  1BSO A;  4ES7 A;  2RTE B;  4YGH A;  4YKO A;  5JR8 A;  2Q39 A;  3S5X A;  4ZFX A;  2OVE A;  1AVD A;  1PTS A;  1N9Y A;  1QY2 A;  2AT5 X;  1DC9 A;  1MVG A;  2RTR B;  3HOE A;  1I06 A;  3KVN A;  3VG6 A;  2WQ9 A;  4DQ4 A;  1KL5 A;  1KL4 A;  1FJ1 E;  1E02 A;  2Y3E A;  4KT5 A;  4UU3 A;  3NX2 A;  1MM9 A;  3VHM A;  2C4I A;  3WOV A;  4CPH B;  2Z4I A;  3BU9 A;  1AQB A;  2CBR A;  4O4S A;  3RDQ A;  5H9K A;  5HCD C;  4YDA A;  1BLR A;  2WR6 A;  1MX8 A;  2OVA A;  4CDF A;  4TKJ A;  1VWA B;  5HA0 A;  4YDB A;  1JZU A;  1SRG A;  4CSB A;  1LCZ A;  4OEL A;  5KID A;  2UZ2 A;  4Y0Q A;  5K06 A;  4O4O A;  1JQP A;  2AVI A;  4R0B A;  1PBY A;  5FQ8 E;  4DCB A;  1X89 A;  4I60 A;  1LNM A;  2FHL A;  4NV8 A;  3VGW A;  4ZHH A;  2ZAI A;  3WZO A;  1HXZ A;  3MM0 A;  3NPO A;  2JU3 A;  1BBP A;  2RN4 A;  1NDJ A;  1X8O A;  3LTW A;  5BVS A;  2LFO A;  1VWQ B;  1VYG A;  2FS7 A;  2MF6 A;  3PPT A;  4HPA A;  5HBS A;  3KFH A;  4ORY A;  4ORU A;  4EQA C;  1E2T A;  2WWP A;  4PSQ A;  1TW4 A;  1ACD A;  1DFV A;  1KQW A;  5LJD A;  3BLG A;  1SY3 A;  3P6F A;  4IB6 A;  4O9S A;  1SRJ A;  4ZGU A;  3RKG A;  1GX3 A;  3ELX A;  1LUQ A;  1Y55 X;  3AKM A;  2L9C A;  4YVB A;  1SWH A;  2MHD A;  1ADL A;  2OL6 O;  4CPF A;  4YGG A;  2RD7 C;  3AKN A;  1VWL B;  2AT0 X;  4IAB A;  2QM9 A;  1LIB A;  1VYO A;  2QMI A;  4ODD A;  2OY1 O;  3IFB A;  4U8U N;  4IMN A;  5D47 A;  5FFH A;  4AZQ A;  4M6S A;  1SY2 A;  1ZND A;  2IZI A;  1HBQ A;  5AQ6 A;  3BSZ E;  1VYF A;  3ELZ A;  3WJF A;  4INN A;  1VWJ B;  2OL7 A;  4FBR A;  3JSQ A;  1DV9 A;  3O19 A;  1D3S A;  2KD2 A;  4XMG A;  4Y0S A;  2NNQ A;  2XKL A;  1CJ5 A;  2VDF A;  5KHP A;  4GKC A;  2GTL N;  5LKF A;  4ARH A;  4ZJ0 A;  1LCW A;  2PY1 A;  2YG2 A;  1CBI A;  4LZU A;  4MEE A;  4OS0 A;  2Y3F A;  5D8J A;  3BY0 A;  3U0D A;  4NYQ A;  1SWP A;  2YMS A;  4K19 A;  1RLB E;  3WVM A;  1GT5 A;  1QFT A;  1RST B;  3ZW2 A;  4AZN A;  2ACO A;  2F73 A;  4XME A;  4ON1 A;  5H8T A;  4HPB A;  5F58 A;  2IZL B;  2MM3 A;  2RTO B;  3C78 X;  1N4J A;  3CWK A;  4YFQ A;  2RTA A;  4Z2V A;  1SXW A;  1Y0G A;  2POA A;  1PM1 X;  1SWJ A;  5D45 A;  1K24 A;  1E5P A;  4AZM A;  1A2D A;  5D4A A;  2W2F A;  5B10 O;  1SWA A;  3PH5 A;  2NP1 A;  3KZA A;  1T68 X;  3ZQ3 A;  2I5Z O;  1SY1 A;  3PED