4HFOA

Biogenic amine-binding protein selenomethionine derivative
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
195
structure length
195
Chain Sequence
SGCSTVDTVKDFNKDNFFTGSWYMTHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYMYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Amine-binding protein
total genus 53
structure length 195
sequence length 195
chains with identical sequence B, C, D, I, J, K, L
ec nomenclature
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4hfoA00
4LKTA 3APWA 1N0SA 1KT4A 4QGVA 3P6HA 4QZTA 4QYPA 2N93A 3JSQA 1LF7A 4IB6A 5AQ6A 2RCQA 1OBPA 1OEJA 2FS7A 2XKLA 3PEDA 1HN2A 2HZRA 2A2UA 4XMCA 4PSQA 3UEXA 1UZ2X 5HZ8A 1A2DA 2AMMX 1YUPA 1I06A 2WR6A 5HCDC 5HZ5A 2BLGA 1A3YA 1KT3A 4LZVA 3VG6A 1BJ7A 1S7DA 4GNWA 1EXSA 2GC9A 3F9DA 2ALLX 1TXLA 4YKOA 4AZNA 1ADLA 4ARHA 4DQ3A 3P6CA 1GKAA 1VYGA 1PMPA 2AT5X 4YDAA 1MUPA 3B2IA 2DM5A 4R0BA 1EUOA 1SY2A 4XMGA 3OJYC 3I0AA 4YH0A 1HMSA 1DZPA 2WEWA 4WFVA 1I4UA 4QGXA 3B2KA 4AZPA 4A1YA 4IMNA 1ACDA 1YWDA 1TOUA 5LKFA 4ORXA 2CM9A 2ASNX 3U03A 2HNXA 5HBSA 4M7MA 5B27A 1X89A 1MVGA 1NGLA 5D47A 1JYJA 3KFGA 4A8ZA 2OVEA 3KFFA 4EXZA 1LICA 5IO6A 4NLIA 5HTEA 1MDCA 4OS0A 2GTFX 4Y0SA 1G85A 2AT0X 3I17A 4RUNA 3ELZA 5KHPA 4ORYA 4XMEA 2FT9A 3O19A 4HFOA 4ES7A 3BS2A 5H9LA 1T68X 1OPAA 2HLVA 1D2UA 3CQRA 1LIBA 3FA6A 3HWGA 3WJCA 2QO6A 3NX1A 4BVMA 1SY0A 1DZMA 1JYDA 4ZHCA 1B8EA 3UEWA 2FR3A 1OEKA 3T1DA 3CBCA 4TKHA 4NNTA 4ZCBA 4ORSA 1EQDA 3NP1A 4I9RA 3STNA 5FENA 1SY1A 2QOSC 1IFBA 1A57A 1T0VA 1X8PA 2XSTA 1SXXA 1S2PA 3VG2A 2FTBA 2CBSA 1KQXA 1E00A 2CBRA 5DG4A 2A0AA 2OFMX 3D96A 2AH7X 3TGBA 1QY0A 2JU3A 2RD7C 1ML7A 1HQPA 3TF6A 5FAZA 4OS8A 1FE3A 1RBPA 4EEJA 1EPBA 2FLJA 1DF3A 1PM1X 1HMRA 3ELXA 5JR8A 1FENA 4TLJA 4WBKA 3NX2A 5HAEA 1LKEA 4QYNA 1LIEA 4YFPA 1MX8A 2HYSA 2EU7X 2X45A 2JOZA 2OFRX 1G74A 1X8OA 3EM0A 5FFHA 3KFIA 2WWPA 4YKMA 3D95A 3QKGA 2G78A 4ZJ0A 3BX7A 3O2YA 1O1UA 1GT3A 3P6FA 4TKJA 4XMFA 2A3FX 5HZQA 4ZHDA 1NP4A 2K62A 2NP1A 4HPDA 3ZUOA 5KICA 4AW8A 3TGAA 1EIIA 2RA6A 4ORUA 4LZUA 5F6BA 4A1HA 5LJEA 2WQ9A 1TW4A 1BLRA 4RUUA 2FS6A 3BY0A 3IFBA 5EEEA 2FR2A 3Q6LA 2X46A 4I9SA 3PP6A 3ZQ3A 5D45A 4LKPA 1X8UA 4BOEA 3KZAA 2IFBA 3C78X 3B2JA 1GT5A 1BBPA 4K19A 1JJXA 2AKQA 4ZH9A 5K06A 3FA9A 4A60A 3IA8A 1CBIA 4IB7A 1ERBA 5LJDA 3FA7A 1H91A 4EDEA 3G7XA 1YP7A 2Q39A 4NNSA 1LNMA 4TNNA 3U9PC 3K3LA 3FW5A 2QO5A 1I04A 4ZFXA 5HTDA 3D97A 5IO5A 3NQ3A 3NADA 3FEPA 1T8VA 3BSZE 3MBTA 2RCTA 5BVTA 1YWCA 5LJCA 3FELA 1AELA 4IAXA 5D4AA 4YMYA 1KT5A 5BVQA 1B56A 4N7DA 1XKIA 1GT4A 3FENA 4D6AA 1KQWA 3HK1A 3NR3A 2WUTA 5BVSA 2Q4NA 4GE1A 3APVA 2RQ0A 3CQNA 2AT6X 1QQSA 1BRQA 3CWKA 1DFVA 3EYCA 1Z24A 3WJDA 2LB6A 3PH6A 2P8GA 3GAQA 4YGZA 4ODDA 4GNYA 4AZRA 1VYFA 2W2BA 2ACOA 1FELA 2L68A 2QO4A 4YCHA 1KZXA 4DQ4A 3FEKA 5LJHA 5B29A 4UU3A 4IAWA 4Y0QA 3DTQA 1XCAA 1B0OA 1SA8A 3FR5A 1MX7A 2HMBA 5HA0A 2LBAA 1A18A 3STKA 1KGLA 3VG7A 1YWBA 2WQAE 5HZ9A 5H8TA 1FEMA 1YWAA 3ZUIA 3FLLA 5DPQA 1VPRA 2L9CA 4QGWA 2OVAA 3PH5A 1AB0A 2AT3X 4AZQA 5D48A 1HBPA 1SY3A 4ORRA 1BWYA 4M6SA 4OMWA 1BRPA 4MVLA 1PBOA 4ZHHA 1OEEA 1R0UA 1ZNHA 1CBRA 1ICMA 3FW4A 1LPJA 2OZQA 1HMTA 2OVDA 2Q9SA 1HBQA 4TJZA 1TVQA 3BRNA 5EDCA 3VG3A 3BX8A 2CZUA 4WFUA 4HPAA 3APXA 2PY1A 4Y0RA 1GX9A 1E06A 1E02A 2Q2MA 4I3DA 1GX8A 2FRSA 2F73A 1YP6A 4I3BA 2R74A 5HZ6A 1KZWA 1X71A 4AYHA 4KIIA 4YBUA 1QG5A 1ZRYA 4EFGA 3BDRA 5HA1A 3FMZA 5LJBA 2JU8A 5EDBA 4ZHGA 1P6PA 1BSYA 3TGCA 4YGGA 4GH7A 4YCEA 1CJ5A 5EPQA 3SAOA 1E5PA 5LJGA 4D6BA 1IFCA 3JS1A 5F7GA 2NNEA 2LFOA 4ALBA 1B4MA 2JU7A 1EW3A 2NNQA 4YBPA 2K23A 2YG2A 5H9AA 3FR4A 1KT6A 2MO5A 1JBHA 3BLGA 5HWZA 1GM6A 2FWVA 3NQ9A 1O1VA 3HWEA 4IB9A 1BSOA 5D8JA 2POAA 1U18A 1GKAB 4I3CA 1ZNLA 2GJ5A 4TQ2A 1DZKA 3TZSA 2W2FA 5L8OA 1IKEA 3P6GA 5IO7A 4YDBA 1SXWA 3EBWA 1QFVA 1I05A 3PPTA 1SXUA 2AL0X 2QM9A 4HPCA 3EBKA 5KIDA 1JV4A 2L5PA 4MVIA 1QY1A 1KXOA 3EMMA 4NP1A 1TOWA 4ALOA 3F8AA 4HPBA 4MVKA 3S26A 2A13A 1OBQA 3HWFA 3HWDA 2LBVA 1IIUA 1CBSA 1IKJA 1EIOA 1OPBA 1CRBA 2G79A 1G5WA 2KTDA 1GXAA 1QFTA 1ZNKA 3O22A 4IBAA 1GGLA 4ZR2A 3WVMA 5LJKA 5L8IA 3APUA 5EEDA 1FDQA 1JZUA 1ICNA 1RLBE 2A2GA 4AZOA 3U0DA 3VG4A 1KOIA 1EPAA 1ZNEA 1ZNGA 3FR2A 3NPOA 4XMDA 1ERXA 2E4JA 1ALBA 4QAEA 5HCCC 3CBSA 2WEXA 4YFRA 3WJEA 4YFQA 3WJBA 3CR6A 5LKEA 4ORWA 1SXYA 4OS3A 3PECA 3WXQA 3CMPA 3FA8A 4IB8A 3WJGA 4NLJA 4Y0PA 3FIQA 4O9SA 3WBGA 2R73A 4QZUA 4UU2A 1YIVA 2KT4B 2MM3A 1LFOA 4YGHA 1S44A 1X8NA 3BU1A 4ZHFA 2ANSA 3UEVA 5H9NA 1AVGI 1L6MA 3UEUA 1DV9A 1QABE 1D3SA 1X8QA 2W2AA 5L8NA 1EALA 1QY2A 5F58A 3VG5A 3P6DA 4AZMA 1JJJA 3KFHA 1DC9A 1LIFA 1FTPA 1O8VA 1ZNDA 3RSWA 5CE4A 3AKNA 5HCEC 1BSQA 5C0NA 2JN3A 1NP1A 3C76X 1G7NA 2O62A 1KT7A 1PEEA 3MVFA 5EZ2A 2CZTA 2G7BA 2Q2PA 5F6ZA 1U0XA 2MJIA 1OBUA 1CBQA 4NYRA 3RZYA 2R56A 5F1EA 1LIDA 3DSZA 3BU9A 2L67A 3WJFA 1IW2A 3B2LA 4GKCA 4CK4A 3P6EA 5H9KA 4GETA 3KQ0A 1UREA 2LKKA 2AT8X 4XMHA 1BEBA 4N7CA 4TKBA 4IMOA 3STMX 1GT1A 1U17A 3L4RA 1DZJA 3B2HA 4ZGUA 2ACPX 2NNDA 4BQUA 1QWDA 4OMXA 2WSJA 3AKMA 4NYQA 1AQBA 4ZH6A 1BM5A 3C77X 4GRJA 2CM4A 2HZQA
