4HFOA

Biogenic amine-binding protein selenomethionine derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
195
structure length
195
Chain Sequence
b'SGCSTVDTVKDFNKDNFFTGSWYMTHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYMYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Amine-binding protein
total genus 53
structure length 195
sequence length 195
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4hfoA00
3KQ0A 1VYFA 4I3BA 1ZRYA 1UZ2X 4ZHCA 1HBPA 1QQSA 2DM5A 3ZQ3A 2KTDA 3P6HA 2G79A 4OS8A 3CMPA 2A2GA 3B2IA 2JU8A 1HQPA 1LIFA 1AB0A 2RCQA 2Q39A 4YDBA 5IO7A 3VG7A 4TKBA 1ZNGA 3NQ3A 4ORXA 1GT1A 3P6FA 1BSYA 1MUPA 2P8GA 2X45A 2NNEA 1RLBE 2HYSA 4QZTA 3WVMA 4ZHDA 1E02A 4Y0QA 4ZGUA 1ICMA 1D3SA 4YKMA 5D48A 1EUOA 3NP1A 3I0AA 5D4AA 1PM1X 1NGLA 2FS6A 5LJBA 1CBSA 3WJEA 1PBOA 1ZNLA 2G78A 1ICNA 2CM4A 2L67A 4N7CA 3APUA 4CK4A 5KICA 4OMWA 4ZHHA 4GKCA 2FS7A 1SA8A 1S44A 3FA7A 1JYDA 5LJEA 3FW4A 1O1UA 5BVTA 1A2DA 5HZ8A 4R0BA 4WFVA 2MO5A 3KFIA 2W2BA 3FA8A 2EU7X 1YP7A 1OEJA 1H91A 2WR6A 4D6AA 3BDRA 4EXZA 2A13A 4GH7A 4ORRA 4XMFA 2LBVA 1KOIA 4TNNA 4I9SA 3FR2A 1LPJA 1HMTA 5F7GA 2AT3X 4DQ3A 3O19A 3O22A 3CBCA 3Q6LA 1ERBA 1OEEA 1XCAA 2FR2A 1LIBA 4TLJA 1ML7A 3S26A 2BLGA 4HPAA 1DF3A 4A1YA 2K23A 1QY0A 4QGVA 1HBQA 5DG4A 2CBRA 4WBKA 3P6CA 3FEPA 3HWGA 2AT0X 1MVGA 4ARHA 4GNYA 3T1DA 5F58A 2A0AA 1YWBA 4QGWA 4EDEA 2FWVA 1SY1A 1QY2A 3BS2A 1IKJA 1FTPA 3HK1A 3EM0A 5C0NA 1NP4A 1QABE 2GTFX 3PEDA 4AZOA 3NADA 1X89A 2G7BA 3FA9A 5HTEA 2L9CA 1EIOA 3VG3A 1QWDA 5B27A 4IB7A 4K19A 1TOWA 3IFBA 2K62A 3I17A 5IO5A 1QG5A 4YKOA 3APWA 5EEEA 3PPTA 1OPAA 5EDBA 4NLJA 1U18A 4XMHA 2FR3A 3FLLA 2XSTA 1SY0A 2QO6A 3JS1A 5HZ9A 3F8AA 1KT7A 1KT4A 2F73A 1DZJA 1GGLA 2GJ5A 2LFOA 2QO5A 1IKEA 2WQ9A 4OMXA 1DZPA 1OBQA 1BLRA 5K06A 1E06A 1BSQA 2FT9A 4BVMA 1G5WA 1ACDA 2WEXA 2MM3A 3GAQA 3JSQA 3UEUA 3PH6A 3DTQA 3KZAA 3ELXA 5IO6A 4M7MA 4OS0A 1FDQA 2JOZA 3BX7A 1X71A 4DQ4A 1CBIA 3NPOA 2AH7X 3PECA 2AL0X 4YFRA 3C78X 1YUPA 4LZVA 3C77X 1GT3A 1BEBA 3FENA 5HZ5A 1OBUA 3EMMA 4GE1A 3EBWA 1TVQA 4YGZA 1JJJA 1BRQA 2WWPA 2CZUA 1B4MA 1BM5A 5H9AA 5FENA 1YWCA 4ORYA 5LJKA 3L4RA 4A1HA 1DC9A 4ZH6A 2QM9A 1XKIA 3TF6A 2OVEA 5L8NA 1TXLA 4AZNA 3UEXA 2R74A 3SAOA 5LJCA 4ORSA 4HPDA 2PY1A 2AT5X 1U0XA 1QFVA 3FR5A 4IB8A 1JZUA 5BVQA 5L8OA 1KXOA 2AMMX 2OZQA 2QOSC 1I06A 3D95A 1GX8A 1X8PA 1ZNEA 1IFCA 3UEWA 5F1EA 1AQBA 2WEWA 2ASNX 3HWDA 3TGAA 1A3YA 1HMSA 5HBSA 5JR8A 1BRPA 1VPRA 1YWAA 4Y0PA 4IMNA 1KQXA 2ACPX 3P6GA 4Y0SA 3VG5A 3APVA 4YMYA 4HPCA 3MVFA 1ZNDA 3C76X 2KT4B 1OPBA 4ODDA 5HTDA 1I04A 1T8VA 3AKMA 3ZUOA 4QZUA 5EPQA 2L5PA 4TKHA 1QY1A 1X8OA 3PP6A 1O1VA 4OS3A 4YCEA 5HA1A 3BU9A 4XMEA 3KFHA 4RUNA 5BVSA 1SY3A 5F6BA 3BU1A 5EEDA 4ZH9A 3CWKA 2QO4A 5CE4A 5FFHA 2RD7C 3U9PC 1B0OA 2AKQA 2WSJA 1TOUA 3NQ9A 1BWYA 1R0UA 2AT6X 4ZCBA 3BSZE 4AZPA 3NR3A 4QAEA 2W2FA 4MVLA 3STMX 4TJZA 4XMDA 2CZTA 5LJGA 4ALBA 1GT4A 1FELA 2A2UA 5FAZA 3APXA 3CQNA 1GT5A 2FLJA 4HFOA 1DV9A 2IFBA 5EZ2A 5HCEC 1DZMA 1LNMA 1E5PA 2NNQA 5LKFA 5LJHA 1IIUA 1KQWA 4EFGA 3FEKA 2E4JA 1O8VA 4ORUA 4GETA 4XMCA 1BSOA 3HWEA 1BBPA 1GKAA 2A3FX 1G7NA 2L68A 3F9DA 3WBGA 4I9RA 3FW5A 1MX8A 1G74A 3K3LA 5D45A 4AYHA 3VG4A 5D8JA 4BQUA 4QYNA 2RQ0A 4XMGA 2W2AA 5EDCA 3G7XA 2FRSA 5LKEA 4GRJA 1SY2A 2O62A 4YGGA 1Z24A 1FE3A 1SXUA 1ZNHA 4ZHGA 1EALA 3U03A 2ACOA 1KT5A 2R56A 5DPQA 5H9LA 5HCDC 1N0SA 2OVAA 1YP6A 1GX9A 1NP1A 1JBHA 1I4UA 4A8ZA 3NX2A 1KT6A 2AT8X 2XKLA 1AVGI 4YBUA 3AKNA 1A57A 1FEMA 1I05A 1IW2A 3ELZA 4I3DA 1LICA 2Q2PA 1GKAB 1KGLA 2CM9A 1GM6A 2HNXA 1U17A 1ERXA 4QYPA 1KT3A 2NP1A 4PSQA 2X46A 3KFGA 1HMRA 4TKJA 4BOEA 3ZUIA 3BRNA 1CBQA 1IFBA 5KHPA 1PEEA 2OFRX 2R73A 2HZQA 1LF7A 4NNTA 4YFQA 3P6EA 5H9KA 1AELA 1KZXA 3IA8A 4KIIA 3TZSA 2ALLX 1SXXA 4NYQA 3P6DA 5LJDA 1EXSA 3FR4A 5B29A 3NX1A 5HA0A 3OJYC 2LKKA 4N7DA 1EQDA 1CRBA 4Y0RA 1MDCA 3BLGA 5HZQA 3BX8A 3BY0A 1TW4A 1S2PA 2RCTA 2YG2A 4AZMA 2JU3A 4D6BA 1D2UA 5KIDA 4GNWA 4ZFXA 3DSZA 3RSWA 3O2YA 2JU7A 3WJCA 4IAXA 3FIQA 3WJFA 1CBRA 4QGXA 5H8TA 2HZRA 3MBTA 4IAWA 1EIIA 4IMOA 4ORWA 4IBAA 2FTBA 4ZHFA 3B2HA 4YDAA 4MVIA 3U0DA 1LIEA 3VG6A 3FA6A 1SXYA 3B2KA 3PH5A 3D96A 3EYCA 4RUUA 4ZR2A 1MX7A 5HWZA 1YIVA 3TGBA 1ALBA 1S7DA 2POAA 2CBSA 4AZRA 4EEJA 5HCCC 1G85A 2LB6A 2MJIA 4NNSA 4YGHA 2NNDA 4LKTA 1BJ7A 2Q2MA 1X8QA 4NYRA 4IB9A 4YFPA 3WJGA 5F6ZA 1EPBA 3CBSA 5L8IA 3WJBA 1KZWA 5AQ6A 2OFMX 4IB6A 3B2JA 4YBPA 2OVDA 4HPBA 1EPAA 4I3CA 1X8NA 5HAEA 3CR6A 4WFUA 4LKPA 1B56A 4MVKA 3UEVA 3D97A 2GC9A 1LKEA 3WJDA 4ALOA 3KFFA 1A18A 1YWDA 1EW3A 3STKA 4YCHA 1FENA 1T68X 1OBPA 1RBPA 3FELA 2LBAA 3RZYA 3EBKA 5D47A 3VG2A 1HN2A 4ES7A 1JYJA 1LFOA 1PMPA 4UU3A 1T0VA 3WXQA 3FMZA 3CQRA 1SXWA 4LZUA 4M6SA 1VYGA 5H9NA 1DZKA 2RA6A 1E00A 1CJ5A 3HWFA 1ADLA 4NLIA 4AZQA 1DFVA 2HMBA 2WUTA 4TQ2A 4YH0A 1ZNKA 4AW8A 1B8EA 4ZJ0A 2Q9SA 5HZ6A 3TGCA 1JJXA 2ANSA 1OEKA 4A60A 2JN3A 1QFTA 1UREA 2HLVA 4UU2A 4NP1A 3QKGA 2Q4NA 1JV4A 1LIDA 1X8UA 1P6PA 4O9SA 3B2LA 2N93A 2WQAE 3STNA 1GXAA 1L6MA
chains in the Genus database with same CATH superfamily