A;  2AL0 X;  4QZU A;  2OY7 A;  3LV4 A;  1HQP A;  5CHK A;  3SLO A;  3SZH A;  1ZNG A;  1MK5 A;  2IZF B;  1SWE A;  1HMS A;  1OBU A;  5F6B A;  2X32 A;  1JBH A;  4GZV A;  1AVE A;  2BC3 A;  2JW1 A;  3V8U A;  4EKV A;  2OF9 A;  1VWH B;  3FR5 A;  4CPH A;  1KOI A;  3L4R A;  2RA6 A;  4O3Z A;  3B2L A;  2ZSC A;  5IO5 A;  1GGL A;  3WYP A;  1BRP A;  1EPA A;  1STP A;  1X8U A;  2JU8 A;  5EED A;  4O3W A;  4ORR A;  3CR6 A;  2GJ5 A;  4A1H A;  5FQ7 E;  3FR2 A;  3TGB A;  4BGF A;  2IZD B;  3FID A;  3T1D A;  2JU7 A;  1B0O A;  3CBS A;  4GET A;  4N7C A;  4A60 A;  1LIF A;  4Z28 A;  2Y32 A;  3NAD A;  2OZQ A;  4GJV A;  2NNE A;  1SWC A;  1Y9L A;  4IAX A;  3EBW A;  1UYO X;  5B2A O;  2FGS A;  2OY5 O;  3SZJ A;  3VHI A;  1IFB A;  1RXK A;  4Z6J A;  1U17 A;  5B27 A;  1STS B;  4YFR A;  3FW4 A;  5IRU A;  3EW2 A;  1O1U A;  1SXU A;  3NBX X;  5BVT A;  5K67 A;  3I17 A;  5L8N A;  2OY8 A;  2RTC B;  3U03 A;  5D48 A;  5HZ6 A;  3D4R A;  4KCA A;  2PI3 O;  4IB8 A;  3B2H A;  2G79 A;  1QAB E;  2BSZ A;  1CBS A;  1SLF B;  2A2G A;  3NQ9 A;  4MIR A;  1SWF A;  2MWH A;  3DSZ A;  1VWP B;  1W4T A;  4GRJ A;  1OEE A;  4CPI A;  5IO6 A;  5FEN A;  4O3X B;  1JJU A;  2RTG B;  3D95 A;  5IO7 A;  4HPC A;  1O1V A;  2RCT A;  1YWB A;  3RWX A;  2RQ0 A;  4GDZ A;  1KL3 A;  3P02 A;  3JS1 A;  3IA8 A;  5DPQ A;  4Y59 A;  4MVL A;  2Q4N A;  3QKG A;  5B5G A;  3SOT A;  3EW1 A;  4HFO A;  3APV A;  3FEL A;  1SLG B;  2G7B A;  1LF7 A;  3WZP A;  1VWF B;  4L3R A;  1YWC A;  2QOM A;  2RTQ B;  1IKJ A;  4D6B A;  1VWD B;  1SLE B;  1SWN A;  1VWR B;  1W5R A;  3NX1 A;  4ZHG A;  1I04 A;  2K62 A;  4Z2P A;  3TGA A;  5F2B A;  3WZN A;  1Y52 X;  5EZ2 A;  5B5F A;  1PEE A;  4TJZ A;  4YH0 A;  1ICM A;  1SRE A;  1FEL A;  2HNX A;  1KT6 A;  2FLJ A;  2CBS A;  1GM6 A;  1T8V A;  4OEM A;  3F6Z B;  4YBU A;  4KC8 A;  1LEL A;  2C1S A;  2DM5 A;  4NW4 A;  3UEW A;  3P6E A;  3ZW1 A;  1GX9 A;  1OEJ A;  5HZ8 A;  1PMP A;  3CKG A;  1XCA A;  2CM4 A;  3B2I A;  2RTP B;  4NNS A;  3MBT A;  2DJF A;  2R56 A;  1LIC A;  5L8I A;  3Q6L A;  4C5P A;  1MOY A;  1KT3 A;  2QO4 A;  2G5L A;  1URE A;  2I5V O;  2OVD A;  1Y9T A;  1YWA A;  1EXS A;  2G78 A;  1GT4 A;  1U0X A;  3APX A;  2AMM X;  4QYP A;  1VWN B;  3RDS A;  4KII A;  1SWB A;  1JMZ A;  1D2U A;  