chains in the Genus database with same CATH superfamily
4EQAC 5BYPA 4LKTA 3APWA 3MG5A 1N0SA 2ZAIA 1KT4A 4QGVA 3P6HA 4QZTA 2FHNX 3VE1A 2OL6O 2N93A 3JSQA 3N91A 1LF7A 1MM9A 4QYPA 3H3IA 4IB6A 1SWQA 1I9HA 5AQ6A 2RCQA 1OBPA 1OEJA 4OELA 3PK2A 2OYBO 1VWBB 2FS7A 2VFBA 2XKLA 1HN2A 2HZRA 3PEDA 3RE5A 2A2UA 4XMCA 4PSQA 3UEXA 2QMIA 1UZ2X 5HZ8A 1A2DA 2AMMX 1YUPA 1I06A 2WR6A 5HCDC 5HZ5A 2BLGA 1N9YA 2RTBB 1A3YA 3WZPA 1KT3A 4LZVA 3VG6A 1BJ7A 1S7DA 2C1QA 4GNWA 4U46A 1EXSA 2GC9A 3F9DA 2ALLX 3NQKA 1TXLA 4YKOA 4AZNA 1ADLA 4ARHA 4DQ3A 3P6CA 1GKAA 1OSPO 1PMPA 1VYGA 2AT5X 1MEPA 4YDAA 1MUPA 3B2IA 2DM5A 4R0BA 1EUOA 1SY2A 3T2XA 4XMGA 3OJYC 1DV9A 2QCBA 4FQBB 3I0AA 1SWNA 4YH0A 5B3MO 2X32A 4BX7B 1HMSA 1DZPA 1RAVA 1VWLB 2WEWA 4WFVA 1IJ8A 1I4UA 4QGXA 3B2KA 3WYPA 4AZPA 4A1YA 4IMNA 1ACDA 1YWDA 1TOUA 1LCZA 1VWIB 4ORXA 2CM9A 5LKFA 2ASNX 5IRWA 3U03A 2HNXA 4LQZA 5HBSA 1VWJB 4M7MA 5B27A 4ON1A 2IZKA 1X89A 1MVGA 1NGLA 2YMSA 2JMBA 5D47A 3MX7A 4O3YA 1JYJA 1W6FA 2IZDB 3KFGA 4Y59A 4A8ZA 2OVEA 4GGZA 3KFFA 4EXZA 1LICA 5IO6A 4NLIA 5HTEA 1MDCA 3D4RA 4OS0A 2GTFX 4Y0SA 1STRB 1G85A 2AT0X 3I17A 4RUNA 3ELZA 2X8FA 2AVIA 4ORYA 5B11O 5KHPA 4XMEA 1K24A 2FT9A 4BX7A 3O19A 3RDQA 1SWGA 1VYOA 2RTFB 1SWFA 3AEHA 3BS2A 4HFOA 2RTCB 4ID2A 5H9LA 1T68X 1OPAA 2HLVA 1D2UA 1SWEA 3CQRA 4KCAA 1LIBA 4KH8A 3FA6A 3HWGA 3WJCA 2QO6A 1VWKB 3NX1A 1I78A 4BVMA 4I95A 1VWCB 1SY0A 1DZMA 4BGFA 1JYDA 2Y3FA 4KT5A 1B8EA 3UEWA 4ZHCA 2FR3A 1OEKA 3T1DA 3CBCA 4TKHA 4NNTA 4ZCBA 4ORSA 1EQDA 3KVNA 3NP1A 4I9RA 3STNA 5FENA 1SY1A 2QOSC 1IFBA 1SREA 4GGRA 4BX6A 1T0VA 1A57A 1X8PA 3FDCA 2XSTA 1SXXA 2BHVA 1S2PA 3VG2A 2FTBA 2CBSA 3SZJA 1HXZA 4O4OA 1KQXA 1E00A 2X8SA 2CBRA 1UYOX 2A0AA 2G5LA 2OFMX 3D96A 5DG4A 2AH7X 2RTNB 1QY0A 3TGBA 2JU3A 2RD7C 1JIWI 1ML7A 4CPEA 1HQPA 3TF6A 5CSEA 5FAZA 4OS8A 1FE3A 1RBPA 4EEJA 1EPBA 2FLJA 1DF3A 1PM1X 3SLTA 1HMRA 2IZHB 3ELXA 5JR8A 1FENA 4TLJA 4WBKA 3NX2A 4Z6JA 5HAEA 1LKEA 1Y0GA 4QYNA 1LIEA 4YFPA 1SMPI 5K67A 1MX8A 4MIRA 2HYSA 2EU7X 2RTRB 1SLFB 4QQ1A 2X45A 1VWDB 2JOZA 5CYBA 1SRFA 2OFRX 3T6FA 4Z27A 2RTLA 1G74A 1X8OA 3EM0A 4GU8A 2OF9A 5FFHA 3KFIA 2WWPA 1VWPB 4YKMA 3D95A 1VWHB 3QKGA 3VHMA 2G78A 4CPHB 4ZJ0A 3BX7A 3O2YA 1O1UA 4O3WA 1GT3A 1NDJA 3P6FA 1SWBA 4TKJA 4XMFA 1KL3A 2A3FX 4U8UM 5HZQA 2RN4A 4ZHDA 4YVBA 1NP4A 3FIDA 2K62A 1VWNB 1LELA 4INNA 4L3RA 2RTHB 2NP1A 1AVDA 4HPDA 3ZUOA 5KICA 1KFFA 1LCWA 4AW8A 1N4JA 3TGAA 1EIIA 2RA6A 2UYWA 4ORUA 4LZUA 5F6BA 4A1HA 5LJEA 1Y53X 2WQ9A 1TW4A 2KD2A 2UZ2A 2FS6A 4RUUA 3WOVA 3BY0A 3IFBA 3NBXX 2FR2A 2JGSA 3Q6LA 2X46A 4JGLA 1N9MA 1Y52X 5EEEA 1HY2A 1EI5A 4I9SA 3PP6A 3ZQ3A 5D45A 4LKPA 1X8UA 4BOEA 1N7YA 3KZAA 2I5ZO 2IFBA 3CKFA 1WBIA 5IRUA 4ML7B 3WZOA 1SRHA 3B2JA 3C78X 1GT5A 3HOEA 1BBPA 2OY8A 4K19A 1JJXA 1RSTB 2AKQA 3LV4A 4ZH9A 5K06A 1MOYA 3FA9A 4BBOA 4FGIB 2OY5O 4A60A 4HWMA 3IA8A 1CBIA 4IB7A 1ERBA 5LJDA 3FA7A 1H91A 4EDEA 3G7XA 1YP7A 4COTA 1LUQA 2Q39A 4NNSA 1LNMA 4TNNA 3U9PC 3K3LA 3FW5A 4BJ8A 2QO5A 3RWXA 1I04A 2LA7A 4ZFXA 5HTDA 3D97A 5B5FA 5IO5A 3NQ3A 3NADA 3FEPA 3RDSA 1SWHA 1T8VA 3V8UA 1STSB 1VWMB 3BSZE 3MBTA 2RCTA 5BVTA 1YWCA 5LJCA 3FELA 1AELA 4IAXA 4BCSA 5D4AA 3CKGA 2A8GA 1NC9A 3RDXA 4YMYA 1KT5A 5BVQA 1B56A 4N7DA 4O3ZA 3SZHA 1XKIA 1WUBA 1GT4A 3FENA 4D6AA 1KQWA 3HK1A 3NR3A 2WUTA 5BVSA 2Q4NA 4GE1A 1RSUB 2Z4IA 3APVA 2RQ0A 3CQNA 2AT6X 4GD9A 1QQSA 1BRQA 2OL7A 1DFVA 3CWKA 3EYCA 4U8UO 4DNEA 1GX3A 3LHNA 1Z24A 2HKDA 4Z2PA 3P02A 5AJBA 4FBVA 5L3YA 3WJDA 2RTAA 2LB6A 3PH6A 2P8GA 3GAQA 4IABA 4YGZA 4ODDA 3ZUIA 4GNYA 1KL4A 2ZSCA 4FBOA 2ZAGA 4GZVA 1VYFA 4AZRA 3MM0A 1VWRB 1W5RA 2W2BA 3RE6A 4U9CA 2ACOA 1FELA 2L68A 2QO4A 4YCHA 4B55A 4NV8A 2X56A 4JNJA 4DQ4A 3FEKA 5H8TA 5B29A 5LJHA 1KZXA 2X4MA 4UU3A 4IAWA 3T2WA 4Y0QA 2Y3EA 2RTJA 2FGSA 4GJSA 3DTQA 3VGWA 1XCAA 1B0OA 1SA8A 2A5BA 3FR5A 3GE2A 1MX7A 2HMBA 5HA0A 2LBAA 3WZQA 1A18A 3STKA 1KGLA 3VG7A 1YWBA 2WQAE 3JQOA 5HZ9A 1SWKA 1FEMA 1YWAA 2IZGB 1UYNX 3FLLA 1VPRA 1FJ1E 1VWAB 2L9CA 4QGWA 5DPQA 4BX5B 2OVAA 3PH5A 1B4MA 1AB0A 2AT3X 2OFBA 