1SWPA 3KQ0A 2AVIA 3VHIA 1VWLB 1VYFA 3H3IA 4I3BA 4KT5A 4OEMA 1ZRYA 1SLGB 1UZ2X 4ZHCA 1HBPA 2RTQB 1SRGA 1NQNA 1QQSA 2DM5A 3WYQA 2RTDB 3ZQ3A 4U8UM 2KTDA 1SWFA 3FIDA 3P6HA 2G79A 2IZKA 4OS8A 3CMPA 3LTWA 2A2GA 3B2IA 2JU8A 1HQPA 1LIFA 1AB0A 2RCQA 2Q39A 3EW2A 4YDBA 3ZI8A 5IO7A 3VG7A 4TKBA 1ZNGA 3NQ3A 4ORXA 1GT1A 3P6FA 1SWJA 1BSYA 2BSZA 4CDFA 1MUPA 2P8GA 2X45A 1VWHB 2NNEA 1RLBE 2HYSA 4CPHA 4QZTA 5B10O 3CKFA 1SRJA 3WVMA 4ZHDA 1E02A 2GTLM 1WUBA 4GK9A 4Y0QA 1ICMA 1D3SA 1RXKA 4YKMA 4ZGUA 5D48A 1EUOA 4CV7A 3NP1A 1KL3A 3I0AA 5D4AA 1FJ1E 1PM1X 1NGLA 2FS6A 1Y9TA 2RTLA 5LJBA 1HXLA 1CBSA 2A8GA 2IZHB 3WJEA 1PBOA 1ZNLA 2G78A 2RTOB 1ICNA 2CM4A 2L67A 4N7CA 5F2BA 3APUA 3T2WA 4CK4A 1LUQA 1SWNA 5KICA 1LELA 4OMWA 4KC7A 3S5VA 4ZHHA 4GKCA 2FS7A 1VWPB 1SA8A 1WBIA 1S44A 3FA7A 1HXZA 1JYDA 5LJEA 3FW4A 1SLFB 2OL6O 4COTA 1O1UA 5BVTA 1A2DA 5HZ8A 4R0BA 4WFVA 2MO5A 5CYBA 3KFIA 2W2BA 3FA8A 3HPEA 2RTJA 2EU7X 1YP7A 1OEJA 1H91A 1OSPO 2IZBA 2A5CA 2IZJA 2WR6A 3BDRA 4IRWA 4EXZA 2OY1O 4CPEA 2A13A 1RXJA 1SWGA 4GH7A 1IJ8A 2FKGA 4ORRA 4XMFA 4GDAA 4CPHB 1SWLA 2LBVA 1KOIA 4MISA 4I9SA 4TNNA 3FR2A 1LPJA 1HMTA 1JMZA 2AT3X 1STSB 2IZLB 5F7GA 4DQ3A 3O19A 3O22A 3CBCA 3Q6LA 1ERBA 3WZQA 1OEEA 1MM9A 1AVEA 1XCAA 2FR2A 2MF6A 1LIBA 4OELA 2UYWA 1ML7A 4TLJA 3ZWEA 3S26A 2BLGA 4HPAA 1DF3A 4A1YA 2K23A 1QY0A 4QGVA 1HBQA 5DG4A 4DNEA 2CBRA 3PDFA 4WBKA 3P6CA 3FEPA 1VWIB 4O49A 4GGRA 4Z28A 3RDMA 3HWGA 4O4OA 4Z2PA 2AT0X 1MVGA 4ARHA 3F6ZB 3P02A 4GNYA 1STRB 1N43A 3T1DA 5F58A 2A0AA 1YWBA 4QGWA 1E2TA 4EDEA 2FWVA 1SY1A 2X4MA 2RTGB 1QY2A 2RTNB 3BS2A 1IKJA 1FTPA 2RTEB 3EM0A 3EW1A 3HK1A 3P24A 5C0NA 1NP4A 1QABE 2GTFX 3PEDA 4AZOA 1VYOA 1STPA 1X89A 1VWEB 2G7BA 2BS5A 2RTKA 2L9CA 3FA9A 3NADA 4U9CA 5HTEA 4INNA 1QWDA 3VG3A 3VHHA 1EIOA 5B27A 2BC3A 4CDEA 4IB7A 4K19A 1RAVA 3VPJE 2RTFB 1TOWA 4CSBA 3IFBA 2K62A 3I17A 5IO5A 1QG5A 4YKOA 2ZAIA 3APWA 5EEEA 3PPTA 1OPAA 2IZFB 5EDBA 4NLJA 1U18A 4XMHA 2FR3A 3FLLA 2XSTA 1Y52X 1SY0A 2OL7A 2QO6A 2X34A 3HTYA 3F8AA 3JS1A 1KT7A 5HZ9A 1KT4A 1W4TA 2F73A 1DZJA 1GGLA 5IXGA 2GJ5A 2LFOA 4U3QA 2IZDB 2QO5A 4FBRA 1IKEA 4BGFA 3WZNA 2DJFA 2WQ9A 1LDOA 4OMXA 1DZPA 3MX7A 1OBQA 4GUZA 1BLRA 5K06A 3SZJA 1E06A 1BSQA 2FT9A 4BVMA 1N7YA 2RTBB 1LCVA 4BJ8A 2JW1A 1ACDA 2WEXA 2MM3A 3GAQA 1VWBB 3JSQA 3UEUA 3PH6A 3DTQA 1I9HA 3ELXA 3KZAA 5IO6A 2BS6A 2GH7A 4GU8A 1SWKA 1DF8A 1MOYA 1NQMA 4M7MA 4OS0A 4Z27A 1FDQA 2MHDA 2CAMA 5CSEA 2JOZA 3BX7A 1X71A 4I60A 4DQ4A 1CBIA 3NPOA 1SWOA 3PECA 2AH7X 1AVDA 2AL0X 3T6LA 1RSUB 2G8CO 4YFRA 3C78X 1YUPA 4LZVA 3C77X 1GT3A 1BEBA 1RXHA 4CPFA 3FENA 5HZ5A 1SWHA 4ZGFA 1OBUA 3EMMA 4GE1A 3EBWA 1TVQA 4YGZA 1JJJA 2PI3O 4ID2A 1BRQA 4CDDA 2WWPA 2CZUA 3VE2A 1B4MA 1BM5A 2IZIA 5H9AA 1VWQB 1YWCA 3RY2A 5FENA 4U8UO 2RN4A 4ORYA 5K67A 5LJKA 1VWAB 3L4RA 2IZCB 1DC9A 4QRLA 2QM9A 1XKIA 3Q34A 2OVEA 4ZH6A 1TXLA 4O3ZA 3TF6A 5L8NA 4AZNA 1SWQA 3UEXA 1VWFB 2R74A 5AJBA 3SAOA 1SLEB 5LJCA 4ORSA 4HPDA 2PY1A 3T2XA 2AT5X 1U0XA 1QFVA 3WZPA 3FR5A 3WYPA 4FGIB 4IB8A 4O3XB 5BVQA 5L8OA 1KXOA 2AMMX 2OZQA 2QOSC 1JZUA 1SWBA 5CHKA 2DJGA 2ZAGA 1I06A 3D95A 5K68A 1GX8A 1X8PA 2GTLO 2WPUA 1ZNEA 1IFCA 2JGSA 3UEWA 5F1EA 1AQBA 2WEWA 2ASNX 1VWNB 3HWDA 1KL5A 3TGAA 3PQSA 2G5LA 1A3YA 1HMSA 4HWMA 5HBSA 5JR8A 1SWAA 2BT9A 5JD2A 1BRPA 1LCWA 1VPRA 1KFFA 1YWAA 4Y0PA 4IMNA 5FQ7E 5B2AO 1KQXA 1N9YA 2ACPX 3P6GA 2KD2A 4Y0SA 3VG5A 2X55A 3APVA 4YMYA 4HPCA 4KCAA 3MVFA 3X00A 1ZNDA 3C76X 2KT4B 2OYBO 2RTIB 1MEPA 1OPBA 4ODDA 5HTDA 4GD9A 1I04A 2C1SA 1T8VA 3AKMA 1W5RA 3ZUOA 4QZUA 5EPQA 2L5PA 4TKHA 1QY1A 1X8OA 3PP6A 1O1VA 4JHQA 4OS3A 4YCEA 5HA1A 3BU9A 4XMEA 2X8FA 3KFHA 4RUNA 5BVSA 1SY3A 3S5XA 5F6BA 3BU1A 5EEDA 4ZH9A 3ZW2A 3CWKA 5B5FA 2QO4A 3SLOA 3PK2A 5CE4A 5FFHA 3RE5A 2FHLA 4Y59A 4L3RA 2RD7C 3U9PC 2MWHA 1B0OA 2AKQA 3ZZVA 2WSJA 1TOUA 3WOVA 3NQ9A 3RDSA 2QOMA 1BWYA 1R0UA 2AT6X 4ZCBA 3BSZE 1SMPI 4AZPA 2VFCA 3NR3A 4QAEA 4JGLA 3FDCA 2W2FA 4MVLA 3STMX 4TJZA 4XMDA 1VWRB 2CZTA 1JQPA 2X8TA 1VWOB 5LJGA 4ALBA 3SOTA 1GT4A 1FELA 1Y55X 2A2UA 2YMSA 3APXA 3CQNA 5FAZA 1HQQA 1GT5A 2FLJA 4HFOA 1DV9A 2IFBA 5EZ2A 5HCEC 1DZMA 1LNMA 2X32A 1E5PA 4IABA 2NNQA 5LKFA 5LJHA 4U8UN 4GGTA 3RWXA 1IIUA 1KQWA 2F01A 2OY5O 4EFGA 3FEKA 4JNJA 2E4JA 1O8VA 4KC8A 4ORUA 4GETA 4XMCA 5IRAA 1BSOA 2OFBA 3HWEA 1BBPA 1GKAA 2A3FX 2RTPB 1G7NA 2L68A 3F9DA 3WBGA 3LV4A 4I9RA 3JQOA 2X8SA 3FW5A 1MX8A 4FQBB 1G74A 3ZW1A 3RDXA 4B55A 3K3LA 4O4SA 5D45A 4AYHA 4NV7A 1LDQA 5D8JA 3VG4A 4QYNA 4BQUA 1SRHA 2RQ0A 4XMGA 2W2AA 4O4XA 2Y3FA 4KH8A 1JIWI 1N9MA 5EDCA 3G7XA 2LA7A 2GTLN 1VWCB 2FRSA 5LKEA 4GRJA 1SY2A 2O62A 4YGGA 1Z24A 1FE3A 3N91A 1SXUA 4TQ2A 1Y53X 1ZNHA 3VU1A 4ZHGA 1EALA 2RTCB 3FYFA 3U03A 5AJCA 1SREA 2ACOA 1KT5A 1NC9A 1HY2A 1NBXA 1JMXA 3RDUA 2R56A 3AEHA 5DPQA 3S60A 5H9LA 5HCDC 1N0SA 2OVAA 1YP6A 1GX9A 1NP1A 1JBHA 3D4RA 1I4UA 4A8ZA 3NX2A 1RSTB 1KT6A 2AT8X 2XKLA 1AVGI 5HCCC 4YBUA 3AKNA 3D9WA 4BX6A 1A57A 1N4JA 1FEMA 1I05A 1IW2A 1SWCA 3ELZA 4I3DA 3RBYA 1LICA 2Q2PA 1GKAB 1KGLA 2CM9A 1GM6A 2HNXA 2M4LA 1U17A 1UYNX 1ERXA 2FGSA 2RTMA 1KT3A 4QYPA 2NP1A 4PSQA 2X46A 3KFGA 3ZW1B 1HMRA 1MK5A 4TKJA 4BOEA 3ZUIA 3BRNA 1CBQA 4GZVA 1IFBA 4A1HA 2Y32A 5KHPA 1VWKB 1PEEA 2OFRX 1I78A 2R73A 4C5PA 4D6AA 2HZQA 1LF7A 1GX3A 2QCBA 4NNTA 4YFQA 3P6EA 5H9KA 1AELA 1KZXA 3IA8A 4KIIA 4NV8A 3TZSA 3RE6A 2ALLX 1SXXA 4NYQA 4O3YA 3P6DA 5LJDA 4EQAC 1EXSA 1Y9LA 1EI5A 3FR4A 4NW4A 3EC5A 5B29A 1VWJB 3NX1A 2RTAA 4MEEA 5HA0A 4LQZA 2UZ2A 3OJYC 4GJVA 4L1NA 2LKKA 1KL4A 2BHVA 2Z4IA 3HOLA 4N7DA 1EQDA 1CRBA 3V8UA 2OFAA 2I5ZO 4Y0RA 2RTRB 3RDOA 1MDCA 3BLGA 1K24A 3KVNA 3BX8A 5HZQA 3BY0A 1TW4A 1S2PA 2RCTA 2YG2A 4O3WA 3OBLA 4I95A 3NQKA 4AZMA 4BX6B 2JU3A 2QMIA 4D6BA 3QQ2A 2FKJA 1D2UA 2KTSA 5KIDA 4GNWA 1NDJA 2VFBA 2IZAA 4ML7B 1PBYA 2C1QA 4ZFXA 3MG5A 2HKDA 3DSZA 1SRFA 1VWGB 3O2YA 5FQ6E 1K3BA 2JU7A 3RSWA 3VE1A 3WJCA 4IAXA 3FIQA 3WJFA 2RTHB 1CBRA 4QGXA 5H8TA 2HZRA 3MBTA 4IAWA 4CPIA 4IMOA 4Z6JA 1EIIA 4ORWA 1SRIA 4IBAA 2FTBA 3SLJA 1Y0GA 4ZHFA 3B2HA 4YDAA 4MVIA 2AF5A 3U0DA 1LIEA 3VG6A 3FA6A 1SXYA 4QNIA 3B2KA 3UAQA 2C4IA 3PH5A 