1GT1 A;  1O8V A;  3Q34 A;  2R73 A;  3HTY A;  2KTD A;  3E3C A;  3OBL A;  2OVS A;  1TVQ A;  3WJB A;  3D9W A;  4QGV A;  1X8Q A;  3GE2 A;  2WSJ A;  1FDQ A;  2MJI A;  5HA1 A;  3BX8 A;  3F8A A;  1S2P A;  2QO5 A;  3KQ0 A;  3OJY C;  3P6H A;  1YUP A;  2OFA A;  2X8S A;  3CKF A;  4GGR A;  3S26 A;  2Q2M A;  1GXA A;  1QQS A;  2OFM X;  4GNW A;  1NQN A;  4IBA A;  4MVE A;  4PJ2 A;  1L6M A;  5LKE A;  3UEX A;  4EEJ A;  3FLL A;  4Y0R A;  3K3L A;  4GH7 A;  4QGW A;  2LA7 A;  1X71 A;  3P6D A;  1SMP I;  4AZR A;  4TKB A;  1FEN A;  1HBP A;  2IZG B;  3P24 A;  4Y5D A;  5F1E A;  1ML7 A;  2AT6 X;  4AYH A;  1MUP A;  2VFC A;  3EC5 A;  5EDB A;  3APW A;  3MG5 A;  2LB6 A;  2M4L A;  3FDC A;  1NBX A;  4MIS A;  1IIU A;  2RTD B;  1OBQ A;  1B4M A;  4YKM A;  4O3Y A;  3RDO A;  5FQ6 E;  5H9A A;  5LJK A;  5CYB A;  2ACP X;  5L3Y A;  3CBC A;  1KT4 A;  2XST A;  1RXH A;  1HMT A;  5EEE A;  3I0A A;  2A8G A;  3RZY A;  2KTS A;  3FW5 A;  1SY0 A;  1A3Y A;  3O22 A;  3ZW0 A;  3ZW1 B;  4BBO A;  1KZW A;  4I9S A;  1ZNH A;  5HAE A;  1TXL A;  1DZM A;  3PP6 A;  2FT9 A;  2MO5 A;  1PBO A;  3B2J A;  4XMC A;  1LDQ A;  3ZWE A;  1VWE B;  4GUZ A;  3HOL A;  2C1Q A;  2GH7 A;  2IZK A;  1X8N A;  2FR2 A;  3VG5 A;  3VG4 A;  2IZJ A;  4ALB A;  1YWD A;  4NYR A;  2BHV A;  3PH6 A;  5B3M O;  3UEU A;  4YBP A;  3PQU A;  1HXL A;  3RDM A;  1DZP A;  1SXX A;  2FRS A;  2Q2P A;  2QOS C;  3FA8 A;  3RSW A;  4EDE A;  4ZGF A;  4NP1 A;  1QG5 A;  4ORS A;  4WBK A;  1T0V A;  2X56 A;  3KFF A;  5L8O A;  3CMP A;  2HZR A;  3LHN A;  2L5P A;  5B29 A;  5HZ5 A;  4ZHC A;  3H3I A;  4MVK A;  1WBI A;  4IRW A;  4RUN A;  2ASN X;  1MEP A;  4GD9 A;  4NV7 A;  4BCS A;  3TZS A;  4YFP A;  2OYB O;  1CRB A;  3TF6 A;  5K68 A;  3UEV A;  3VHH A;  4BX7 B;  1OSP O;  1SWT A;  2AF5 A;  3D96 A;  3VE2 A;  3ZW0 B;  4NLI A;  4I95 A;  1BSQ A;  3DTQ A;  4AW8 A;  1YP6 A;  2R74 A;  4YMY A;  2FHN X;  1LFO A;  1ZNK A;  2A13 A;  2RTK A;  3BU1 A;  5AJC A;  5HTE A;  3RE5 A;  1IJ8 A;  1LPJ A;  4BX5 B;  2HYS A;  3S5V A;  4AZP A;  1A18 A;  1SWR A;  4LZV A;  1FTP A;  2A5B A;  4YGZ A;  2A5C A;  2QO6 A;  3HWF A;  3AEH A;  2JGS A;  1SXY A;  1LCV A;  1SLD B;  3BS2 A;  4WHI A;  1K3B A;  4O49 A;  1TOU A;  4EXZ A;  2X34 A;  4COT A;  1HN2 A;  2ANS A;  2IZC B;  