5K68A 4AZQA 5D48A 1HBPA 1SY3A 4ORRA 1SWJA 1BWYA 5IRAA 4M6SA 1KL5A 1LDOA 1SWOA 4OMWA 3UAQA 1BRPA 4PJ2A 4DCBA 1K3BA 1PBOA 4MVLA 2FKJA 4ZHHA 1OEEA 1R0UA 2RTDB 1ZNHA 2BC3A 1CBRA 1ICMA 3FW4A 1LPJA 2OZQA 3OBLA 1HMTA 4I60A 2OVDA 1SWTA 1Y55X 1Y9LA 2Q9SA 4O3XB 2IZAA 4Z2OA 1HBQA 4TJZA 1TVQA 1SRIA 3BRNA 5EDCA 1Y9TA 5AEOA 3VG3A 3BX8A 2CZUA 4WFUA 4HPAA 3APXA 4CDEA 2PY1A 4Y0RA 1GX9A 3FYFA 2RTKA 1E06A 1E02A 1HQQA 1SWPA 2M4LA 2Q2MA 4I3DA 3EW1A 1GX8A 1SLGB 5IXGA 2BSZA 2DJGA 2FRSA 2Y32A 2F73A 3ZW2A 1YP6A 3S5VA 4I3BA 2R74A 2IZJA 4CPIA 1RXHA 1X71A 2AF5A 4AYHA 5HZ6A 4KIIA 1KZWA 1SWAA 4MEEA 2IZBA 4YBUA 1QG5A 1ZRYA 2I5VO 4EFGA 1VWQB 3BDRA 5HA1A 3WYQA 3ZZVA 1SLEB 4MVEA 3FMZA 5LJBA 2JU8A 5EDBA 4ZHGA 3HPEA 1LCVA 1P6PA 1BSYA 3Q34A 3TGCA 3S60A 4U8UN 4YGGA 3VE2A 2F09A 4GH7A 4YCEA 1CJ5A 5EPQA 3SAOA 3WZNA 1E5PA 3X00A 2Z4HA 4GDAA 3PQSA 5LJGA 4D6BA 1IFCA 3JS1A 5F7GA 2NNEA 5FQ6E 2LFOA 4GK9A 4ALBA 4QNIA 4CPFA 5B2AO 2JU7A 1EW3A 2NNQA 4GGTA 2JW1A 4WHIA 4YBPA 2A5CA 2K23A 2OVSA 2MHDA 1PBYA 2YG2A 3F6ZB 5H9AA 1AVEA 3FR4A 1KT6A 2MO5A 1JBHA 3BLGA 2OF8A 4CPHA 5HWZA 3EW2A 1GM6A 2FWVA 3RDUA 3NQ9A 1O1VA 3HWEA 5CHKA 3RDOA 4IB9A 1BSOA 5D8JA 2POAA 1U18A 1GKAB 4I3CA 1ZNLA 2GJ5A 2OY1O 4TQ2A 1DZKA 1E2TA 3TZSA 2W2FA 5L8OA 2CAMA 3RDMA 3VU1A 1IKEA 2KTSA 3P6GA 4ES7A 5IO7A 4YDBA 1SXWA 3EBWA 4Y5DA 4FBRA 1NQNA 1PTSA 1QFVA 1I05A 3P24A 3PPTA 1SXUA 2AL0X 2QM9A 4HPCA 5FQ8E 3EBKA 5KIDA 1JV4A 2L5PA 4O4SA 4MVIA 1QY1A 1KXOA 3EMMA 4NP1A 4CDFA 2VDFA 1TOWA 2IZFB 4ALOA 3F8AA 4HPBA 4MVKA 2MWHA 3S5XA 1SWCA 2A13A 1HXLA 3S26A 1OBQA 3VHIA 3ZWEA 3HWFA 3HWDA 2LBVA 3HTYA 5FQ7E 1IIUA 3ZW1B 1CBSA 1IKJA 4Z2VA 2X55A 1VWFB 1EIOA 1OPBA 1CRBA 2G79A 1JQPA 2FKGA 3OE3A 4KC7A 1G5WA 2GH7A 2KTDA 3EC5A 4IRWA 1GXAA 1QFTA 4O4XA 1JMXA 1ZNKA 3O22A 4IBAA 1GGLA 4ZR2A 3WVMA 5LJKA 5L8IA 3APUA 5EEDA 1VWGB 1FDQA 2RTOB 1JZUA 2KW1A 1ICNA 2GTLM 1JJUA 1RLBE 3LTWA 2A2GA 2C4IA 1SWRA 4AZOA 3U0DA 4JHQA 3VG4A 2BS5A 1KOIA 1NQMA 2BT9A 1EPAA 1ZNEA 1ZNGA 2GTLN 3FR2A 3NPOA 3HOLA 4XMDA 1ERXA 1DF8A 2E4JA 1ALBA 4GJVA 4QAEA 3RBYA 2OL8O 3CBSA 5HCCC 2WEXA 4YFRA 3WJEA 3ZW1A 4YFQA 3WJBA 3CR6A 5LKEA 4NW4A 4ORWA 3AUMO 1SXYA 4OS3A 3PECA 3WXQA 5JD2A 3CMPA 3FA8A 3RY2A 4IB8A 3WJGA 4BX6B 4NLJA 2IZCB 1RXJA 3ZW0B 4Y0PA 3FIQA 4O9SA 3WBGA 2R73A 3OD9A 4QZUA 4UU2A 3ZI8A 1YIVA 2KT4B 2MM3A 1LFOA 4YGHA 1S44A 1X8NA 3BU1A 4ZHFA 2ANSA 3UEVA 5H9NA 1AVGI 3RY1A 1L6MA 3UEUA 4KC8A 2DJFA 2QOMA 2X8TA 3PDFA 1SLDB 1QABE 1D3SA 1LDQA 1SWLA 1X8QA 2W2AA 5L8NA 1EALA 1QY2A 1SWSA 3QQ2A 4MISA 5F2BA 5F58A 3VHHA 1VWEB 3VG5A 3P6DA 1SWUA 1JMZA 4AZMA 4Z28A 4CDDA 1STPA 1JJJA 2IZLB 4NV7A 5B5GA 3KFHA 4GUZA 1DC9A 1LIFA 1FTPA 1O8VA 1ZNDA 3RSWA 5CE4A 3AKNA 5HCEC 1BSQA 5C0NA 2RTIB 2JN3A 3ZW0A 1NP1A 3C76X 1G7NA 1VWOB 2O62A 1KT7A 2RTEB 1PEEA 4ZGFA 3MVFA 2G8CO 5EZ2A 1MK5A 2CZTA 2G7BA 2Q2PA 2RTPB 2IZIA 1SRJA 5F6ZA 1U0XA 4GDZA 2MJIA 3E3CA 3RKGA 1OBUA 1CBQA 4NYRA 4BX5A 2RTMA 3RZYA 3SLJA 2C1SA 2IZEB 2R56A 5AJCA 5F1EA 4CSBA 4CV7A 1LIDA 3DSZA 3BU9A 1W4TA 2L67A 3WJFA 4C5PA 2PI3O 1IW2A 1BLRA 4QRLA 2GTLO 2X34A 3B2LA 4OEMA 4GKCA 4CK4A 3P6EA 3SOTA 3D9WA 5H9KA 4GETA 2OFAA 3KQ0A 5B10O 1UREA 2MF6A 2RTQB 2LKKA 2BS6A 3PQUA 2AT8X 4XMHA 4OKAA 2RTGB 1BEBA 4L1NA 4U3QA 3T6LA 1SWDA 4CDCA 4N7CA 4TKBA 3SZIA 4IMOA 3STMX 1GT1A 1U17A 1SRGA 3L4RA 4I6SA 4EKVA 1DZJA 3VPJE 3B2HA 4ZGUA 2ACPX 2NNDA 2FHLA 4BQUA 1QWDA 2WPUA 4O4UA 4OMXA 2WSJA 1RXKA 3AKMA 4NYQA 2VFCA 4JO6A 1N43A 1AQBA 4ZH6A 2F01A 3SLOA 1BM5A 3C77X 4GRJA 2CM4A 1NBXA 4O49A 2OY7A 2HZQA
chains in the Genus database with same CATH topology
4EQAC 5BYPA 4LKTA 3APWA 1N0SA 2ZAIA 1KT4A 4QGVA 3P6HA 4QZTA 3VE1A 4QYPA 2N93A 3JSQA 3N91A 1LF7A 3H3IA 4IB6A 5AQ6A 2RCQA 1OBPA 1OEJA 2FS7A 2XKLA 3PEDA 1HN2A 2HZRA 2A2UA 4XMCA 4PSQA 3UEXA 2QMIA 1UZ2X 5HZ8A 1A2DA 2AMMX 1YUPA 1I06A 2WR6A 5HCDC 5HZ5A 2BLGA 1A3YA 1KT3A 4LZVA 3VG6A 1BJ7A 1S7DA 4GNWA 1EXSA 2GC9A 3F9DA 2ALLX 3NQKA 1TXLA 4YKOA 4AZNA 1ADLA 4ARHA 4DQ3A 3P6CA 1GKAA 1VYGA 1PMPA 2AT5X 4YDAA 1MUPA 3B2IA 2DM5A 4R0BA 1EUOA 1SY2A 4XMGA 3OJYC 4FQBB 3I0AA 4YH0A 1HMSA 1DZPA 2WEWA 4WFVA 1I4UA 4QGXA 3B2KA 4AZPA 4A1YA 4IMNA 1ACDA 1YWDA 1TOUA 5LKFA 4ORXA 2CM9A 2ASNX 3U03A 2HNXA 4LQZA 5HBSA 4M7MA 5B27A 4ON1A 1X89A 1MVGA 1NGLA 2YMSA 2JMBA 5D47A 3MX7A 4O3YA 1JYJA 3KFGA 4A8ZA 2OVEA 3KFFA 4EXZA 1LICA 5IO6A 4NLIA 5HTEA 1MDCA 3D4RA 4OS0A 2GTFX 4Y0SA 1G85A 2AT0X 3I17A 4RUNA 3ELZA 2X8FA 4ORYA 5KHPA 4XMEA 2FT9A 3O19A 4HFOA 4ES7A 3BS2A 4ID2A 5H9LA 1T68X 1OPAA 2HLVA 1D2UA 3CQRA 4KCAA 1LIBA 4KH8A 3FA6A 3HWGA 3WJCA 