4WHIA 3D96A 3EYCA 4RUUA 4ZR2A 1MX7A 3MM0A 5HWZA 1YIVA 3OD9A 4JO6A 1CJ5A 3TGBA 5B3MO 3T6FA 1ALBA 1SWSA 1S7DA 3WZOA 2OVSA 2POAA 2IZEB 2CBSA 3VGWA 4AZRA 3SLTA 3RKGA 4EEJA 4OKAA 1SWTA 3LHNA 4PJ2A 4FBVA 5B11O 1G85A 2LB6A 1VWMB 2MJIA 2OF8A 2OF9A 4MVEA 4NNSA 4YGHA 4EKVA 2NNDA 4LKTA 3ZW0A 1BJ7A 4BX5A 2Q2MA 1X8QA 4O4UA 1LCZA 4NYRA 4IB9A 4YFPA 3WJGA 5F6ZA 1EPBA 3CBSA 5L8IA 3WJBA 4Z2VA 1KZWA 4U46A 5AQ6A 5IRWA 3PQUA 4BCSA 2OFMX 4IB6A 1PTSA 3B2JA 4YBPA 2ZSCA 1SWRA 2OVDA 4GDZA 4HPBA 1EPAA 4I3CA 2FHNX 4DCBA 1X8NA 2KW1A 1SWEA 2Z4HA 5HAEA 3CR6A 4WFUA 4I6SA 4LKPA 5IRUA 4BX7A 5AEOA 1B56A 4MVKA 3UEVA 4QQ1A 3D97A 5L3YA 2Y3EA 2GC9A 1LKEA 4MIRA 3WJDA 2IZGB 2A5BA 3GE2A 4ALOA 2VDFA 1SWUA 3KFFA 1A18A 1YWDA 3AUMO 2X56A 5FQ8E 4CDCA 1EW3A 2I5VO 3STKA 4YCHA 1FENA 1T68X 1OBPA 1RBPA 4GGZA 3SZHA 3FELA 2LBAA 3RZYA 1JJUA 3EBKA 3OE3A 1HN2A 5D47A 2OY7A 3VG2A 3VHMA 4ES7A 1JYJA 4Z2OA 1LFOA 1PMPA 4UU3A 3RY1A 3NBXX 4Y5DA 1T0VA 3WXQA 4YVBA 3FMZA 2JMBA 3CQRA 1SXWA 4LZUA 3ZW0B 4BX5B 4M6SA 1VYGA 5H9NA 1DZKA 2RA6A 1E00A 3CKGA 3HWFA 4FBOA 1ADLA 4NLIA 4AZQA 1DFVA 2HMBA 2WUTA 4BBOA 4YH0A 1ZNKA 4AW8A 1B8EA 4ZJ0A 2Q9SA 5HZ6A 3TGCA 1JJXA 2ANSA 2OL8O 1G5WA 1W6FA 5BYPA 1OEKA 1SLDB 4A60A 2JN3A 1QFTA 1VWDB 1UREA 2HLVA 4UU2A 3E3CA 3RDQA 4GJSA 4NP1A 5B5GA 3QKGA 2Q4NA 4BX7B 3HOEA 1JV4A 1LIDA 2F09A 2OY8A 1X8UA 1P6PA 4O9SA 4ON1A 3SZIA 3B2LA 2N93A 2WQAE 1UYOX 3STNA 1SWDA 1GXAA 1L6MA
chains in the Genus database with same CATH topology
3KQ0A 1VYFA 3H3IA 4I3BA 4KT5A 1ZRYA 1UZ2X 4ZHCA 1HBPA 1QQSA 2DM5A 3ZQ3A 4U8UM 2KTDA 3P6HA 2G79A 4OS8A 3CMPA 2A2GA 3B2IA 2JU8A 1HQPA 1LIFA 1AB0A 2RCQA 2Q39A 4YDBA 3ZI8A 5IO7A 3VG7A 4TKBA 1ZNGA 3NQ3A 4ORXA 1GT1A 3P6FA 1BSYA 1MUPA 2P8GA 2X45A 2NNEA 1RLBE 2HYSA 4QZTA 3WVMA 4ZHDA 1E02A 2GTLM 4GK9A 4Y0QA 4ZGUA 1ICMA 1D3SA 4YKMA 5D48A 1EUOA 4CV7A 3NP1A 3I0AA 5D4AA 1PM1X 1NGLA 2FS6A 1Y9TA 5LJBA 1CBSA 3WJEA 1PBOA 1ZNLA 2G78A 1ICNA 2CM4A 2L67A 4N7CA 3APUA 4CK4A 5KICA 4OMWA 3S5VA 4KC7A 4ZHHA 4GKCA 2FS7A 1SA8A 1S44A 3FA7A 1JYDA 5LJEA 3FW4A 4COTA 1O1UA 5BVTA 1A2DA 5HZ8A 4R0BA 4WFVA 2MO5A 5CYBA 3KFIA 2W2BA 3FA8A 2EU7X 1YP7A 1OEJA 1H91A 2WR6A 4D6AA 3BDRA 4EXZA 2A13A 4GH7A 4ORRA 4XMFA 2LBVA 1KOIA 4MISA 4I9SA 4TNNA 3FR2A 1LPJA 1HMTA 5F7GA 2AT3X 4DQ3A 3O19A 3O22A 3CBCA 3Q6LA 1ERBA 1OEEA 1XCAA 2FR2A 1LIBA 4TLJA 3ZWEA 1ML7A 3S26A 2BLGA 4HPAA 1DF3A 4A1YA 2K23A 1QY0A 4QGVA 1HBQA 5DG4A 2CBRA 4WBKA 3P6CA 3FEPA 4O49A 3HWGA 4O4OA 2AT0X 1MVGA 4ARHA 3F6ZB 3P02A 4GNYA 3T1DA 5F58A 2A0AA 1YWBA 4QGWA 4EDEA 2FWVA 1SY1A 1QY2A 3BS2A 1IKJA 1FTPA 3HK1A 3EM0A 5C0NA 3P24A 1NP4A 1QABE 2GTFX 3PEDA 4AZOA 3NADA 1X89A 2G7BA 3FA9A 2BS5A 4U9CA 2L9CA 5HTEA 3VG3A 1EIOA 4INNA 1QWDA 5B27A 4IB7A 4K19A 3VPJE 1TOWA 4CSBA 3IFBA 2K62A 3I17A 5IO5A 1QG5A 4YKOA 2ZAIA 3APWA 5EEEA 3PPTA 1OPAA 5EDBA 4NLJA 1U18A 4XMHA 2FR3A 3FLLA 2XSTA 1SY0A 2QO6A 3HTYA 3JS1A 3F8AA 5HZ9A 1KT7A 1KT4A 2F73A 1DZJA 1GGLA 2GJ5A 2LFOA 4U3QA 4FBRA 2QO5A 1IKEA 2WQ9A 4OMXA 1DZPA 3MX7A 1OBQA 1BLRA 5K06A 1E06A 1BSQA 2FT9A 4BVMA 1G5WA 2JW1A 1ACDA 2WEXA 2MM3A 3GAQA 3JSQA 3UEUA 3PH6A 3DTQA 3KZAA 3ELXA 5IO6A 2BS6A 4GU8A 4M7MA 4OS0A 1FDQA 2MHDA 2JOZA 3BX7A 1X71A 4DQ4A 1CBIA 3NPOA 2AH7X 3PECA 2AL0X 4YFRA 3C78X 1YUPA 4LZVA 3C77X 1GT3A 1BEBA 3FENA 5HZ5A 4ZGFA 1OBUA 3EMMA 4GE1A 3EBWA 1TVQA 4YGZA 1JJJA 4ID2A 1BRQA 2WWPA 2CZUA 3VE2A 1B4MA 1BM5A 5H9AA 5FENA 1YWCA 4U8UO 2RN4A 4ORYA 5LJKA 3L4RA 4A1HA 1DC9A 4QRLA 2QM9A 1XKIA 4ZH6A 2OVEA 3TF6A 1TXLA 4O3ZA 5L8NA 4AZNA 3UEXA 2R74A 5AJBA 3SAOA 5LJCA 4ORSA 4HPDA 2PY1A 2AT5X 1U0XA 1QFVA 3FR5A 4FGIB 4IB8A 4O3XB 5BVQA 5L8OA 1KXOA 2AMMX 2OZQA 2QOSC 1JZUA 2ZAGA 1I06A 3D95A 1GX8A 1X8PA 2GTLO 1ZNEA 1IFCA 3UEWA 5F1EA 1AQBA 2WEWA 2ASNX 3HWDA 3TGAA 3PQSA 1A3YA 1HMSA 4HWMA 5HBSA 5JR8A 2BT9A 1BRPA 1VPRA 1YWAA 4Y0PA 4IMNA 5FQ7E 1KQXA 2ACPX 3P6GA 2KD2A 4Y0SA 3VG5A 3APVA 4YMYA 4HPCA 4KCAA 3MVFA 1ZNDA 3C76X 2KT4B 1OPBA 4ODDA 5HTDA 1I04A 1T8VA 3AKMA 3ZUOA 4QZUA 5EPQA 2L5PA 4TKHA 1QY1A 1X8OA 3PP6A 1O1VA 4OS3A 4YCEA 5HA1A 3BU9A 4XMEA 2X8FA 3KFHA 4RUNA 5BVSA 1SY3A 3S5XA 5F6BA 3BU1A 5EEDA 4ZH9A 3ZW2A 3CWKA 2QO4A 5CE4A 5FFHA 4L3RA 2RD7C 3U9PC 2MWHA 1B0OA 2AKQA 3ZZVA 2WSJA 1TOUA 3WOVA 3NQ9A 1BWYA 1R0UA 2AT6X 4ZCBA 3BSZE 1SMPI 4AZPA 3NR3A 4QAEA 4JGLA 2W2FA 4MVLA 3STMX 4TJZA 4XMDA 2CZTA 5LJGA 2X8TA 4ALBA 3SOTA 1GT4A 1FELA 2A2UA 2YMSA 5FAZA 3APXA 3CQNA 1GT5A 2FLJA 4HFOA 1DV9A 2IFBA 5EZ2A 5HCEC 1DZMA 1LNMA 1E5PA 4IABA 2NNQA 5LKFA 5LJHA 4U8UN 3RWXA 1IIUA 1KQWA 4EFGA 3FEKA 2E4JA 1O8VA 4KC8A 4ORUA 4GETA 4XMCA 1BSOA 3HWEA 1BBPA 1GKAA 2A3FX 1G7NA 2L68A 3F9DA 3WBGA 3LV4A 4I9RA 3JQOA 2X8SA 3FW5A 1MX8A 4FQBB 1G74A 3ZW1A 3K3LA 4O4SA 5D45A 4AYHA 3VG4A 5D8JA 4BQUA 4QYNA 2RQ0A 4XMGA 2W2AA 4O4XA 4KH8A 1JIWI 5EDCA 3G7XA 2LA7A 2GTLN 2FRSA 5LKEA 4GRJA 1SY2A 2O62A 4YGGA 1Z24A 1FE3A 3N91A 1SXUA 1ZNHA 3VU1A 4ZHGA 1EALA 3FYFA 3U03A 5AJCA 2ACOA 1KT5A 2R56A 5DPQA 3S60A 5H9LA 5HCDC 1N0SA 2OVAA 1YP6A 1GX9A 1NP1A 1JBHA 3D4RA 1I4UA 4A8ZA 3NX2A 1KT6A 2AT8X 2XKLA 1AVGI 4YBUA 3AKNA 1A57A 1FEMA 1I05A 1IW2A 3ELZA 4I3DA 3RBYA 1LICA 2Q2PA 1GKAB 1KGLA 2M4LA 2CM9A 1GM6A 2HNXA 1U17A 1ERXA 4QYPA 1KT3A 2NP1A 4PSQA 2X46A 3KFGA 3ZW1B 1HMRA 4TKJA 4BOEA 3ZUIA 3BRNA 1CBQA 4GZVA 1IFBA 5KHPA 1PEEA 2OFRX 2R73A 2HZQA 1LF7A 4NNTA 4YFQA 3P6EA 5H9KA 1AELA 1KZXA 3IA8A 4KIIA 3TZSA 2ALLX 1SXXA 4NYQA 4O3YA 3P6DA 5LJDA 4EQAC 1EXSA 1Y9LA 1EI5A 3FR4A 4NW4A 5B29A 3NX1A 5HA0A 4LQZA 4L1NA 3OJYC 2LKKA 3HOLA 2BHVA 2Z4IA 4N7DA 3V8UA 1EQDA 1CRBA 4Y0RA 1MDCA 3BLGA 5HZQA 3BX8A 3BY0A 