3NP1 A;  3JQO A;  4B55 A;  5LJH A;  4IB9 A;  1N0S A;  4QQ1 A;  3VG3 A;  5LJC A;  2RTL A;  2HLV A;  4ZR2 A;  1EII A;  3X00 A;  4ORX A;  4XMD A;  1RXJ A;  1WUB A;  2K23 A;  2UYW A;  3EYC A;  4KC7 A;  1HQQ A;  2HZQ A;  2A2U A;  2X45 A;  5F6Z A;  1RBP A;  1SWQ A;  4TKH A;  3RBY A;  3SAO A;  1AB0 A;  5EPQ A;  1CBQ A;  3U9P C;  1N7Y A;  3FIQ A;  4GU8 A;  5LJG A;  3S60 A;  1ZNE A;  3WYQ A;  1JYJ A;  3STN A;  2WQA E;  1RSU B;  2RTB B;  3ZUI A;  1W6F A;  1SWD A;  2Z4H A;  1ERX A;  1JMX A;  1HY2 A;  5HCE C;  3WZQ A;  4CDC A;  1KZX A;  4O4X A;  5H9N A;  4ZH6 A;  1SWO A;  1JJJ A;  4BX6 A;  4HWM A;  4I3C A;  1JYD A;  4A8Z A;  4BVM A;  3PK2 A;  5DG4 A;  1R0U A;  4N7D A;  1JJX A;  1EIO A;  2WEW A;  4M7M A;  2IZA A;  2BLG A;  4CDE A;  5BVQ A;  1JIW I;  2Q9S A;  4FBO A;  1FE3 A;  2FWV A;  4FGI B;  2RTH B;  3SLT A;  4Z27 A;  3HWE A;  2BS5 A;  4FQB B;  1DF3 A;  1IW2 A;  1XKI A;  2LKK A;  3ZZV A;  2GC9 A;  3RE6 A;  2ZAG A;  1GT3 A;  5HZQ A;  3VG7 A;  1P6P A;  3PQS A;  2RTN B;  2EU7 X;  2HMB A;  4QGX A;  2A0A A;  3RDX A;  3FA6 A;  4DQ3 A;  2IFB A;  3PDF A;  3HWG A;  4GGZ A;  4TQ2 A;  5LJE A;  2LBV A;  3NQ3 A;  1VWM B;  1KGL A;  1G85 A;  1KQX A;  2O62 A;  1YIV A;  4CK4 A;  1ALB A;  1NQM A;  1OEK A;  3RY1 A;  1YP7 A;  1G7N A;  1S7D A;  1VWG B;  2OL8 O;  4OKA A;  5IRA A;  5BYP A;  1TOW A;  1E00 A;  4RUU A;  1SWL A;  3O2Y A;  4D6A A;  5EDC A;  1BWY A;  1HMR A;  1EI5 A;  3OD9 A;  2HKD A;  1E06 A;  1UZ2 X;  1B8E A;  1GKA A;  1GX8 A;  1I4U A;  2L68 A;  2QCB A;  4GGT A;  4HPD A;  1AVG I;  1OPA A;  2E4J A;  1LDO A;  4I6S A;  3RDU A;  4I9R A;  3STM X;  3WJC A;  5AJB A;  2P8G A;  1FEM A;  2F09 A;  1NC9 A;  3P6C A;  2ALL X;  4YCH A;  4YCE A;  2X4M A;  1KT7 A;  3VU1 A;  4CDD A;  3PEC A;  1ERB A;  1I05 A;  1KXO A;  2BT9 A;  1EPB A;  4GK9 A;  2CAM A;  4QAE A;  4TNN A;  2VFB A;  3ZI8 A;  4BQU A;  4BX7 A;  1G5W A;  1QFV A;  1OPB A;  4BX6 B;  2RCQ A;  4I3B A;  4EFG A;  4QNI A;  1DZK A;  5B11 O;  3WJE A;  1VWK B;  4ZHF A;  1EQD A;  1ZRY A;  4QZT A;  3HPE A;  3WJD A;  1QWD A;  4U8U O;  1Z24 A;  2W2B A;  2WEX A;  2AKQ A;  4DNE A;  4FBV A;  1VWO B;  4BX5 A;  4U9C A;  1CBR A;  3T6L A;  4Y0P A;  3WBG A;  2DJG A;  2RTF B;  1LIE A;  4QYN A;  4BJ8 A;  1X8P