2QO6A 3NX1A 4BVMA 4I95A 1SY0A 1DZMA 1JYDA 4KT5A 4ZHCA 1B8EA 3UEWA 2FR3A 1OEKA 3T1DA 3CBCA 4TKHA 4NNTA 4ZCBA 4ORSA 1EQDA 3NP1A 4I9RA 3STNA 5FENA 1SY1A 2QOSC 1IFBA 1A57A 1T0VA 1X8PA 2XSTA 1SXXA 2BHVA 1S2PA 3VG2A 2FTBA 2CBSA 4O4OA 1KQXA 1E00A 2X8SA 2CBRA 5DG4A 2A0AA 2OFMX 3D96A 2AH7X 3TGBA 1QY0A 2JU3A 2RD7C 1JIWI 1ML7A 1HQPA 3TF6A 5FAZA 4OS8A 1FE3A 1RBPA 4EEJA 1EPBA 2FLJA 1DF3A 1PM1X 1HMRA 3ELXA 5JR8A 1FENA 4TLJA 4WBKA 3NX2A 5HAEA 1LKEA 4QYNA 1LIEA 4YFPA 1SMPI 1MX8A 4MIRA 2HYSA 2EU7X 4QQ1A 2X45A 2JOZA 5CYBA 2OFRX 1G74A 1X8OA 3EM0A 4GU8A 5FFHA 3KFIA 2WWPA 4YKMA 3D95A 3QKGA 2G78A 4ZJ0A 3BX7A 3O2YA 1O1UA 4O3WA 1GT3A 3P6FA 4TKJA 4XMFA 2A3FX 4U8UM 5HZQA 2RN4A 4ZHDA 1NP4A 2K62A 4L3RA 4INNA 2NP1A 4HPDA 3ZUOA 5KICA 4AW8A 3TGAA 1EIIA 2RA6A 4ORUA 4LZUA 5F6BA 4A1HA 5LJEA 2WQ9A 1TW4A 2KD2A 4RUUA 2FS6A 3WOVA 1BLRA 3BY0A 3IFBA 3NBXX 2FR2A 5EEEA 3Q6LA 2X46A 4JGLA 4I9SA 1EI5A 3PP6A 3ZQ3A 5D45A 4LKPA 1X8UA 4BOEA 3KZAA 2IFBA 4ML7B 3C78X 3B2JA 1GT5A 3HOEA 1BBPA 4K19A 1JJXA 2AKQA 3LV4A 4ZH9A 5K06A 3FA9A 4FGIB 4A60A 4HWMA 3IA8A 1CBIA 4IB7A 1ERBA 5LJDA 3FA7A 1H91A 4EDEA 3G7XA 1YP7A 4COTA 2Q39A 4NNSA 1LNMA 4TNNA 3U9PC 3K3LA 3FW5A 2QO5A 3RWXA 1I04A 2LA7A 4ZFXA 5HTDA 3D97A 5IO5A 3NQ3A 3NADA 3FEPA 3V8UA 1T8VA 3BSZE 3MBTA 2RCTA 5BVTA 1YWCA 5LJCA 3FELA 1AELA 4IAXA 5D4AA 4YMYA 1KT5A 5BVQA 1B56A 4N7DA 4O3ZA 1XKIA 1GT4A 3FENA 4D6AA 1KQWA 3HK1A 3NR3A 2WUTA 5BVSA 2Q4NA 4GE1A 2Z4IA 3APVA 2RQ0A 3CQNA 2AT6X 1QQSA 1BRQA 3CWKA 1DFVA 3EYCA 4U8UO 3LHNA 1Z24A 3P02A 5AJBA 4FBVA 3WJDA 2LB6A 3PH6A 2P8GA 3GAQA 4IABA 4YGZA 4ODDA 4GNYA 4FBOA 2ZAGA 4GZVA 1VYFA 4AZRA 2W2BA 4U9CA 2ACOA 1FELA 2L68A 2QO4A 4YCHA 1KZXA 4DQ4A 3FEKA 5LJHA 5B29A 4UU3A 4IAWA 4Y0QA 3DTQA 1XCAA 1B0OA 1SA8A 3FR5A 3GE2A 1MX7A 2HMBA 5HA0A 2LBAA 1A18A 3STKA 1KGLA 3VG7A 1YWBA 2WQAE 3JQOA 5HZ9A 5H8TA 1FEMA 1YWAA 3ZUIA 3FLLA 5DPQA 1VPRA 2L9CA 4QGWA 2OVAA 3PH5A 1AB0A 2AT3X 4AZQA 5D48A 1HBPA 1SY3A 4ORRA 1BWYA 4M6SA 4OMWA 3UAQA 1BRPA 4PJ2A 4MVLA 1PBOA 4ZHHA 1OEEA 1R0UA 1ZNHA 1CBRA 1ICMA 3FW4A 1LPJA 2OZQA 3OBLA 1HMTA 4O3XB 2OVDA 1Y9LA 2Q9SA 1HBQA 4TJZA 1TVQA 3BRNA 5EDCA 1Y9TA 5AEOA 3VG3A 3BX8A 2CZUA 4WFUA 4HPAA 3APXA 2PY1A 4Y0RA 1GX9A 3FYFA 1E06A 1E02A 2M4LA 2Q2MA 4I3DA 1GX8A 2FRSA 2F73A 3ZW2A 1YP6A 3S5VA 4I3BA 2R74A 5HZ6A 1KZWA 1X71A 4AYHA 4KIIA 4YBUA 1QG5A 1ZRYA 4EFGA 3BDRA 5HA1A 3ZZVA 4MVEA 3FMZA 5LJBA 2JU8A 5EDBA 4ZHGA 1P6PA 1BSYA 3TGCA 3S60A 4U8UN 4YGGA 3VE2A 2F09A 4GH7A 4YCEA 1CJ5A 5EPQA 3SAOA 1E5PA 2Z4HA 3PQSA 5LJGA 4D6BA 1IFCA 3JS1A 5F7GA 2NNEA 5FQ6E 2LFOA 4GK9A 4ALBA 4QNIA 1B4MA 2JU7A 1EW3A 2NNQA 4YBPA 2JW1A 4WHIA 2K23A 2OVSA 2MHDA 2YG2A 3F6ZB 5H9AA 3FR4A 1KT6A 2MO5A 1JBHA 3BLGA 5HWZA 1GM6A 2FWVA 3NQ9A 1O1VA 3HWEA 4IB9A 1BSOA 5D8JA 2POAA 1U18A 1GKAB 4I3CA 1ZNLA 2GJ5A 4TQ2A 1DZKA 3TZSA 2W2FA 5L8OA 3VU1A 1IKEA 2KTSA 3P6GA 5IO7A 4YDBA 1SXWA 3EBWA 4FBRA 1QFVA 1I05A 3P24A 3PPTA 1SXUA 2AL0X 2QM9A 4HPCA 5FQ8E 3EBKA 5KIDA 1JV4A 2L5PA 4O4SA 4MVIA 1QY1A 1KXOA 3EMMA 4NP1A 1TOWA 4ALOA 3F8AA 4HPBA 4MVKA 2MWHA 3S5XA 3S26A 2A13A 3ZWEA 1OBQA 3HWFA 3HWDA 2LBVA 3HTYA 5FQ7E 1IIUA 3ZW1B 1CBSA 1IKJA 1EIOA 1OPBA 1CRBA 2G79A 3OE3A 4KC7A 1G5WA 2KTDA 1GXAA 1QFTA 4O4XA 1ZNKA 3O22A 4IBAA 1GGLA 4ZR2A 3WVMA 5LJKA 5L8IA 3APUA 5EEDA 1FDQA 1JZUA 2KW1A 1ICNA 2GTLM 1RLBE 2A2GA 4AZOA 3U0DA 3VG4A 2BS5A 1KOIA 2BT9A 1EPAA 1ZNEA 2GTLN 1ZNGA 3FR2A 3NPOA 3HOLA 4XMDA 1ERXA 3RBYA 2E4JA 1ALBA 4QAEA 5HCCC 3CBSA 2WEXA 4YFRA 3WJEA 3ZW1A 4YFQA 3WJBA 3CR6A 5LKEA 4NW4A 4ORWA 1SXYA 4OS3A 3PECA 3WXQA 3CMPA 3FA8A 4IB8A 3WJGA 4NLJA 3ZW0B 4Y0PA 3FIQA 4O9SA 3WBGA 2R73A 3OD9A 4QZUA 4UU2A 3ZI8A 1YIVA 2KT4B 2MM3A 1LFOA 4YGHA 1S44A 1X8NA 3BU1A 4ZHFA 2ANSA 3UEVA 5H9NA 1AVGI 1L6MA 3UEUA 4KC8A 2X8TA 1DV9A 1QABE 1D3SA 1X8QA 2W2AA 5L8NA 1EALA 1QY2A 4MISA 5F58A 3VG5A 3P6DA 4AZMA 1JJJA 3KFHA 1DC9A 1LIFA 1FTPA 1O8VA 1ZNDA 3RSWA 5CE4A 3AKNA 5HCEC 1BSQA 5C0NA 2JN3A 3ZW0A 1NP1A 3C76X 1G7NA 2O62A 1KT7A 1PEEA 4ZGFA 3MVFA 5EZ2A 2CZTA 2G7BA 2Q2PA 3RKGA 5F6ZA 1U0XA 4GDZA 2MJIA 3E3CA 1OBUA 1CBQA 4NYRA 3RZYA 5AJCA 2R56A 5F1EA 4CSBA 4CV7A 1LIDA 3DSZA 3BU9A 2L67A 3WJFA 1IW2A 4QRLA 2GTLO 3B2LA 4GKCA 4CK4A 3P6EA 3SOTA 5H9KA 4GETA 3KQ0A 1UREA 2LKKA 2BS6A 3PQUA 2AT8X 4XMHA 1BEBA 4L1NA 4U3QA 4N7CA 4TKBA 4IMOA 3STMX 1GT1A 1U17A 3L4RA 4I6SA 1DZJA 3VPJE 3B2HA 4ZGUA 2ACPX 2NNDA 4BQUA 1QWDA 4O4UA 4OMXA 2WSJA 3AKMA 4NYQA 1AQBA 4ZH6A 1BM5A 3C77X 4GRJA 2CM4A 4O49A 2HZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKT A;  3APW A;  1N0S A;  1KT4 