1TW4A 1S2PA 2RCTA 2YG2A 4O3WA 3OBLA 4I95A 3NQKA 4AZMA 2JU3A 2QMIA 4D6BA 1D2UA 2KTSA 5KIDA 4GNWA 4ML7B 4ZFXA 3DSZA 5FQ6E 3RSWA 3O2YA 2JU7A 3WJCA 3VE1A 4IAXA 3FIQA 3WJFA 1CBRA 4QGXA 5H8TA 2HZRA 3MBTA 4IAWA 1EIIA 4IMOA 4ORWA 4IBAA 2FTBA 4ZHFA 3B2HA 4YDAA 4MVIA 3U0DA 1LIEA 3VG6A 3FA6A 1SXYA 4QNIA 3B2KA 3UAQA 3PH5A 4WHIA 3D96A 3EYCA 4RUUA 4ZR2A 1MX7A 5HWZA 1YIVA 3OD9A 3TGBA 1ALBA 1S7DA 2OVSA 2POAA 2CBSA 4AZRA 3RKGA 4EEJA 3LHNA 4PJ2A 5HCCC 4FBVA 1G85A 2LB6A 2MJIA 4MVEA 4NNSA 4YGHA 2NNDA 4LKTA 3ZW0A 1BJ7A 2Q2MA 1X8QA 4O4UA 4NYRA 4IB9A 4YFPA 3WJGA 5F6ZA 1EPBA 3CBSA 5L8IA 3WJBA 1KZWA 5AQ6A 3PQUA 2OFMX 4IB6A 3B2JA 4YBPA 4GDZA 2OVDA 4HPBA 1EPAA 4I3CA 1X8NA 2KW1A 2Z4HA 5HAEA 3CR6A 4WFUA 4I6SA 4LKPA 5AEOA 1B56A 4MVKA 3UEVA 4QQ1A 3D97A 2GC9A 1LKEA 4MIRA 3WJDA 3GE2A 4ALOA 3KFFA 1A18A 1YWDA 5FQ8E 1EW3A 3STKA 4YCHA 1FENA 1T68X 1OBPA 1RBPA 3FELA 2LBAA 3RZYA 3EBKA 5D47A 3OE3A 1HN2A 3VG2A 4ES7A 1JYJA 1LFOA 1PMPA 4UU3A 3NBXX 1T0VA 3WXQA 3FMZA 2JMBA 3CQRA 1SXWA 4LZUA 3ZW0B 4M6SA 1VYGA 5H9NA 1DZKA 2RA6A 1E00A 4FBOA 3HWFA 1CJ5A 1ADLA 4NLIA 4AZQA 1DFVA 2HMBA 2WUTA 4TQ2A 4YH0A 1ZNKA 4AW8A 1B8EA 4ZJ0A 2Q9SA 5HZ6A 3TGCA 1JJXA 2ANSA 5BYPA 1OEKA 4A60A 2JN3A 1QFTA 1UREA 2HLVA 4UU2A 3E3CA 4NP1A 3QKGA 2Q4NA 3HOEA 1JV4A 1LIDA 2F09A 1X8UA 1P6PA 4O9SA 4ON1A 3B2LA 2N93A 2WQAE 3STNA 1GXAA 1L6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQ0 A;  1VYF A;  4I3B A;  1ZRY A;  1UZ2 X;  4ZHC A;  1HBP A;  1QQS A;  2DM5 A;  3ZQ3 A;  2KTD A;  3P6H A;  2G79 A;  4OS8 A;  3CMP A;  2A2G A;  3B2I A;  2JU8 A;  1HQP A;  1LIF A;  1AB0 A;  2RCQ A;  2Q39 A;  4YDB A;  5IO7 A;  3VG7 A;  4TKB A;  1ZNG A;  3NQ3 A;  4ORX A;  1GT1 A;  3P6F A;  1BSY A;  1MUP A;  2P8G A;  2X45 A;  2NNE A;  1RLB E;  2HYS A;  4QZT A;  3WVM A;  4ZHD A;  1E02 A;  4Y0Q A;  4ZGU A;  1ICM A;  1D3S A;  4YKM A;  5D48 A;  1EUO A;  3NP1 A;  3I0A A;  5D4A A;  1PM1 X;  1NGL A;  2FS6 A;  5LJB A;  1CBS A;  3WJE A;  1PBO A;  1ZNL A;  2G78 A;  1ICN A;  2CM4 A;  2L67 A;  4N7C A;  3APU A;  4CK4 A;  5KIC A;  4OMW A;  4ZHH A;  4GKC A;  2FS7 A;  1SA8 A;  1S44 A;  3FA7 A;  1JYD A;  5LJE A;  3FW4 A;  1O1U A;  5BVT A;  1A2D A;  5HZ8 A;  4R0B A;  4WFV A;  2MO5 A;  3KFI A;  2W2B A;  3FA8 A;  2EU7 X;  1YP7 A;  1OEJ A;  1H91 A;  2WR6 A;  4D6A A;  3BDR A;  4EXZ A;  2A13 A;  4GH7 A;  4ORR A;  4XMF A;  2LBV A;  1KOI A;  4TNN A;  4I9S A;  3FR2 A;  1LPJ A;  1HMT A;  5F7G A;  2AT3 X;  4DQ3 A;  3O19 A;  3O22 A;  3CBC A;  3Q6L A;  1ERB A;  1OEE A;  1XCA A;  2FR2 A;  1LIB A;  4TLJ A;  1ML7 A;  3S26 A;  2BLG A;  4HPA A;  1DF3 A;  4A1Y A;  2K23 A;  1QY0 A;  4QGV A;  1HBQ A;  5DG4 A;  2CBR A;  4WBK A;  3P6C A;  3FEP A;  3HWG A;  2AT0 X;  1MVG A;  4ARH A;  4GNY A;  3T1D A;  5F58 A;  2A0A A;  1YWB A;  4QGW A;  4EDE A;  2FWV A;  1SY1 A;  1QY2 A;  3BS2 A;  1IKJ A;  1FTP A;  3HK1 A;  3EM0 A;  5C0N A;  1NP4 A;  1QAB E;  2GTF X;  3PED A;  4AZO A;  3NAD A;  1X89 A;  2G7B A;  3FA9 A;  5HTE A;  2L9C A;  1EIO A;  3VG3 A;  1QWD A;  5B27 A;  4IB7 A;  4K19 A;  1TOW A;  3IFB A;  2K62 A;  3I17 A;  5IO5 A;  1QG5 A;  4YKO A;  3APW A;  5EEE A;  3PPT A;  1OPA A;  5EDB A;  4NLJ A;  1U18 A;  4XMH A;  2FR3 A;  3FLL A;  2XST A;  1SY0 A;  2QO6 A;  3JS1 A;  5HZ9 A;  3F8A A;  1KT7 A;  1KT4 A;  2F73 A;  1DZJ A;  1GGL A;  2GJ5 A;  2LFO A;  2QO5 A;  1IKE A;  2WQ9 A;  4OMX A;  1DZP A;  1OBQ A;  1BLR A;  5K06 A;  1E06 A;  1BSQ A;  2FT9 A;  4BVM A;  1G5W A;  1ACD A;  2WEX A;  2MM3 A;  3GAQ A;  3JSQ A;  3UEU A;  3PH6 A;  3DTQ A;  3KZA A;  3ELX A;  5IO6 A;  4M7M A;  4OS0 A;  1FDQ A;  2JOZ A;  3BX7 A;  1X71 A;  4DQ4 A;  1CBI A;  3NPO A;  2AH7 X;  3PEC A;  2AL0 X;  4YFR A;  3C78 X;  1YUP A;  4LZV A;  3C77 X;  1GT3 A;  1BEB A;  3FEN A;  5HZ5 A;  1OBU A;  3EMM A;  4GE1 A;  3EBW A;  1TVQ A;  4YGZ A;  1JJJ A;  1BRQ A;  2WWP A;  2CZU A;  1B4M A;  1BM5 A;  5H9A A;  5FEN A;  1YWC A;  4ORY A;  5LJK A;  3L4R A;  4A1H A;  1DC9 A;  4ZH6 A;  2QM9 A;  1XKI A;  3TF6 A;  2OVE A;  5L8N A;  1TXL A;  4AZN A;  3UEX A;  2R74 A;  3SAO A;  5LJC A;  4ORS A;  4HPD A;  2PY1 A;  2AT5 X;  1U0X A;  1QFV A;  3FR5 A;  4IB8 A;  1JZU A;  5BVQ A;  5L8O A;  1KXO A;  2AMM X;  2OZQ A;  2QOS C;  1I06 A;  3D95 A;  1GX8 A;  1X8P A;  1ZNE A;  1IFC A;  3UEW A;  5F1E A;  1AQB A;  2WEW A;  2ASN X;  3HWD A;  3TGA A;  1A3Y A;  1HMS A;  5HBS A;  5JR8 A;  1BRP A;  1VPR A;  1YWA A;  4Y0P A;  4IMN A;  1KQX A;  2ACP X;  3P6G A;  4Y0S A;  3VG5 A;  3APV A;  4YMY A;  4HPC A;  3MVF A;  1ZND A;  3C76 X;  2KT4 B;  1OPB A;  4ODD A;  5HTD A;  1I04 A;  1T8V A;  3AKM A;  3ZUO A;  4QZU A;  5EPQ A;  2L5P A;  4TKH A;  1QY1 A;  1X8O A;  3PP6 A;  1O1V A;  4OS3 A;  4YCE A;  5HA1 A;  3BU9 A;  4XME A;  3KFH A;  4RUN A;  5BVS A;  1SY3 A;  5F6B A;  3BU1 A;  5EED A;  4ZH9 A;  3CWK A;  2QO4 A;  5CE4 A;  5FFH A;  2RD7 C;  3U9P C;  1B0O A;  2AKQ A;  2WSJ A;  1TOU A;  3NQ9 A;  1BWY A;  1R0U A;  2AT6 X;  4ZCB A;  3BSZ E;  4AZP A;  3NR3 A;  4QAE A;  2W2F A;  4MVL A;  3STM X;  4TJZ A;  4XMD A;  2CZT A;  5LJG A;  4ALB A;  1GT4 A;  1FEL A;  2A2U A;  5FAZ A;  3APX A;  3CQN A;  1GT5 A;  2FLJ A;  4HFO A;  1DV9 A;  2IFB A;  5EZ2 A;  5HCE C;  1DZM A;  1LNM A;  1E5P A;  2NNQ A;  5LKF A;  5LJH A;  1IIU A;  1KQW A;  4EFG A;  3FEK A;  2E4J A;  1O8V A;  4ORU A;  4GET A;  4XMC A;  1BSO A;  3HWE A;  1BBP A;  1GKA A;  2A3F X;  1G7N A;  2L68 A;  3F9D A;  3WBG A;  4I9R A;  3FW5 A;  1MX8 A;  1G74 A;  3K3L A;  5D45 A;  4AYH A;  3VG4 A;  5D8J A;  