A;  2FKG A;  1EAL A;  3UAQ A;  5HCC C;  2JN3 A;  1LKE A;  2OFB A;  4JNJ A;  1OBP A;  1SWS A;  1EUO A;  2KW1 A;  2X55 A;  3FA9 A;  4IAW A;  3SLJ A;  5HWZ A;  1Y53 X;  1SWG A;  1N43 A;  2GTL O;  4BOE A;  1VPR A;  4JHQ A;  4WFV A;  1KT5 A;  2CZU A;  4KH8 A;  3AUM O;  4OS8 A;  3STK A;  2KT4 B;  4UU2 A;  1STR B;  3FEP A;  5LJB A;  5IRW A;  2RTM A;  4JGL A;  5HTD A;  1SRF A;  1KFF A;  1BRQ A;  1EW3 A;  1MDC A;  2AT3 X;  4LKT A;  4LQZ A;  4U3Q A;  5CSE A;  3WXQ A;  3GAQ A;  1DF8 A;  4ALO A;  2WPU A;  2G8C O;  1SWU A;  1G74 A;  1I9H A;  1A57 A;  5HZ9 A;  3APU A;  1NGL A;  3F9D A;  1LID A;  4OS3 A;  1RAV A;  4ML7 B;  4WFU A;  1GKA B;  3BDR A;  3G7X A;  3HWD A;  4IB7 A;  2FKJ A;  3FA7 A;  2X46 A;  1NP1 A;  2FTB A;  2F01 A;  1U18 A;  4AZO A;  2NND A;  1I78 A;  5IXG A;  2X8F A;  2FR3 A;  4NLJ A;  2L67 A;  3QQ2 A;  4OMX A;  3CQR A;  5H9L A;  2LBA A;  3EM0 A;  4GJS A; 
#chains in the Genus database with same CATH homology
 4LKP A;  3FEK A;  4ZCB A;  1MX7 A;  1NP4 A;  4O4U A;  3P6G A;  4NNT A;  4XMH A;  3OE3 A;  5FAZ A;  2JOZ A;  3MVF A;  1BM5 A;  3KFG A;  3EBK A;  3CQN A;  1AEL A;  1BJ7 A;  4GE1 A;  3EMM A;  3FEN A;  3ZUO A;  3FR4 A;  2OFR X;  4MVI A;  3WJG A;  1S44 A;  4QRL A;  2X8T A;  4ZH9 A;  1BEB A;  3VG2 A;  1QY1 A;  4ORW A;  4U8U M;  1JV4 A;  3C76 X;  4A1Y A;  3TGC A;  1ICN A;  4L1N A;  3N91 A;  4ID2 A;  2JMB A;  1BSY A;  1QY0 A;  1B56 A;  1ZNL A;  1H91 A;  2WUT A;  3FYF A;  2N93 A;  3C77 X;  5KIC A;  2CM9 A;  4GNY A;  4IMO A;  4XMF A;  2FS6 A;  3VE1 A;  1IFC A;  3BRN A;  4CV7 A;  2GTL M;  4TLJ A;  5C0N A;  1DZJ A;  5CE4 A;  1SA8 A;  3MX7 A;  3NQK A;  5F7G A;  3VPJ E;  4ZHD A;  2W2A A;  2GTF X;  3D97 A;  1IKE A;  3FMZ A;  2BS6 A;  3BX7 A;  3KFI A;  4OMW A;  2AH7 X;  2AT8 X;  2A3F X;  3HK1 A;  2CZT A;  3B2K A;  3NR3 A;  5AEO A;  4I3D A;  1BSO A;  4ES7 A;  4YGH A;  4YKO A;  5JR8 A;  2Q39 A;  3S5X A;  4ZFX A;  2OVE A;  1QY2 A;  2AT5 X;  1DC9 A;  1MVG A;  3HOE A;  1I06 A;  3VG6 A;  2WQ9 A;  4DQ4 A;  4KT5 A;  4UU3 A;  1E02 A;  3NX2 A;  3WOV A;  2Z4I A;  3BU9 A;  1AQB A;  2CBR A;  4O4S A;  5H9K A;  5HCD C;  4YDA A;  1BLR A;  2WR6 A;  1MX8 A;  2OVA A;  4TKJ A;  5HA0 A;  1JZU A;  4YDB A;  4CSB A;  5KID A;  4Y0Q A;  5K06 A;  4O4O