A;  4QGV A;  3P6H A;  4QZT A;  4QYP A;  2N93 A;  3JSQ A;  1LF7 A;  4IB6 A;  5AQ6 A;  2RCQ A;  1OBP A;  1OEJ A;  2FS7 A;  2XKL A;  3PED A;  1HN2 A;  2HZR A;  2A2U A;  4XMC A;  4PSQ A;  3UEX A;  1UZ2 X;  5HZ8 A;  1A2D A;  2AMM X;  1YUP A;  1I06 A;  2WR6 A;  5HCD C;  5HZ5 A;  2BLG A;  1A3Y A;  1KT3 A;  4LZV A;  3VG6 A;  1BJ7 A;  1S7D A;  4GNW A;  1EXS A;  2GC9 A;  3F9D A;  2ALL X;  1TXL A;  4YKO A;  4AZN A;  1ADL A;  4ARH A;  4DQ3 A;  3P6C A;  1GKA A;  1VYG A;  1PMP A;  2AT5 X;  4YDA A;  1MUP A;  3B2I A;  2DM5 A;  4R0B A;  1EUO A;  1SY2 A;  4XMG A;  3OJY C;  3I0A A;  4YH0 A;  1HMS A;  1DZP A;  2WEW A;  4WFV A;  1I4U A;  4QGX A;  3B2K A;  4AZP A;  4A1Y A;  4IMN A;  1ACD A;  1YWD A;  1TOU A;  5LKF A;  4ORX A;  2CM9 A;  2ASN X;  3U03 A;  2HNX A;  5HBS A;  4M7M A;  5B27 A;  1X89 A;  1MVG A;  1NGL A;  5D47 A;  1JYJ A;  3KFG A;  4A8Z A;  2OVE A;  3KFF A;  4EXZ A;  1LIC A;  5IO6 A;  4NLI A;  5HTE A;  1MDC A;  4OS0 A;  2GTF X;  4Y0S A;  1G85 A;  2AT0 X;  3I17 A;  4RUN A;  3ELZ A;  5KHP A;  4ORY A;  4XME A;  2FT9 A;  3O19 A;  4HFO A;  4ES7 A;  3BS2 A;  5H9L A;  1T68 X;  1OPA A;  2HLV A;  1D2U A;  3CQR A;  1LIB A;  3FA6 A;  3HWG A;  3WJC A;  2QO6 A;  3NX1 A;  4BVM A;  1SY0 A;  1DZM A;  1JYD A;  4ZHC A;  1B8E A;  3UEW A;  2FR3 A;  1OEK A;  3T1D A;  3CBC A;  4TKH A;  4NNT A;  4ZCB A;  4ORS A;  1EQD A;  3NP1 A;  4I9R A;  3STN A;  5FEN A;  1SY1 A;  2QOS C;  1IFB A;  1A57 A;  1T0V A;  1X8P A;  2XST A;  1SXX A;  1S2P A;  3VG2 A;  2FTB A;  2CBS A;  1KQX A;  1E00 A;  2CBR A;  5DG4 A;  2A0A A;  2OFM X;  3D96 A;  2AH7 X;  3TGB A;  1QY0 A;  2JU3 A;  2RD7 C;  1ML7 A;  1HQP A;  3TF6 A;  5FAZ A;  4OS8 A;  1FE3 A;  1RBP A;  4EEJ A;  1EPB A;  2FLJ A;  1DF3 A;  1PM1 X;  1HMR A;  3ELX A;  5JR8 A;  1FEN A;  4TLJ A;  4WBK A;  3NX2 A;  5HAE A;  1LKE A;  4QYN A;  1LIE A;  4YFP A;  1MX8 A;  2HYS A;  2EU7 X;  2X45 A;  2JOZ A;  2OFR X;  1G74 A;  1X8O A;  3EM0 A;  5FFH A;  3KFI A;  2WWP A;  4YKM A;  3D95 A;  3QKG A;  2G78 A;  4ZJ0 A;  3BX7 A;  3O2Y A;  1O1U A;  1GT3 A;  3P6F A;  4TKJ A;  4XMF A;  2A3F X;  5HZQ A;  4ZHD A;  1NP4 A;  2K62 A;  2NP1 A;  4HPD A;  3ZUO A;  5KIC A;  4AW8 A;  3TGA A;  1EII A;  2RA6 A;  4ORU A;  4LZU A;  5F6B A;  4A1H A;  5LJE A;  2WQ9 A;  1TW4 A;  1BLR A;  4RUU A;  2FS6 A;  3BY0 A;  3IFB A;  5EEE A;  2FR2 A;  3Q6L A;  2X46 A;  4I9S A;  3PP6 A;  3ZQ3 A;  5D45 A;  4LKP A;  1X8U A;  4BOE A;  3KZA A;  2IFB A;  3C78 X;  3B2J A;  1GT5 A;  1BBP A;  4K19 A;  1JJX A;  2AKQ A;  4ZH9 A;  5K06 A;  3FA9 A;  4A60 A;  3IA8 A;  1CBI A;  4IB7 A;  1ERB A;  5LJD A;  3FA7 A;  1H91 A;  4EDE A;  3G7X A;  1YP7 A;  2Q39 A;  4NNS A;  1LNM A;  4TNN A;  3U9P C;  3K3L A;  3FW5 A;  2QO5 A;  1I04 A;  4ZFX A;  5HTD A;  3D97 A;  5IO5 A;  3NQ3 A;  3NAD A;  3FEP A;  1T8V A;  3BSZ E;  3MBT A;  2RCT A;  5BVT A;  1YWC A;  5LJC A;  3FEL A;  1AEL A;  4IAX A;  5D4A A;  4YMY A;  1KT5 A;  5BVQ A;  1B56 A;  4N7D A;  1XKI A;  1GT4 A;  3FEN A;  4D6A A;  1KQW A;  3HK1 A;  3NR3 A;  2WUT A;  5BVS A;  2Q4N A;  4GE1 A;  3APV A;  2RQ0 A;  3CQN A;  2AT6 X;  1QQS A;  1BRQ A;  3CWK A;  1DFV A;  3EYC A;  1Z24 A;  3WJD A;  2LB6 A;  3PH6 A;  2P8G A;  3GAQ A;  4YGZ A;  4ODD A;  4GNY A;  4AZR A;  1VYF A;  2W2B A;  2ACO A;  1FEL A;  2L68 A;  2QO4 A;  4YCH A;  1KZX A;  4DQ4 A;  3FEK A;  5LJH A;  5B29 A;  4UU3 A;  4IAW A;  4Y0Q A;  3DTQ A;  1XCA A;  1B0O A;  1SA8 A;  3FR5 A;  1MX7 A;  2HMB A;  5HA0 A;  2LBA A;  1A18 A;  3STK A;  1KGL A;  3VG7 A;  1YWB A;  2WQA E;  5HZ9 A;  5H8T A;  1FEM A;  1YWA A;  3ZUI A;  3FLL A;  5DPQ A;  1VPR A;  2L9C A;  4QGW A;  2OVA A;  3PH5 A;  1AB0 A;  2AT3 X;  4AZQ A;  5D48 A;  1HBP A;  1SY3 A;  4ORR A;  1BWY A;  4M6S A;  4OMW A;  1BRP A;  4MVL A;  1PBO A;  4ZHH A;  1OEE A;  1R0U A;  1ZNH A;  1CBR A;  1ICM A;  3FW4 A;  1LPJ A;  2OZQ A;  1HMT A;  2OVD A;  2Q9S A;  1HBQ A;  4TJZ A;  1TVQ A;  3BRN A;  5EDC A;  3VG3 A;  3BX8 A;  2CZU A;  4WFU A;  4HPA A;  3APX A;  2PY1 A;  4Y0R A;  1GX9 A;  1E06 A;  1E02 A;  2Q2M A;  4I3D A;  1GX8 A;  2FRS A;  2F73 A;  1YP6 A;  4I3B A;  2R74 A;  5HZ6 A;  1KZW A;  1X71 A;  4AYH A;  4KII A;  4YBU A;  1QG5 A;  1ZRY A;  4EFG A;  3BDR A;  5HA1 A;  3FMZ A;  5LJB A;  2JU8 A;  5EDB A;  4ZHG A;  1P6P A;  1BSY A;  3TGC A;  4YGG A;  4GH7 A;  4YCE A;  1CJ5 A;  5EPQ A;  3SAO A;  1E5P A;  5LJG A;  4D6B A;  1IFC A;  3JS1 A;  5F7G A;  2NNE A;  2LFO A;  4ALB A;  1B4M A;  2JU7 A;  1EW3 A;  2NNQ A;  4YBP A;  2K23 