4BQU A;  4QYN A;  2RQ0 A;  4XMG A;  2W2A A;  5EDC A;  3G7X A;  2FRS A;  5LKE A;  4GRJ A;  1SY2 A;  2O62 A;  4YGG A;  1Z24 A;  1FE3 A;  1SXU A;  1ZNH A;  4ZHG A;  1EAL A;  3U03 A;  2ACO A;  1KT5 A;  2R56 A;  5DPQ A;  5H9L A;  5HCD C;  1N0S A;  2OVA A;  1YP6 A;  1GX9 A;  1NP1 A;  1JBH A;  1I4U A;  4A8Z A;  3NX2 A;  1KT6 A;  2AT8 X;  2XKL A;  1AVG I;  4YBU A;  3AKN A;  1A57 A;  1FEM A;  1I05 A;  1IW2 A;  3ELZ A;  4I3D A;  1LIC A;  2Q2P A;  1GKA B;  1KGL A;  2CM9 A;  1GM6 A;  2HNX A;  1U17 A;  1ERX A;  4QYP A;  1KT3 A;  2NP1 A;  4PSQ A;  2X46 A;  3KFG A;  1HMR A;  4TKJ A;  4BOE A;  3ZUI A;  3BRN A;  1CBQ A;  1IFB A;  5KHP A;  1PEE A;  2OFR X;  2R73 A;  2HZQ A;  1LF7 A;  4NNT A;  4YFQ A;  3P6E A;  5H9K A;  1AEL A;  1KZX A;  3IA8 A;  4KII A;  3TZS A;  2ALL X;  1SXX A;  4NYQ A;  3P6D A;  5LJD A;  1EXS A;  3FR4 A;  5B29 A;  3NX1 A;  5HA0 A;  3OJY C;  2LKK A;  4N7D A;  1EQD A;  1CRB A;  4Y0R A;  1MDC A;  3BLG A;  5HZQ A;  3BX8 A;  3BY0 A;  1TW4 A;  1S2P A;  2RCT A;  2YG2 A;  4AZM A;  2JU3 A;  4D6B A;  1D2U A;  5KID A;  4GNW A;  4ZFX A;  3DSZ A;  3RSW A;  3O2Y A;  2JU7 A;  3WJC A;  4IAX A;  3FIQ A;  3WJF A;  1CBR A;  4QGX A;  5H8T A;  2HZR A;  3MBT A;  4IAW A;  1EII A;  4IMO A;  4ORW A;  4IBA A;  2FTB A;  4ZHF A;  3B2H A;  4YDA A;  4MVI A;  3U0D A;  1LIE A;  3VG6 A;  3FA6 A;  1SXY A;  3B2K A;  3PH5 A;  3D96 A;  3EYC A;  4RUU A;  4ZR2 A;  1MX7 A;  5HWZ A;  1YIV A;  3TGB A;  1ALB A;  1S7D A;  2POA A;  2CBS A;  4AZR A;  4EEJ A;  5HCC C;  1G85 A;  2LB6 A;  2MJI A;  4NNS A;  4YGH A;  2NND A;  4LKT A;  1BJ7 A;  2Q2M A;  1X8Q A;  4NYR A;  4IB9 A;  4YFP A;  3WJG A;  5F6Z A;  1EPB A;  3CBS A;  5L8I A;  3WJB A;  1KZW A;  5AQ6 A;  2OFM X;  4IB6 A;  3B2J A;  4YBP A;  2OVD A;  4HPB A;  1EPA A;  4I3C A;  1X8N A;  5HAE A;  3CR6 A;  4WFU A;  4LKP A;  1B56 A;  4MVK A;  3UEV A;  3D97 A;  2GC9 A;  1LKE A;  3WJD A;  4ALO A;  3KFF A;  1A18 A;  1YWD A;  1EW3 A;  3STK A;  4YCH A;  1FEN A;  1T68 X;  1OBP A;  1RBP A;  3FEL A;  2LBA A;  3RZY A;  3EBK A;  5D47 A;  3VG2 A;  1HN2 A;  4ES7 A;  1JYJ A;  1LFO A;  1PMP A;  4UU3 A;  1T0V A;  3WXQ A;  3FMZ A;  3CQR A;  1SXW A;  4LZU A;  4M6S A;  1VYG A;  5H9N A;  1DZK A;  2RA6 A;  1E00 A;  1CJ5 A;  3HWF A;  1ADL A;  4NLI A;  4AZQ A;  1DFV A;  2HMB A;  2WUT A;  4TQ2 A;  4YH0 A;  1ZNK A;  4AW8 A;  1B8E A;  4ZJ0 A;  2Q9S A;  5HZ6 A;  3TGC A;  1JJX A;  2ANS A;  1OEK A;  4A60 A;  2JN3 A;  1QFT A;  1URE A;  2HLV A;  4UU2 A;  4NP1 A;  3QKG A;  2Q4N A;  1JV4 A;  1LID A;  1X8U A;  1P6P A;  4O9S A;  3B2L A;  2N93 A;  2WQA E;  3STN A;  1GXA A;  1L6M A; 
#chains in the Genus database with same CATH topology
 1SWP A;  3KQ0 A;  2AVI A;  3VHI A;  1VWL B;  1VYF A;  3H3I A;  4I3B A;  4KT5 A;  4OEM A;  1ZRY A;  1SLG B;  1UZ2 X;  4ZHC A;  1HBP A;  2RTQ B;  1SRG A;  1NQN A;  1QQS A;  2DM5 A;  3WYQ A;  2RTD B;  3ZQ3 A;  4U8U M;  2KTD A;  1SWF A;  3FID A;  3P6H A;  2G79 A;  2IZK A;  4OS8 A;  3CMP A;  3LTW A;  2A2G A;  3B2I A;  2JU8 A;  1HQP A;  1LIF A;  1AB0 A;  2RCQ A;  2Q39 A;  3EW2 A;  4YDB A;  3ZI8 A;  5IO7 A;  3VG7 A;  4TKB A;  1ZNG A;  3NQ3 A;  4ORX A;  1GT1 A;  3P6F A;  1SWJ A;  1BSY A;  2BSZ A;  4CDF A;  1MUP A;  2P8G A;  2X45 A;  1VWH B;  2NNE A;  1RLB E;  2HYS A;  4CPH A;  4QZT A;  5B10 O;  3CKF A;  1SRJ A;  3WVM A;  4ZHD A;  1E02 A;  2GTL M;  1WUB A;  4GK9 A;  4Y0Q A;  1ICM A;  1D3S A;  1RXK A;  4YKM A;  4ZGU A;  5D48 A;  1EUO A;  4CV7 A;  3NP1 A;  1KL3 A;  3I0A A;  5D4A A;  1FJ1 E;  1PM1 X;  1NGL A;  2FS6 A;  1Y9T A;  2RTL A;  5LJB A;  1HXL A;  1CBS A;  2A8G A;  2IZH B;  3WJE A;  1PBO A;  1ZNL A;  2G78 A;  2RTO B;  1ICN A;  2CM4 A;  2L67 A;  4N7C A;  5F2B A;  3APU A;  3T2W A;  4CK4 A;  1LUQ A;  1SWN A;  5KIC A;  1LEL A;  4OMW A;  4KC7 A;  3S5V A;  4ZHH A;  4GKC A;  2FS7 A;  1VWP B;  1SA8 A;  1WBI A;  1S44 A;  3FA7 A;  1HXZ A;  1JYD A;  5LJE A;  3FW4 A;  1SLF B;  2OL6 O;  4COT A;  1O1U A;  5BVT A;  1A2D A;  5HZ8 A;  4R0B A;  4WFV A;  2MO5 A;  5CYB A;  3KFI A;  2W2B A;  3FA8 A;  3HPE A;  2RTJ A;  2EU7 X;  1YP7 A;  1OEJ A;  1H91 A;  1OSP O;  2IZB A;  2A5C A;  2IZJ A;  2WR6 A;  3BDR A;  4IRW A;  4EXZ A;  2OY1 O;  4CPE A;  2A13 A;  1RXJ A;  1SWG A;  4GH7 A;  1IJ8 A;  2FKG A;  4ORR A;  4XMF A;  4GDA A;  4CPH B;  1SWL A;  2LBV A;  1KOI A;  4MIS A;  4I9S A;  4TNN A;  3FR2 A;  1LPJ A;  1HMT A;  1JMZ A;  2AT3 X;  1STS B;  2IZL B;  5F7G A;  4DQ3 A;  3O19 A;  3O22 A;  3CBC A;  3Q6L A;  1ERB A;  3WZQ A;  1OEE A;  1MM9 A;  1AVE A;  1XCA A;  2FR2 A;  2MF6 A;  1LIB A;  4OEL A;  2UYW A;  1ML7 A;  4TLJ A;  3ZWE A;  3S26 A;  2BLG A;  4HPA A;  1DF3 A;  4A1Y A;  2K23 A;  1QY0 A;  4QGV A;  1HBQ A;  5DG4 A;  4DNE A;  2CBR A;  3PDF A;  4WBK A;  3P6C A;  3FEP A;  1VWI B;  4O49 A;  4GGR A;  4Z28 A;  3RDM A;  3HWG A;  4O4O A;  4Z2P A;  2AT0 X;  1MVG A;  4ARH A;  3F6Z B;  3P02 A;  4GNY A;  1STR B;  1N43 A;  3T1D A;  5F58 A;  2A0A A;  1YWB A;  4QGW A;  1E2T A;  4EDE A;  2FWV A;  1SY1 A;  2X4M A;  2RTG B;  1QY2 A;  2RTN B;  3BS2 A;  1IKJ A;  1FTP A;  2RTE B;  3EM0 A;  3EW1 A;  3HK1 A;  3P24 A;  5C0N A;  1NP4 A;  1QAB E;  2GTF X;  3PED A;  4AZO A;  1VYO A;  1STP A;  1X89 A;  1VWE B;  2G7B A;  2BS5 A;  2RTK A;  2L9C A;  3FA9 A;  3NAD A;  4U9C A;  5HTE A;  4INN A;  1QWD A;  3VG3 A;  3VHH A;  1EIO A;  5B27 A;  2BC3 A;  4CDE A;  4IB7 A;  4K19 A;  1RAV A;  3VPJ E;  2RTF B;  1TOW A;  4CSB A;  3IFB A;  2K62 A;  3I17 A;  5IO5 A;  1QG5 A;  4YKO