A;  4R0B A;  5FQ8 E;  1X89 A;  1LNM A;  4ZHH A;  2ZAI A;  3NPO A;  2JU3 A;  1BBP A;  2RN4 A;  1X8O A;  5BVS A;  2LFO A;  1VYG A;  2FS7 A;  3PPT A;  4HPA A;  5HBS A;  3KFH A;  4ORY A;  4ORU A;  4EQA C;  2WWP A;  4PSQ A;  1TW4 A;  1ACD A;  1DFV A;  1KQW A;  5LJD A;  3BLG A;  1SY3 A;  3P6F A;  4IB6 A;  4O9S A;  4ZGU A;  3RKG A;  3ELX A;  3AKM A;  2L9C A;  2MHD A;  1ADL A;  4YGG A;  2RD7 C;  3AKN A;  2AT0 X;  4IAB A;  2QM9 A;  1LIB A;  2QMI A;  4ODD A;  3IFB A;  4U8U N;  4IMN A;  5D47 A;  5FFH A;  4AZQ A;  4M6S A;  1SY2 A;  1ZND A;  1HBQ A;  5AQ6 A;  3BSZ E;  1VYF A;  3ELZ A;  3WJF A;  4INN A;  4FBR A;  3JSQ A;  1DV9 A;  3O19 A;  1D3S A;  2KD2 A;  4XMG A;  4Y0S A;  2NNQ A;  2XKL A;  1CJ5 A;  5KHP A;  4GKC A;  2GTL N;  5LKF A;  4ARH A;  4ZJ0 A;  2PY1 A;  2YG2 A;  4LZU A;  1CBI A;  4OS0 A;  5D8J A;  3U0D A;  3BY0 A;  4NYQ A;  2YMS A;  3ZW2 A;  4K19 A;  1RLB E;  3WVM A;  1GT5 A;  1QFT A;  4AZN A;  2ACO A;  2F73 A;  4XME A;  4ON1 A;  5H8T A;  4HPB A;  5F58 A;  2MM3 A;  4YFQ A;  3C78 X;  3CWK A;  1SXW A;  2POA A;  1PM1 X;  5D45 A;  1E5P A;  1A2D A;  5D4A A;  2W2F A;  3PH5 A;  2NP1 A;  3KZA A;  1T68 X;  3ZQ3 A;  3PED A;  1SY1 A;  4QZU A;  2AL0 X;  3LV4 A;  1HQP A;  1ZNG A;  1HMS A;  1OBU A;  5F6B A;  1JBH A;  4GZV A;  2JW1 A;  3V8U A;  3FR5 A;  1KOI A;  3L4R A;  2RA6 A;  4O3Z A;  3B2L A;  5IO5 A;  1GGL A;  1BRP A;  1EPA A;  1X8U A;  2JU8 A;  5EED A;  4O3W A;  4ORR A;  3CR6 A;  2GJ5 A;  4A1H A;  5FQ7 E;  3FR2 A;  3TGB A;  3T1D A;  2JU7 A;  1B0O A;  3CBS A;  4GET A;  4N7C A;  4A60 A;  1LIF A;  4EFG A;  3NAD A;  2OZQ A;  2NNE A;  1Y9L A;  4IAX A;  3EBW A;  1IFB A;  1U17 A;  5B27 A;  4YFR A;  3FW4 A;  1O1U A;  1SXU A;  3NBX X;  5BVT A;  3I17 A;  5L8N A;  3U03 A;  5D48 A;  5HZ6 A;  3D4R A;  4KCA A;  4IB8 A;  3B2H A;  2G79 A;  1QAB E;  1CBS A;  2A2G A;  3NQ9 A;  4MIR A;  2MWH A;  3DSZ A;  4GRJ A;  1OEE A;  5IO6 A;  5FEN A;  4O3X B;  3D95 A;  5IO7 A;  4HPC A;  1O1V A;  2RCT A;  1YWB A;  3RWX A;  2RQ0 A;  4GDZ A;  3P02 A;  3JS1 A;  3IA8 A;  5DPQ A;  4MVL A;  2Q4N A;  3QKG A;  3SOT A;  4HFO A;  3APV A;  3FEL A;  2G7B A;  1LF7 A;  4L3R A;  1YWC A;  1IKJ A;  4D6B A;  4ZHG A;  3NX1 A;  1I04 A;  2K62 A;  3TGA A;  5EZ2 A;  1PEE A;  