A;  2YG2 A;  5H9A A;  3FR4 A;  1KT6 A;  2MO5 A;  1JBH A;  3BLG A;  5HWZ A;  1GM6 A;  2FWV A;  3NQ9 A;  1O1V A;  3HWE A;  4IB9 A;  1BSO A;  5D8J A;  2POA A;  1U18 A;  1GKA B;  4I3C A;  1ZNL A;  2GJ5 A;  4TQ2 A;  1DZK A;  3TZS A;  2W2F A;  5L8O A;  1IKE A;  3P6G A;  5IO7 A;  4YDB A;  1SXW A;  3EBW A;  1QFV A;  1I05 A;  3PPT A;  1SXU A;  2AL0 X;  2QM9 A;  4HPC A;  3EBK A;  5KID A;  1JV4 A;  2L5P A;  4MVI A;  1QY1 A;  1KXO A;  3EMM A;  4NP1 A;  1TOW A;  4ALO A;  3F8A A;  4HPB A;  4MVK A;  3S26 A;  2A13 A;  1OBQ A;  3HWF A;  3HWD A;  2LBV A;  1IIU A;  1CBS A;  1IKJ A;  1EIO A;  1OPB A;  1CRB A;  2G79 A;  1G5W A;  2KTD A;  1GXA A;  1QFT A;  1ZNK A;  3O22 A;  4IBA A;  1GGL A;  4ZR2 A;  3WVM A;  5LJK A;  5L8I A;  3APU A;  5EED A;  1FDQ A;  1JZU A;  1ICN A;  1RLB E;  2A2G A;  4AZO A;  3U0D A;  3VG4 A;  1KOI A;  1EPA A;  1ZNE A;  1ZNG A;  3FR2 A;  3NPO A;  4XMD A;  1ERX A;  2E4J A;  1ALB A;  4QAE A;  5HCC C;  3CBS A;  2WEX A;  4YFR A;  3WJE A;  4YFQ A;  3WJB A;  3CR6 A;  5LKE A;  4ORW A;  1SXY A;  4OS3 A;  3PEC A;  3WXQ A;  3CMP A;  3FA8 A;  4IB8 A;  3WJG A;  4NLJ A;  4Y0P A;  3FIQ A;  4O9S A;  3WBG A;  2R73 A;  4QZU A;  4UU2 A;  1YIV A;  2KT4 B;  2MM3 A;  1LFO A;  4YGH A;  1S44 A;  1X8N A;  3BU1 A;  4ZHF A;  2ANS A;  3UEV A;  5H9N A;  1AVG I;  1L6M A;  3UEU A;  1DV9 A;  1QAB E;  1D3S A;  1X8Q A;  2W2A A;  5L8N A;  1EAL A;  1QY2 A;  5F58 A;  3VG5 A;  3P6D A;  4AZM A;  1JJJ A;  3KFH A;  1DC9 A;  1LIF A;  1FTP A;  1O8V A;  1ZND A;  3RSW A;  5CE4 A;  3AKN A;  5HCE C;  1BSQ A;  5C0N A;  2JN3 A;  1NP1 A;  3C76 X;  1G7N A;  2O62 A;  1KT7 A;  1PEE A;  3MVF A;  5EZ2 A;  2CZT A;  2G7B A;  2Q2P A;  5F6Z A;  1U0X A;  2MJI A;  1OBU A;  1CBQ A;  4NYR A;  3RZY A;  2R56 A;  5F1E A;  1LID A;  3DSZ A;  3BU9 A;  2L67 A;  3WJF A;  1IW2 A;  3B2L A;  4GKC A;  4CK4 A;  3P6E A;  5H9K A;  4GET A;  3KQ0 A;  1URE A;  2LKK A;  2AT8 X;  4XMH A;  1BEB A;  4N7C A;  4TKB A;  4IMO A;  3STM X;  1GT1 A;  1U17 A;  3L4R A;  1DZJ A;  3B2H A;  4ZGU A;  2ACP X;  2NND A;  4BQU A;  1QWD A;  4OMX A;  2WSJ A;  3AKM A;  4NYQ A;  1AQB A;  4ZH6 A;  1BM5 A;  3C77 X;  4GRJ A;  2CM4 A;  2HZQ A; 
#chains in the Genus database with same CATH topology
 4EQA C;  5BYP A;  4LKT A;  3APW A;  3MG5 A;  1N0S A;  2ZAI A;  1KT4 A;  4QGV A;  3P6H A;  4QZT A;  2FHN X;  3VE1 A;  2OL6 O;  2N93 A;  3JSQ A;  3N91 A;  1LF7 A;  1MM9 A;  4QYP A;  3H3I A;  4IB6 A;  1SWQ A;  1I9H A;  5AQ6 A;  2RCQ A;  1OBP A;  1OEJ A;  4OEL A;  3PK2 A;  2OYB O;  1VWB B;  2FS7 A;  2VFB A;  2XKL A;  1HN2 A;  2HZR A;  3PED A;  3RE5 A;  2A2U A;  4XMC A;  4PSQ A;  3UEX A;  2QMI A;  1UZ2 X;  5HZ8 A;  1A2D A;  2AMM X;  1YUP A;  1I06 A;  2WR6 A;  5HCD C;  5HZ5 A;  2BLG A;  1N9Y A;  2RTB B;  1A3Y A;  3WZP A;  1KT3 A;  4LZV A;  3VG6 A;  1BJ7 A;  1S7D A;  2C1Q A;  4GNW A;  4U46 A;  1EXS A;  2GC9 A;  3F9D A;  2ALL X;  3NQK A;  1TXL A;  4YKO A;  4AZN A;  1ADL A;  4ARH A;  4DQ3 A;  3P6C A;  1GKA A;  1OSP O;  1PMP A;  1VYG A;  2AT5 X;  1MEP A;  4YDA A;  1MUP A;  3B2I A;  2DM5 A;  4R0B A;  1EUO A;  1SY2 A;  3T2X A;  4XMG A;  3OJY C;  1DV9 A;  2QCB A;  4FQB B;  3I0A A;  1SWN A;  4YH0 A;  5B3M O;  2X32 A;  4BX7 B;  1HMS A;  1DZP A;  1RAV A;  1VWL B;  2WEW A;  4WFV A;  1IJ8 A;  1I4U A;  4QGX A;  3B2K A;  3WYP A;  4AZP A;  4A1Y A;  4IMN A;  1ACD A;  1YWD A;  1TOU A;  1LCZ A;  1VWI B;  4ORX A;  2CM9 A;  5LKF A;  2ASN X;  5IRW A;  3U03 A;  2HNX A;  4LQZ A;  5HBS A;  1VWJ B;  4M7M A;  5B27 A;  4ON1 A;  2IZK A;  1X89 A;  1MVG A;  1NGL A;  2YMS A;  2JMB A;  5D47 A;  3MX7 A;  4O3Y A;  1JYJ A;  1W6F A;  2IZD B;  3KFG A;  4Y59 A;  4A8Z A;  2OVE A;  4GGZ A;  3KFF A;  4EXZ A;  1LIC A;  5IO6 A;  4NLI A;  5HTE A;  1MDC A;  3D4R A;  4OS0 A;  2GTF X;  4Y0S A;  1STR B;  1G85 A;  2AT0 X;  3I17 A;  4RUN A;  3ELZ A;  2X8F A;  2AVI A;  4ORY A;  5B11 O;  5KHP A;  4XME A;  1K24 A;  2FT9 A;  4BX7 A;  3O19 A;  3RDQ A;  1SWG A;  1VYO A;  2RTF B;  1SWF A;  3AEH A;  3BS2 A;  4HFO A;  2RTC B;  4ID2 A;  5H9L A;  1T68 X;  1OPA A;  2HLV A;  1D2U A;  1SWE A;  3CQR A;  4KCA A;  1LIB A;  4KH8 A;  3FA6 A;  3HWG A;  3WJC A;  2QO6 A;  1VWK B;  3NX1 A;  1I78 A;  4BVM A;  4I95 A;  1VWC B;  1SY0 A;  1DZM A;  4BGF A;  1JYD A;  2Y3F A;  4KT5 A;  1B8E A;  3UEW A;  4ZHC A;  2FR3 A;  1OEK A;  3T1D A;  3CBC A;  4TKH A;  4NNT A;  4ZCB A;  4ORS A;  1EQD A;  3KVN A;  3NP1 A;  4I9R A;  3STN A;  5FEN A;  1SY1 A;  2QOS C;  1IFB A;  1SRE A;  4GGR