A;  2ZAI A;  3APW A;  5EEE A;  3PPT A;  1OPA A;  2IZF B;  5EDB A;  4NLJ A;  1U18 A;  4XMH A;  2FR3 A;  3FLL A;  2XST A;  1Y52 X;  1SY0 A;  2OL7 A;  2QO6 A;  2X34 A;  3HTY A;  3F8A A;  3JS1 A;  1KT7 A;  5HZ9 A;  1KT4 A;  1W4T A;  2F73 A;  1DZJ A;  1GGL A;  5IXG A;  2GJ5 A;  2LFO A;  4U3Q A;  2IZD B;  2QO5 A;  4FBR A;  1IKE A;  4BGF A;  3WZN A;  2DJF A;  2WQ9 A;  1LDO A;  4OMX A;  1DZP A;  3MX7 A;  1OBQ A;  4GUZ A;  1BLR A;  5K06 A;  3SZJ A;  1E06 A;  1BSQ A;  2FT9 A;  4BVM A;  1N7Y A;  2RTB B;  1LCV A;  4BJ8 A;  2JW1 A;  1ACD A;  2WEX A;  2MM3 A;  3GAQ A;  1VWB B;  3JSQ A;  3UEU A;  3PH6 A;  3DTQ A;  1I9H A;  3ELX A;  3KZA A;  5IO6 A;  2BS6 A;  2GH7 A;  4GU8 A;  1SWK A;  1DF8 A;  1MOY A;  1NQM A;  4M7M A;  4OS0 A;  4Z27 A;  1FDQ A;  2MHD A;  2CAM A;  5CSE A;  2JOZ A;  3BX7 A;  1X71 A;  4I60 A;  4DQ4 A;  1CBI A;  3NPO A;  1SWO A;  3PEC A;  2AH7 X;  1AVD A;  2AL0 X;  3T6L A;  1RSU B;  2G8C O;  4YFR A;  3C78 X;  1YUP A;  4LZV A;  3C77 X;  1GT3 A;  1BEB A;  1RXH A;  4CPF A;  3FEN A;  5HZ5 A;  1SWH A;  4ZGF A;  1OBU A;  3EMM A;  4GE1 A;  3EBW A;  1TVQ A;  4YGZ A;  1JJJ A;  2PI3 O;  4ID2 A;  1BRQ A;  4CDD A;  2WWP A;  2CZU A;  3VE2 A;  1B4M A;  1BM5 A;  2IZI A;  5H9A A;  1VWQ B;  1YWC A;  3RY2 A;  5FEN A;  4U8U O;  2RN4 A;  4ORY A;  5K67 A;  5LJK A;  1VWA B;  3L4R A;  2IZC B;  1DC9 A;  4QRL A;  2QM9 A;  1XKI A;  3Q34 A;  2OVE A;  4ZH6 A;  1TXL A;  4O3Z A;  3TF6 A;  5L8N A;  4AZN A;  1SWQ A;  3UEX A;  1VWF B;  2R74 A;  5AJB A;  3SAO A;  1SLE B;  5LJC A;  4ORS A;  4HPD A;  2PY1 A;  3T2X A;  2AT5 X;  1U0X A;  1QFV A;  3WZP A;  3FR5 A;  3WYP A;  4FGI B;  4IB8 A;  4O3X B;  5BVQ A;  5L8O A;  1KXO A;  2AMM X;  2OZQ A;  2QOS C;  1JZU A;  1SWB A;  5CHK A;  2DJG A;  2ZAG A;  1I06 A;  3D95 A;  5K68 A;  1GX8 A;  1X8P A;  2GTL O;  2WPU A;  1ZNE A;  1IFC A;  2JGS A;  3UEW A;  5F1E A;  1AQB A;  2WEW A;  2ASN X;  1VWN B;  3HWD A;  1KL5 A;  3TGA A;  3PQS A;  2G5L A;  1A3Y A;  1HMS A;  4HWM A;  5HBS A;  5JR8 A;  1SWA A;  2BT9 A;  5JD2 A;  1BRP A;  1LCW A;  1VPR A;  1KFF A;  1YWA A;  4Y0P A;  4IMN A;  5FQ7 E;  5B2A O;  1KQX A;  1N9Y A;  2ACP X;  3P6G A;  2KD2 A;  4Y0S A;  3VG5 A;  2X55 A;  3APV A;  4YMY A;  4HPC A;  4KCA A;  3MVF A;  3X00 A;  1ZND A;  3C76 X;  2KT4 B;  2OYB O;  2RTI B;  1MEP A;  1OPB A;  4ODD A;  5HTD A;  4GD9 A;  1I04 A;  2C1S A;  1T8V A;  3AKM A;  1W5R A;  3ZUO A;  4QZU A;  5EPQ A;  2L5P A;  4TKH A;  1QY1 A;  1X8O A;  3PP6 A;  1O1V A;  4JHQ A;  4OS3 A;  4YCE A;  5HA1 A;  3BU9 A;  4XME A;  2X8F A;  3KFH A;  4RUN A;  5BVS A;  1SY3 A;  3S5X A;  5F6B A;  3BU1 A;  5EED A;  4ZH9 A;  3ZW2 A;  3CWK A;  5B5F A;  2QO4 A;  3SLO A;  3PK2 A;  5CE4 A;  5FFH A;  3RE5 A;  2FHL A;  4Y59 A;  4L3R A;  2RD7 C;  3U9P C;  2MWH A;  1B0O A;  2AKQ A;  3ZZV A;  2WSJ A;  1TOU A;  3WOV A;  3NQ9 A;  3RDS A;  2QOM A;  1BWY A;  1R0U A;  2AT6 X;  4ZCB A;  3BSZ E;  1SMP I;  4AZP A;  2VFC A;  3NR3 A;  4QAE A;  4JGL A;  3FDC A;  2W2F A;  4MVL A;  3STM X;  4TJZ A;  4XMD A;  1VWR B;  2CZT A;  1JQP A;  2X8T A;  1VWO B;  5LJG A;  4ALB A;  3SOT A;  1GT4 A;  1FEL A;  1Y55 X;  2A2U A;  2YMS A;  3APX A;  3CQN A;  5FAZ A;  1HQQ A;  1GT5 A;  2FLJ A;  4HFO A;  1DV9 A;  2IFB A;  5EZ2 A;  5HCE C;  1DZM A;  1LNM A;  2X32 A;  1E5P A;  4IAB A;  2NNQ A;  5LKF A;  5LJH A;  4U8U N;  4GGT A;  3RWX A;  1IIU A;  1KQW A;  2F01 A;  2OY5 O;  4EFG A;  3FEK A;  4JNJ A;  2E4J A;  1O8V A;  4KC8 A;  4ORU A;  4GET A;  4XMC A;  5IRA A;  1BSO A;  2OFB A;  3HWE A;  1BBP A;  1GKA A;  2A3F X;  2RTP B;  1G7N A;  2L68 A;  3F9D A;  3WBG A;  3LV4 A;  4I9R A;  3JQO A;  2X8S A;  3FW5 A;  1MX8 A;  4FQB B;  1G74 A;  3ZW1 A;  3RDX A;  4B55 A;  3K3L A;  4O4S A;  5D45 A;  4AYH A;  4NV7 A;  1LDQ A;  5D8J A;  3VG4 A;  4QYN A;  4BQU A;  1SRH A;  2RQ0 A;  4XMG A;  2W2A A;  4O4X A;  2Y3F A;  4KH8 A;  1JIW I;  1N9M A;  5EDC A;  3G7X A;  2LA7 A;  2GTL N;  1VWC B;  2FRS A;  5LKE A;  4GRJ A;  1SY2 A;  2O62 A;  4YGG A;  1Z24 A;  1FE3 A;  3N91 A;  1SXU A;  4TQ2 A;  1Y53 X;  1ZNH A;  3VU1 A;  4ZHG A;  1EAL A;  2RTC B;  3FYF A;  3U03 A;  5AJC A;  1SRE A;  2ACO A;  1KT5 A;  1NC9 A;  1HY2 A;  1NBX A;  1JMX A;  3RDU A;  2R56 A;  3AEH A;  5DPQ A;  3S60 A;  5H9L A;  5HCD C;  1N0S A;  2OVA A;  1YP6 A;  1GX9 A;  1NP1 A;  1JBH A;  3D4R A;  1I4U A;  4A8Z A;  3NX2 A;  1RST B;  1KT6 A;  2AT8 X;  2XKL A;  1AVG I;  5HCC C;  4YBU A;  3AKN A;  3D9W A;  4BX6 A;  1A57 A;  1N4J A;  1FEM A;  1I05 A;  1IW2 A;  1SWC A;  3ELZ A;  4I3D A;  3RBY A;  1LIC A;  2Q2P A;  1GKA B;  1KGL A;  2CM9 A;  1GM6 A;  2HNX A;  2M4L A;  1U17 A;  1UYN X;  1ERX A;  2FGS A;  2RTM A;  1KT3 A;  4QYP A;  2NP1 A;  4PSQ A;  2X46 A;  3KFG A;  3ZW1 B;  1HMR A;  1MK5 A;  4TKJ A;  4BOE A;  3ZUI A;  3BRN A;  1CBQ A;  4GZV A;  1IFB A;  4A1H A;  2Y32 A;  5KHP A;  1VWK B;  1PEE A;  2OFR X;  1I78 A;  2R73 A;  4C5P A;  4D6A A;  2HZQ A;  1LF7 A;  1GX3 A;  2QCB A;  4NNT A;  4YFQ A;  3P6E A;  5H9K A;  1AEL A;  1KZX A;  3IA8 A;  4KII A;  4NV8 A;  3TZS A;  3RE6 A;  2ALL X;  1SXX A;  4NYQ A;  4O3Y A;  3P6D A;  5LJD A;  4EQA C;  1EXS A;  1Y9L A;  1EI5 A;  3FR4 A;  4NW4 A;  3EC5 A;  5B29 A;  1VWJ B;  3NX1 A;  2RTA A;  4MEE A;  5HA0 A;  4LQZ A;  2UZ2 A;  3OJY C;  4GJV A;  4L1N A;  2LKK A;  1KL4 A;  2BHV A;  2Z4I A;  3HOL A;  4N7D A;  1EQD A;  1CRB A;  3V8U A;  2OFA A;  2I5Z O;  4Y0R A;  2RTR B;  3RDO A;  1MDC A;  3BLG A;  1K24 A;  3KVN A;  3BX8 A;  5HZQ A;  3BY0 A;  1TW4 