4TJZ A;  4YH0 A;  1ICM A;  1FEL A;  2HNX A;  1KT6 A;  2FLJ A;  2CBS A;  1GM6 A;  1T8V A;  4YBU A;  3F6Z B;  4KC8 A;  2DM5 A;  4NW4 A;  3UEW A;  3P6E A;  3ZW1 A;  1GX9 A;  1OEJ A;  5HZ8 A;  1PMP A;  2CM4 A;  1XCA A;  3B2I A;  4NNS A;  3MBT A;  2R56 A;  1LIC A;  5L8I A;  3Q6L A;  1KT3 A;  2QO4 A;  1URE A;  2OVD A;  1Y9T A;  1YWA A;  1EXS A;  2G78 A;  1GT4 A;  1U0X A;  3APX A;  2AMM X;  4QYP A;  4KII A;  1GT1 A;  1D2U A;  1O8V A;  2R73 A;  3HTY A;  2KTD A;  3E3C A;  3OBL A;  2OVS A;  1TVQ A;  3WJB A;  1X8Q A;  3GE2 A;  2WSJ A;  1FDQ A;  2MJI A;  5HA1 A;  3BX8 A;  3F8A A;  1S2P A;  2QO5 A;  3KQ0 A;  3OJY C;  3P6H A;  1YUP A;  4Y0P A;  2X8S A;  3WJE A;  3S26 A;  4AZM A;  2Q2M A;  1GXA A;  1QQS A;  2OFM X;  4GNW A;  4IBA A;  4MVE A;  4PJ2 A;  5LKE A;  1L6M A;  3UEX A;  4EEJ A;  3FLL A;  4Y0R A;  3K3L A;  4GH7 A;  4QGW A;  2LA7 A;  1X71 A;  3P6D A;  1SMP I;  4AZR A;  4TKB A;  1FEN A;  1HBP A;  3P24 A;  5F1E A;  1ML7 A;  2AT6 X;  4AYH A;  1MUP A;  5EDB A;  3APW A;  3STN A;  2LB6 A;  2M4L A;  4MIS A;  3ZW0 A;  1B4M A;  1IIU A;  1OBQ A;  4YKM A;  4O3Y A;  5FQ6 E;  5H9A A;  5LJK A;  5CYB A;  2ACP X;  3CBC A;  1KT4 A;  2XST A;  1HMT A;  5EEE A;  3I0A A;  3RZY A;  5LJC A;  2KTS A;  3FW5 A;  1SY0 A;  1A3Y A;  3O22 A;  3ZW1 B;  1KZW A;  4I9S A;  1ZNH A;  5HAE A;  1TXL A;  1DZM A;  3PP6 A;  2FT9 A;  2MO5 A;  1PBO A;  3B2J A;  4XMC A;  3ZWE A;  3HOL A;  1X8N A;  2FR2 A;  3VG5 A;  3VG4 A;  4ALB A;  1YWD A;  4NYR A;  2BHV A;  3PH6 A;  3UEU A;  4YBP A;  3PQU A;  4EDE A;  1DZP A;  1SXX A;  2FRS A;  2Q2P A;  2QOS C;  3FA8 A;  3RSW A;  4ZGF A;  4NP1 A;  1QG5 A;  4ORS A;  4WBK A;  1T0V A;  5L8O A;  3KFF A;  3CMP A;  2HZR A;  3LHN A;  2L5P A;  5B29 A;  5HZ5 A;  4ZHC A;  3H3I A;  4MVK A;  4RUN A;  2ASN X;  3TZS A;  4YFP A;  3TF6 A;  1CRB A;  3UEV A;  3D96 A;  3VE2 A;  3ZW0 B;  4NLI A;  4I95 A;  1BSQ A;  3DTQ A;  4AW8 A;  1YP6 A;  2R74 A;  4YMY A;  1LFO A;  1ZNK A;  2A13 A;  5HTE A;  3BU1 A;  5AJC A;  1LPJ A;  2HYS A;  3S5V A;  4AZP A;  1A18 A;  4LZV A;  1FTP A;  4YGZ A;  2QO6 A;  3HWF A;  4WHI A;  1SXY A;  3BS2 A;  4O49 A;  1TOU A;  4EXZ A;  4COT A;  1HN2 A;  2ANS A;  3NP1 A;  3JQO A;  5LJH A;  4IB9 A;  1N0S A;  4QQ1 A;  3VG3 A;  2HLV A;  