A;  4BX6 A;  1T0V A;  1A57 A;  1X8P A;  3FDC A;  2XST A;  1SXX A;  2BHV A;  1S2P A;  3VG2 A;  2FTB A;  2CBS A;  3SZJ A;  1HXZ A;  4O4O A;  1KQX A;  1E00 A;  2X8S A;  2CBR A;  1UYO X;  2A0A A;  2G5L A;  2OFM X;  3D96 A;  5DG4 A;  2AH7 X;  2RTN B;  1QY0 A;  3TGB A;  2JU3 A;  2RD7 C;  1JIW I;  1ML7 A;  4CPE A;  1HQP A;  3TF6 A;  5CSE A;  5FAZ A;  4OS8 A;  1FE3 A;  1RBP A;  4EEJ A;  1EPB A;  2FLJ A;  1DF3 A;  1PM1 X;  3SLT A;  1HMR A;  2IZH B;  3ELX A;  5JR8 A;  1FEN A;  4TLJ A;  4WBK A;  3NX2 A;  4Z6J A;  5HAE A;  1LKE A;  1Y0G A;  4QYN A;  1LIE A;  4YFP A;  1SMP I;  5K67 A;  1MX8 A;  4MIR A;  2HYS A;  2EU7 X;  2RTR B;  1SLF B;  4QQ1 A;  2X45 A;  1VWD B;  2JOZ A;  5CYB A;  1SRF A;  2OFR X;  3T6F A;  4Z27 A;  2RTL A;  1G74 A;  1X8O A;  3EM0 A;  4GU8 A;  2OF9 A;  5FFH A;  3KFI A;  2WWP A;  1VWP B;  4YKM A;  3D95 A;  1VWH B;  3QKG A;  3VHM A;  2G78 A;  4CPH B;  4ZJ0 A;  3BX7 A;  3O2Y A;  1O1U A;  4O3W A;  1GT3 A;  1NDJ A;  3P6F A;  1SWB A;  4TKJ A;  4XMF A;  1KL3 A;  2A3F X;  4U8U M;  5HZQ A;  2RN4 A;  4ZHD A;  4YVB A;  1NP4 A;  3FID A;  2K62 A;  1VWN B;  1LEL A;  4INN A;  4L3R A;  2RTH B;  2NP1 A;  1AVD A;  4HPD A;  3ZUO A;  5KIC A;  1KFF A;  1LCW A;  4AW8 A;  1N4J A;  3TGA A;  1EII A;  2RA6 A;  2UYW A;  4ORU A;  4LZU A;  5F6B A;  4A1H A;  5LJE A;  1Y53 X;  2WQ9 A;  1TW4 A;  2KD2 A;  2UZ2 A;  2FS6 A;  4RUU A;  3WOV A;  3BY0 A;  3IFB A;  3NBX X;  2FR2 A;  2JGS A;  3Q6L A;  2X46 A;  4JGL A;  1N9M A;  1Y52 X;  5EEE A;  1HY2 A;  1EI5 A;  4I9S A;  3PP6 A;  3ZQ3 A;  5D45 A;  4LKP A;  1X8U A;  4BOE A;  1N7Y A;  3KZA A;  2I5Z O;  2IFB A;  3CKF A;  1WBI A;  5IRU A;  4ML7 B;  3WZO A;  1SRH A;  3B2J A;  3C78 X;  1GT5 A;  3HOE A;  1BBP A;  2OY8 A;  4K19 A;  1JJX A;  1RST B;  2AKQ A;  3LV4 A;  4ZH9 A;  5K06 A;  1MOY A;  3FA9 A;  4BBO A;  4FGI B;  2OY5 O;  4A60 A;  4HWM A;  3IA8 A;  1CBI A;  4IB7 A;  1ERB A;  5LJD A;  3FA7 A;  1H91 A;  4EDE A;  3G7X A;  1YP7 A;  4COT A;  1LUQ A;  2Q39 A;  4NNS A;  1LNM A;  4TNN A;  3U9P C;  3K3L A;  3FW5 A;  4BJ8 A;  2QO5 A;  3RWX A;  1I04 A;  2LA7 A;  4ZFX A;  5HTD A;  3D97 A;  5B5F A;  5IO5 A;  3NQ3 A;  3NAD A;  3FEP A;  3RDS A;  1SWH A;  1T8V A;  3V8U A;  1STS B;  1VWM B;  3BSZ E;  3MBT A;  2RCT A;  5BVT A;  1YWC A;  5LJC A;  3FEL A;  1AEL A;  4IAX A;  4BCS A;  5D4A A;  3CKG A;  2A8G A;  1NC9 A;  3RDX A;  4YMY A;  1KT5 A;  5BVQ A;  1B56 A;  4N7D A;  4O3Z A;  3SZH A;  1XKI A;  1WUB A;  1GT4 A;  3FEN A;  4D6A A;  1KQW A;  3HK1 A;  3NR3 A;  2WUT A;  5BVS A;  2Q4N A;  4GE1 A;  1RSU B;  2Z4I A;  3APV A;  2RQ0 A;  3CQN A;  2AT6 X;  4GD9 A;  1QQS A;  1BRQ A;  2OL7 A;  1DFV A;  3CWK A;  3EYC A;  4U8U O;  4DNE A;  1GX3 A;  3LHN A;  1Z24 A;  2HKD A;  4Z2P A;  3P02 A;  5AJB A;  4FBV A;  5L3Y A;  3WJD A;  2RTA A;  2LB6 A;  3PH6 A;  2P8G A;  3GAQ A;  4IAB A;  4YGZ A;  4ODD A;  3ZUI A;  4GNY A;  1KL4 A;  2ZSC A;  4FBO A;  2ZAG A;  4GZV A;  1VYF A;  4AZR A;  3MM0 A;  1VWR B;  1W5R A;  2W2B A;  3RE6 A;  4U9C A;  2ACO A;  1FEL A;  2L68 A;  2QO4 A;  4YCH A;  4B55 A;  4NV8 A;  2X56 A;  4JNJ A;  4DQ4 A;  3FEK A;  5H8T A;  5B29 A;  5LJH A;  1KZX A;  2X4M A;  4UU3 A;  4IAW A;  3T2W A;  4Y0Q A;  2Y3E A;  2RTJ A;  2FGS A;  4GJS A;  3DTQ A;  3VGW A;  1XCA A;  1B0O A;  1SA8 A;  2A5B A;  3FR5 A;  3GE2 A;  1MX7 A;  2HMB A;  5HA0 A;  2LBA A;  3WZQ A;  1A18 A;  3STK A;  1KGL A;  3VG7 A;  1YWB A;  2WQA E;  3JQO A;  5HZ9 A;  1SWK A;  1FEM A;  1YWA A;  2IZG B;  1UYN X;  3FLL A;  1VPR A;  1FJ1 E;  1VWA B;  2L9C A;  4QGW A;  5DPQ A;  4BX5 B;  2OVA A;  3PH5 A;  1B4M A;  1AB0 A;  2AT3 X;  2OFB A;  5K68 A;  4AZQ A;  5D48 A;  1HBP A;  1SY3 A;  4ORR A;  1SWJ A;  1BWY A;  5IRA A;  4M6S A;  1KL5 A;  1LDO A;  1SWO A;  4OMW A;  3UAQ A;  1BRP A;  4PJ2 A;  4DCB A;  1K3B A;  1PBO A;  4MVL A;  2FKJ A;  4ZHH A;  1OEE A;  1R0U A;  2RTD B;  1ZNH A;  2BC3 A;  1CBR A;  1ICM A;  3FW4 A;  1LPJ A;  2OZQ A;  3OBL A;  1HMT A;  4I60 A;  2OVD A;  1SWT A;  1Y55 X;  1Y9L A;  2Q9S A;  4O3X B;  2IZA A;  4Z2O A;  1HBQ A;  4TJZ A;  1TVQ A;  1SRI A;  3BRN A;  5EDC A;  1Y9T A;  5AEO A;  3VG3 A;  3BX8 A;  2CZU A;  4WFU A;  4HPA A;  3APX A;  4CDE A;  2PY1 A;  4Y0R A;  1GX9 A;  3FYF A;  2RTK A;  1E06 A;  1E02 A;  1HQQ A;  1SWP A;  2M4L A;  2Q2M A;  4I3D A;  3EW1 A;  1GX8 A;  1SLG B;  5IXG A;  2BSZ A;  2DJG A;  2FRS A;  2Y32 A;  2F73 A;  3ZW2 A;  1YP6 A;  3S5V A;  4I3B A;  2R74 A;  2IZJ A;  4CPI A;  1RXH A;  1X71 A;  2AF5 A;  4AYH