A;  1S2P A;  2RCT A;  2YG2 A;  4O3W A;  3OBL A;  4I95 A;  3NQK A;  4AZM A;  4BX6 B;  2JU3 A;  2QMI A;  4D6B A;  3QQ2 A;  2FKJ A;  1D2U A;  2KTS A;  5KID A;  4GNW A;  1NDJ A;  2VFB A;  2IZA A;  4ML7 B;  1PBY A;  2C1Q A;  4ZFX A;  3MG5 A;  2HKD A;  3DSZ A;  1SRF A;  1VWG B;  3O2Y A;  5FQ6 E;  1K3B A;  2JU7 A;  3RSW A;  3VE1 A;  3WJC A;  4IAX A;  3FIQ A;  3WJF A;  2RTH B;  1CBR A;  4QGX A;  5H8T A;  2HZR A;  3MBT A;  4IAW A;  4CPI A;  4IMO A;  4Z6J A;  1EII A;  4ORW A;  1SRI A;  4IBA A;  2FTB A;  3SLJ A;  1Y0G A;  4ZHF A;  3B2H A;  4YDA A;  4MVI A;  2AF5 A;  3U0D A;  1LIE A;  3VG6 A;  3FA6 A;  1SXY A;  4QNI A;  3B2K A;  3UAQ A;  2C4I A;  3PH5 A;  4WHI A;  3D96 A;  3EYC A;  4RUU A;  4ZR2 A;  1MX7 A;  3MM0 A;  5HWZ A;  1YIV A;  3OD9 A;  4JO6 A;  1CJ5 A;  3TGB A;  5B3M O;  3T6F A;  1ALB A;  1SWS A;  1S7D A;  3WZO A;  2OVS A;  2POA A;  2IZE B;  2CBS A;  3VGW A;  4AZR A;  3SLT A;  3RKG A;  4EEJ A;  4OKA A;  1SWT A;  3LHN A;  4PJ2 A;  4FBV A;  5B11 O;  1G85 A;  2LB6 A;  1VWM B;  2MJI A;  2OF8 A;  2OF9 A;  4MVE A;  4NNS A;  4YGH A;  4EKV A;  2NND A;  4LKT A;  3ZW0 A;  1BJ7 A;  4BX5 A;  2Q2M A;  1X8Q A;  4O4U A;  1LCZ A;  4NYR A;  4IB9 A;  4YFP A;  3WJG A;  5F6Z A;  1EPB A;  3CBS A;  5L8I A;  3WJB A;  4Z2V A;  1KZW A;  4U46 A;  5AQ6 A;  5IRW A;  3PQU A;  4BCS A;  2OFM X;  4IB6 A;  1PTS A;  3B2J A;  4YBP A;  2ZSC A;  1SWR A;  2OVD A;  4GDZ A;  4HPB A;  1EPA A;  4I3C A;  2FHN X;  4DCB A;  1X8N A;  2KW1 A;  1SWE A;  2Z4H A;  5HAE A;  3CR6 A;  4WFU A;  4I6S A;  4LKP A;  5IRU A;  4BX7 A;  5AEO A;  1B56 A;  4MVK A;  3UEV A;  4QQ1 A;  3D97 A;  5L3Y A;  2Y3E A;  2GC9 A;  1LKE A;  4MIR A;  3WJD A;  2IZG B;  2A5B A;  3GE2 A;  4ALO A;  2VDF A;  1SWU A;  3KFF A;  1A18 A;  1YWD A;  3AUM O;  2X56 A;  5FQ8 E;  4CDC A;  1EW3 A;  2I5V O;  3STK A;  4YCH A;  1FEN A;  1T68 X;  1OBP A;  1RBP A;  4GGZ A;  3SZH A;  3FEL A;  2LBA A;  3RZY A;  1JJU A;  3EBK A;  3OE3 A;  1HN2 A;  5D47 A;  2OY7 A;  3VG2 A;  3VHM A;  4ES7 A;  1JYJ A;  4Z2O A;  1LFO A;  1PMP A;  4UU3 A;  3RY1 A;  3NBX X;  4Y5D A;  1T0V A;  3WXQ A;  4YVB A;  3FMZ A;  2JMB A;  3CQR A;  1SXW A;  4LZU A;  3ZW0 B;  4BX5 B;  4M6S A;  1VYG A;  5H9N A;  1DZK A;  2RA6 A;  1E00 A;  3CKG A;  3HWF A;  4FBO A;  1ADL A;  4NLI A;  4AZQ A;  1DFV A;  2HMB A;  2WUT A;  4BBO A;  4YH0 A;  1ZNK A;  4AW8 A;  1B8E A;  4ZJ0 A;  2Q9S A;  5HZ6 A;  3TGC A;  1JJX A;  2ANS A;  2OL8 O;  1G5W A;  1W6F A;  5BYP A;  1OEK A;  1SLD B;  4A60 A;  2JN3 A;  1QFT A;  1VWD B;  1URE A;  2HLV A;  4UU2 A;  3E3C A;  3RDQ A;  4GJS A;  4NP1 A;  5B5G A;  3QKG A;  2Q4N A;  4BX7 B;  3HOE A;  1JV4 A;  1LID A;  2F09 A;  2OY8 A;  1X8U A;  1P6P A;  4O9S A;  4ON1 A;  3SZI A;  3B2L A;  2N93 A;  2WQA E;  1UYO X;  3STN A;  1SWD A;  1GXA A;  1L6M A; 
#chains in the Genus database with same CATH homology
 3KQ0 A;  1VYF A;  3H3I A;  4I3B A;  4KT5 A;  1ZRY A;  1UZ2 X;  4ZHC A;  1HBP A;  1QQS A;  2DM5 A;  3ZQ3 A;  4U8U M;  2KTD A;  3P6H A;  2G79 A;  4OS8 A;  3CMP A;  2A2G A;  3B2I A;  2JU8 A;  1HQP A;  1LIF A;  1AB0 A;  2RCQ A;  2Q39 A;  4YDB A;  3ZI8 A;  5IO7 A;  3VG7 A;  4TKB A;  1ZNG A;  3NQ3 A;  4ORX A;  1GT1 A;  3P6F A;  1BSY A;  1MUP A;  2P8G A;  2X45 A;  2NNE A;  1RLB E;  2HYS A;  4QZT A;  3WVM A;  4ZHD A;  1E02 A;  2GTL M;  4GK9 A;  4Y0Q A;  4ZGU A;  1ICM A;  1D3S A;  4YKM A;  5D48 A;  1EUO A;  4CV7 A;  3NP1 A;  3I0A A;  5D4A A;  1PM1 X;  1NGL A;  2FS6 A;  1Y9T A;  5LJB A;  1CBS A;  3WJE A;  1PBO A;  1ZNL A;  2G78 A;  1ICN A;  2CM4 A;  2L67 A;  4N7C A;  3APU A;  4CK4 A;  5KIC A;  4OMW A;  3S5V A;  4KC7 A;  4ZHH A;  4GKC A;  2FS7 A;  1SA8 A;  1S44 A;  3FA7 A;  1JYD A;  5LJE A;  3FW4 A;  4COT A;  1O1U A;  5BVT A;  1A2D A;  5HZ8 A;  4R0B A;  4WFV A;  2MO5 A;  5CYB A;  3KFI A;  2W2B A;  3FA8 A;  2EU7 X;  1YP7 A;  1OEJ A;  1H91 A;  2WR6 A;  4D6A A;  3BDR A;  4EXZ A;  2A13 A;  4GH7 A;  4ORR A;  4XMF A;  2LBV A;  1KOI A;  4MIS A;  4I9S A;  4TNN A;  3FR2 A;  1LPJ A;  1HMT A;  5F7G A;  2AT3 X;  4DQ3 A;  3O19 A;  3O22 A;  3CBC A;  3Q6L A;  1ERB A;  1OEE A;  1XCA A;  2FR2 A;  1LIB A;  4TLJ A;  3ZWE A;  1ML7 A;  3S26 A;  2BLG A;  4HPA A;  1DF3 A;  4A1Y A;  2K23 A;  1QY0 A;  4QGV A;  1HBQ A;  5DG4 A;  2CBR A;  4WBK A;  3P6C A;  3FEP A;  4O49 A;  3HWG A;  4O4O A;  2AT0 X;  1MVG A;  4ARH A;  3F6Z B;  3P02 A;  4GNY A;  3T1D A;  5F58 A;  2A0A A;  1YWB A;  4QGW A;  4EDE A;  2FWV A;  1SY1 A;  1QY2 A;  3BS2 A;  1IKJ A;  1FTP A;  3HK1 A;  3EM0 A;  5C0N A;  3P24 A;  1NP4 A;  1QAB E;  2GTF X;  3PED A;  4AZO A;  3NAD A;  1X89 A;  2G7B A;  3FA9 A;  2BS5 A;  4U9C A;  2L9C A;  5HTE A;  3VG3 A;  1EIO A;  4INN A;  1QWD A;  5B27 A;  4IB7 A;  4K19 A;  3VPJ E;  1TOW A;  4CSB A;  3IFB A;  2K62 A;  3I17 A;  5IO5 A;  1QG5 A;  4YKO A;  2ZAI A;  3APW A;  5EEE A;  3PPT A;  1OPA A;  5EDB A;  4NLJ A;  1U18 A;  4XMH A;  2FR3 A;  3FLL A;  2XST A;  1SY0 A;  2QO6 A;  3HTY A;  3JS1 A;  3F8A A;  5HZ9 A;  1KT7 A;  1KT4 A;  2F73 A;  1DZJ A;  1GGL A;  2GJ5 A;  2LFO A;  4U3Q A;  4FBR A;  2QO5 A;  1IKE A;  2WQ9 A;  4OMX A;  1DZP A;  3MX7 A;  1OBQ A;  1BLR A;  5K06 A;  1E06 A;  1BSQ A;  2FT9 A;  4BVM A;  1G5W A;  2JW1 A;  1ACD A;  2WEX A;  2MM3 A;  3GAQ A;  3JSQ A;  3UEU A;  3PH6 A;  3DTQ A;  3KZA A;  3ELX A;  5IO6 A;  2BS6 A;  4GU8 A;  4M7M A;  4OS0 A;  1FDQ A;  2MHD A;  2JOZ A;  3BX7 A;  1X71 A;  4DQ4 A;  1CBI A;  3NPO A;  2AH7 X;  3PEC A;  2AL0 X;  4YFR A;  3C78 X;  1YUP A;  