4ZR2 A;  1EII A;  4ORX A;  4XMD A;  4QGV A;  2K23 A;  3EYC A;  5F6Z A;  4KC7 A;  3RBY A;  2HZQ A;  2A2U A;  2X45 A;  3SAO A;  1RBP A;  4TKH A;  1AB0 A;  5EPQ A;  1CBQ A;  3U9P C;  4GU8 A;  3FIQ A;  5LJG A;  3S60 A;  1ZNE A;  1JYJ A;  2WQA E;  3ZUI A;  1KZX A;  2Z4H A;  1ERX A;  5HCE C;  4O4X A;  5H9N A;  4ZH6 A;  1JJJ A;  4HWM A;  4I3C A;  1JYD A;  4A8Z A;  4BVM A;  5DG4 A;  1R0U A;  4N7D A;  1JJX A;  1EIO A;  2WEW A;  4M7M A;  2BLG A;  5BVQ A;  1JIW I;  2Q9S A;  4FBO A;  1FE3 A;  2FWV A;  4FGI B;  3HWE A;  2BS5 A;  4FQB B;  1DF3 A;  1IW2 A;  1XKI A;  2LKK A;  3ZZV A;  2GC9 A;  2ZAG A;  1GT3 A;  5HZQ A;  3VG7 A;  1P6P A;  3PQS A;  2EU7 X;  2HMB A;  4QGX A;  2A0A A;  3FA6 A;  4DQ3 A;  2IFB A;  3HWG A;  4TQ2 A;  5LJE A;  2LBV A;  3NQ3 A;  1KGL A;  1G85 A;  1KQX A;  2O62 A;  1YIV A;  4CK4 A;  1ALB A;  1OEK A;  1YP7 A;  1G7N A;  1S7D A;  5BYP A;  1TOW A;  1E00 A;  4RUU A;  3O2Y A;  4D6A A;  5EDC A;  1BWY A;  1HMR A;  1EI5 A;  3OD9 A;  1E06 A;  1UZ2 X;  2L68 A;  1B8E A;  1GKA A;  1GX8 A;  1I4U A;  4HPD A;  3STM X;  1AVG I;  1OPA A;  2E4J A;  4I6S A;  3WJC A;  4I9R A;  5AJB A;  2P8G A;  1FEM A;  2F09 A;  3P6C A;  2ALL X;  4YCH A;  4YCE A;  1KT7 A;  3VU1 A;  3PEC A;  1ERB A;  1I05 A;  1KXO A;  2BT9 A;  1EPB A;  4GK9 A;  4QAE A;  4TNN A;  3ZI8 A;  4BQU A;  1G5W A;  1QFV A;  1OPB A;  2RCQ A;  4I3B A;  4QNI A;  1DZK A;  4ZHF A;  1EQD A;  1ZRY A;  4QZT A;  3WJD A;  1QWD A;  4U8U O;  1Z24 A;  2W2B A;  2WEX A;  2AKQ A;  4FBV A;  4U9C A;  1CBR A;  3WBG A;  4QYN A;  1LIE A;  1X8P A;  1EAL A;  3UAQ A;  5HCC C;  2JN3 A;  1LKE A;  1OBP A;  2KW1 A;  1EUO A;  3FA9 A;  4IAW A;  5HWZ A;  2GTL O;  4BOE A;  1VPR A;  4WFV A;  1KT5 A;  2CZU A;  4KH8 A;  4OS8 A;  3STK A;  2KT4 B;  4UU2 A;  3FEP A;  5LJB A;  4JGL A;  5HTD A;  1BRQ A;  1EW3 A;  1MDC A;  2AT3 X;  4LKT A;  4LQZ A;  4U3Q A;  4ALO A;  3WXQ A;  3GAQ A;  1G74 A;  1A57 A;  5HZ9 A;  3APU A;  1NGL A;  3F9D A;  1LID A;  4OS3 A;  4ML7 B;  4WFU A;  1GKA B;  3BDR A;  3G7X A;  3HWD A;  4IB7 A;  3FA7 A;  2X46 A;  1NP1 A;  2FTB A;  1U18 A;  4AZO A;  2NND A;  2X8F A;  2FR3 A;  4NLJ A;  2L67 A;  4OMX A;  3CQR A;  5H9L A;  2LBA A;  3EM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...