4LZV A;  3C77 X;  1GT3 A;  1BEB A;  3FEN A;  5HZ5 A;  4ZGF A;  1OBU A;  3EMM A;  4GE1 A;  3EBW A;  1TVQ A;  4YGZ A;  1JJJ A;  4ID2 A;  1BRQ A;  2WWP A;  2CZU A;  3VE2 A;  1B4M A;  1BM5 A;  5H9A A;  5FEN A;  1YWC A;  4U8U O;  2RN4 A;  4ORY A;  5LJK A;  3L4R A;  4A1H A;  1DC9 A;  4QRL A;  2QM9 A;  1XKI A;  4ZH6 A;  2OVE A;  3TF6 A;  1TXL A;  4O3Z A;  5L8N A;  4AZN A;  3UEX A;  2R74 A;  5AJB A;  3SAO A;  5LJC A;  4ORS A;  4HPD A;  2PY1 A;  2AT5 X;  1U0X A;  1QFV A;  3FR5 A;  4FGI B;  4IB8 A;  4O3X B;  5BVQ A;  5L8O A;  1KXO A;  2AMM X;  2OZQ A;  2QOS C;  1JZU A;  2ZAG A;  1I06 A;  3D95 A;  1GX8 A;  1X8P A;  2GTL O;  1ZNE A;  1IFC A;  3UEW A;  5F1E A;  1AQB A;  2WEW A;  2ASN X;  3HWD A;  3TGA A;  3PQS A;  1A3Y A;  1HMS A;  4HWM A;  5HBS A;  5JR8 A;  2BT9 A;  1BRP A;  1VPR A;  1YWA A;  4Y0P A;  4IMN A;  5FQ7 E;  1KQX A;  2ACP X;  3P6G A;  2KD2 A;  4Y0S A;  3VG5 A;  3APV A;  4YMY A;  4HPC A;  4KCA A;  3MVF A;  1ZND A;  3C76 X;  2KT4 B;  1OPB A;  4ODD A;  5HTD A;  1I04 A;  1T8V A;  3AKM A;  3ZUO A;  4QZU A;  5EPQ A;  2L5P A;  4TKH A;  1QY1 A;  1X8O A;  3PP6 A;  1O1V A;  4OS3 A;  4YCE A;  5HA1 A;  3BU9 A;  4XME A;  2X8F A;  3KFH A;  4RUN A;  5BVS A;  1SY3 A;  3S5X A;  5F6B A;  3BU1 A;  5EED A;  4ZH9 A;  3ZW2 A;  3CWK A;  2QO4 A;  5CE4 A;  5FFH A;  4L3R A;  2RD7 C;  3U9P C;  2MWH A;  1B0O A;  2AKQ A;  3ZZV A;  2WSJ A;  1TOU A;  3WOV A;  3NQ9 A;  1BWY A;  1R0U A;  2AT6 X;  4ZCB A;  3BSZ E;  1SMP I;  4AZP A;  3NR3 A;  4QAE A;  4JGL A;  2W2F A;  4MVL A;  3STM X;  4TJZ A;  4XMD A;  2CZT A;  5LJG A;  2X8T A;  4ALB A;  3SOT A;  1GT4 A;  1FEL A;  2A2U A;  2YMS A;  5FAZ A;  3APX A;  3CQN A;  1GT5 A;  2FLJ A;  4HFO A;  1DV9 A;  2IFB A;  5EZ2 A;  5HCE C;  1DZM A;  1LNM A;  1E5P A;  4IAB A;  2NNQ A;  5LKF A;  5LJH A;  4U8U N;  3RWX A;  1IIU A;  1KQW A;  4EFG A;  3FEK A;  2E4J A;  1O8V A;  4KC8 A;  4ORU A;  4GET A;  4XMC A;  1BSO A;  3HWE A;  1BBP A;  1GKA A;  2A3F X;  1G7N A;  2L68 A;  3F9D A;  3WBG A;  3LV4 A;  4I9R A;  3JQO A;  2X8S A;  3FW5 A;  1MX8 A;  4FQB B;  1G74 A;  3ZW1 A;  3K3L A;  4O4S A;  5D45 A;  4AYH A;  3VG4 A;  5D8J A;  4BQU A;  4QYN A;  2RQ0 A;  4XMG A;  2W2A A;  4O4X A;  4KH8 A;  1JIW I;  5EDC A;  3G7X A;  2LA7 A;  2GTL N;  2FRS A;  5LKE A;  4GRJ A;  1SY2 A;  2O62 A;  4YGG A;  1Z24 A;  1FE3 A;  3N91 A;  1SXU A;  1ZNH A;  3VU1 A;  4ZHG A;  1EAL A;  3FYF A;  3U03 A;  5AJC A;  2ACO A;  1KT5 A;  2R56 A;  5DPQ A;  3S60 A;  5H9L A;  5HCD C;  1N0S A;  2OVA A;  1YP6 A;  1GX9 A;  1NP1 A;  1JBH A;  3D4R A;  1I4U A;  4A8Z A;  3NX2 A;  1KT6 A;  2AT8 X;  2XKL A;  1AVG I;  4YBU A;  3AKN A;  1A57 A;  1FEM A;  1I05 A;  1IW2 A;  3ELZ A;  4I3D A;  3RBY A;  1LIC A;  2Q2P A;  1GKA B;  1KGL A;  2M4L A;  2CM9 A;  1GM6 A;  2HNX A;  1U17 A;  1ERX A;  4QYP A;  1KT3 A;  2NP1 A;  4PSQ A;  2X46 A;  3KFG A;  3ZW1 B;  1HMR A;  4TKJ A;  4BOE A;  3ZUI A;  3BRN A;  1CBQ A;  4GZV A;  1IFB A;  5KHP A;  1PEE A;  2OFR X;  2R73 A;  2HZQ A;  1LF7 A;  4NNT A;  4YFQ A;  3P6E A;  5H9K A;  1AEL A;  1KZX A;  3IA8 A;  4KII A;  3TZS A;  2ALL X;  1SXX A;  4NYQ A;  4O3Y A;  3P6D A;  5LJD A;  4EQA C;  1EXS A;  1Y9L A;  1EI5 A;  3FR4 A;  4NW4 A;  5B29 A;  3NX1 A;  5HA0 A;  4LQZ A;  4L1N A;  3OJY C;  2LKK A;  3HOL A;  2BHV A;  2Z4I A;  4N7D A;  3V8U A;  1EQD A;  1CRB A;  4Y0R A;  1MDC A;  3BLG A;  5HZQ A;  3BX8 A;  3BY0 A;  1TW4 A;  1S2P A;  2RCT A;  2YG2 A;  4O3W A;  3OBL A;  4I95 A;  3NQK A;  4AZM A;  2JU3 A;  2QMI A;  4D6B A;  1D2U A;  2KTS A;  5KID A;  4GNW A;  4ML7 B;  4ZFX A;  3DSZ A;  5FQ6 E;  3RSW A;  3O2Y A;  2JU7 A;  3WJC A;  3VE1 A;  4IAX A;  3FIQ A;  3WJF A;  1CBR A;  4QGX A;  5H8T A;  2HZR A;  3MBT A;  4IAW A;  1EII A;  4IMO A;  4ORW A;  4IBA A;  2FTB A;  4ZHF A;  3B2H A;  4YDA A;  4MVI A;  3U0D A;  1LIE A;  3VG6 A;  3FA6 A;  1SXY A;  4QNI A;  3B2K A;  3UAQ A;  3PH5 A;  4WHI A;  3D96 A;  3EYC A;  4RUU A;  4ZR2 A;  1MX7 A;  5HWZ A;  1YIV A;  3OD9 A;  3TGB A;  1ALB A;  1S7D A;  2OVS A;  2POA A;  2CBS A;  4AZR A;  3RKG A;  4EEJ A;  3LHN A;  4PJ2 A;  5HCC C;  4FBV A;  1G85 A;  2LB6 A;  2MJI A;  4MVE A;  4NNS A;  4YGH A;  2NND A;  4LKT A;  3ZW0 A;  1BJ7 A;  2Q2M A;  1X8Q A;  4O4U A;  4NYR A;  4IB9 A;  4YFP A;  3WJG A;  5F6Z A;  1EPB A;  3CBS A;  5L8I A;  3WJB A;  1KZW A;  5AQ6 A;  3PQU A;  2OFM X;  4IB6 A;  3B2J A;  4YBP A;  4GDZ A;  2OVD A;  4HPB A;  1EPA A;  4I3C A;  1X8N A;  2KW1 A;  2Z4H A;  5HAE A;  3CR6 A;  4WFU A;  4I6S A;  4LKP A;  5AEO A;  1B56 A;  4MVK A;  3UEV A;  4QQ1 A;  3D97 A;  2GC9 A;  1LKE A;  4MIR A;  3WJD A;  3GE2 A;  4ALO A;  3KFF A;  1A18 A;  1YWD A;  5FQ8 E;  1EW3 A;  3STK A;  4YCH A;  1FEN A;  1T68 X;  1OBP A;  1RBP A;  3FEL A;  2LBA A;  3RZY A;  3EBK A;  5D47 A;  3OE3 A;  1HN2 A;  3VG2 A;  4ES7 A;  1JYJ A;  1LFO A;  1PMP A;  4UU3 A;  3NBX X;  1T0V A;  3WXQ A;  3FMZ A;  2JMB A;  3CQR A;  1SXW A;  4LZU A;  3ZW0 B;  4M6S A;  1VYG A;  5H9N A;  1DZK A;  2RA6 A;  1E00 A;  4FBO A;  3HWF A;  1CJ5 A;  1ADL A;  4NLI A;  4AZQ A;  1DFV A;  2HMB A;  2WUT A;  4TQ2 A;  4YH0 A;  1ZNK A;  4AW8 A;  1B8E A;  4ZJ0 A;  2Q9S A;  5HZ6 A;  3TGC A;  1JJX A;  2ANS A;  5BYP A;  1OEK A;  4A60 A;  2JN3 A;  1QFT A;  1URE A;  2HLV A;  4UU2 A;  3E3C A;  4NP1 A;  3QKG A;  2Q4N A;  3HOE A;  1JV4 A;  1LID A;  2F09 A;  1X8U A;  1P6P A;  4O9S A;  4ON1 A;  3B2L A;  2N93 A;  2WQA E;  3STN A;  1GXA A;  1L6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...