A;  5HZ6 A;  4KII A;  1KZW A;  1SWA A;  4MEE A;  2IZB A;  4YBU A;  1QG5 A;  1ZRY A;  2I5V O;  4EFG A;  1VWQ B;  3BDR A;  5HA1 A;  3WYQ A;  3ZZV A;  1SLE B;  4MVE A;  3FMZ A;  5LJB A;  2JU8 A;  5EDB A;  4ZHG A;  3HPE A;  1LCV A;  1P6P A;  1BSY A;  3Q34 A;  3TGC A;  3S60 A;  4U8U N;  4YGG A;  3VE2 A;  2F09 A;  4GH7 A;  4YCE A;  1CJ5 A;  5EPQ A;  3SAO A;  3WZN A;  1E5P A;  3X00 A;  2Z4H A;  4GDA A;  3PQS A;  5LJG A;  4D6B A;  1IFC A;  3JS1 A;  5F7G A;  2NNE A;  5FQ6 E;  2LFO A;  4GK9 A;  4ALB A;  4QNI A;  4CPF A;  5B2A O;  2JU7 A;  1EW3 A;  2NNQ A;  4GGT A;  2JW1 A;  4WHI A;  4YBP A;  2A5C A;  2K23 A;  2OVS A;  2MHD A;  1PBY A;  2YG2 A;  3F6Z B;  5H9A A;  1AVE A;  3FR4 A;  1KT6 A;  2MO5 A;  1JBH A;  3BLG A;  2OF8 A;  4CPH A;  5HWZ A;  3EW2 A;  1GM6 A;  2FWV A;  3RDU A;  3NQ9 A;  1O1V A;  3HWE A;  5CHK A;  3RDO A;  4IB9 A;  1BSO A;  5D8J A;  2POA A;  1U18 A;  1GKA B;  4I3C A;  1ZNL A;  2GJ5 A;  2OY1 O;  4TQ2 A;  1DZK A;  1E2T A;  3TZS A;  2W2F A;  5L8O A;  2CAM A;  3RDM A;  3VU1 A;  1IKE A;  2KTS A;  3P6G A;  4ES7 A;  5IO7 A;  4YDB A;  1SXW A;  3EBW A;  4Y5D A;  4FBR A;  1NQN A;  1PTS A;  1QFV A;  1I05 A;  3P24 A;  3PPT A;  1SXU A;  2AL0 X;  2QM9 A;  4HPC A;  5FQ8 E;  3EBK A;  5KID A;  1JV4 A;  2L5P A;  4O4S A;  4MVI A;  1QY1 A;  1KXO A;  3EMM A;  4NP1 A;  4CDF A;  2VDF A;  1TOW A;  2IZF B;  4ALO A;  3F8A A;  4HPB A;  4MVK A;  2MWH A;  3S5X A;  1SWC A;  2A13 A;  1HXL A;  3S26 A;  1OBQ A;  3VHI A;  3ZWE A;  3HWF A;  3HWD A;  2LBV A;  3HTY A;  5FQ7 E;  1IIU A;  3ZW1 B;  1CBS A;  1IKJ A;  4Z2V A;  2X55 A;  1VWF B;  1EIO A;  1OPB A;  1CRB A;  2G79 A;  1JQP A;  2FKG A;  3OE3 A;  4KC7 A;  1G5W A;  2GH7 A;  2KTD A;  3EC5 A;  4IRW A;  1GXA A;  1QFT A;  4O4X A;  1JMX A;  1ZNK A;  3O22 A;  4IBA A;  1GGL A;  4ZR2 A;  3WVM A;  5LJK A;  5L8I A;  3APU A;  5EED A;  1VWG B;  1FDQ A;  2RTO B;  1JZU A;  2KW1 A;  1ICN A;  2GTL M;  1JJU A;  1RLB E;  3LTW A;  2A2G A;  2C4I A;  1SWR A;  4AZO A;  3U0D A;  4JHQ A;  3VG4 A;  2BS5 A;  1KOI A;  1NQM A;  2BT9 A;  1EPA A;  1ZNE A;  1ZNG A;  2GTL N;  3FR2 A;  3NPO A;  3HOL A;  4XMD A;  1ERX A;  1DF8 A;  2E4J A;  1ALB A;  4GJV A;  4QAE A;  3RBY A;  2OL8 O;  3CBS A;  5HCC C;  2WEX A;  4YFR A;  3WJE A;  3ZW1 A;  4YFQ A;  3WJB A;  3CR6 A;  5LKE A;  4NW4 A;  4ORW A;  3AUM O;  1SXY A;  4OS3 A;  3PEC A;  3WXQ A;  5JD2 A;  3CMP A;  3FA8 A;  3RY2 A;  4IB8 A;  3WJG A;  4BX6 B;  4NLJ A;  2IZC B;  1RXJ A;  3ZW0 B;  4Y0P A;  3FIQ A;  4O9S A;  3WBG A;  2R73 A;  3OD9 A;  4QZU A;  4UU2 A;  3ZI8 A;  1YIV A;  2KT4 B;  2MM3 A;  1LFO A;  4YGH A;  1S44 A;  1X8N A;  3BU1 A;  4ZHF A;  2ANS A;  3UEV A;  5H9N A;  1AVG I;  3RY1 A;  1L6M A;  3UEU A;  4KC8 A;  2DJF A;  2QOM A;  2X8T A;  3PDF A;  1SLD B;  1QAB E;  1D3S A;  1LDQ A;  1SWL A;  1X8Q A;  2W2A A;  5L8N A;  1EAL A;  1QY2 A;  1SWS A;  3QQ2 A;  4MIS A;  5F2B A;  5F58 A;  3VHH A;  1VWE B;  3VG5 A;  3P6D A;  1SWU A;  1JMZ A;  4AZM A;  4Z28 A;  4CDD A;  1STP A;  1JJJ A;  2IZL B;  4NV7 A;  5B5G A;  3KFH A;  4GUZ A;  1DC9 A;  1LIF A;  1FTP A;  1O8V A;  1ZND A;  3RSW A;  5CE4 A;  3AKN A;  5HCE C;  1BSQ A;  5C0N A;  2RTI B;  2JN3 A;  3ZW0 A;  1NP1 A;  3C76 X;  1G7N A;  1VWO B;  2O62 A;  1KT7 A;  2RTE B;  1PEE A;  4ZGF A;  3MVF A;  2G8C O;  5EZ2 A;  1MK5 A;  2CZT A;  2G7B A;  2Q2P A;  2RTP B;  2IZI A;  1SRJ A;  5F6Z A;  1U0X A;  4GDZ A;  2MJI A;  3E3C A;  3RKG A;  1OBU A;  1CBQ A;  4NYR A;  4BX5 A;  2RTM A;  3RZY A;  3SLJ A;  2C1S A;  2IZE B;  2R56 A;  5AJC A;  5F1E A;  4CSB A;  4CV7 A;  1LID A;  3DSZ A;  3BU9 A;  1W4T A;  2L67 A;  3WJF A;  4C5P A;  2PI3 O;  1IW2 A;  1BLR A;  4QRL A;  2GTL O;  2X34 A;  3B2L A;  4OEM A;  4GKC A;  4CK4 A;  3P6E A;  3SOT A;  3D9W A;  5H9K A;  4GET A;  2OFA A;  3KQ0 A;  5B10 O;  1URE A;  2MF6 A;  2RTQ B;  2LKK A;  2BS6 A;  3PQU A;  2AT8 X;  4XMH A;  4OKA A;  2RTG B;  1BEB A;  4L1N A;  4U3Q A;  3T6L A;  1SWD A;  4CDC A;  4N7C A;  4TKB A;  3SZI A;  4IMO A;  3STM X;  1GT1 A;  1U17 A;  1SRG A;  3L4R A;  4I6S A;  4EKV A;  1DZJ A;  3VPJ E;  3B2H A;  4ZGU A;  2ACP X;  2NND A;  2FHL A;  4BQU A;  1QWD A;  2WPU A;  4O4U A;  4OMX A;  2WSJ A;  1RXK A;  3AKM A;  4NYQ A;  2VFC A;  4JO6 A;  1N43 A;  1AQB A;  4ZH6 A;  2F01 A;  3SLO A;  1BM5 A;  3C77 X;  4GRJ A;  2CM4 A;  1NBX A;  4O49 A;  2OY7 A;  2HZQ A; 
#chains in the Genus database with same CATH homology
 4EQA C;  5BYP A;  4LKT A;  3APW A;  1N0S A;  2ZAI A;  1KT4 A;  4QGV A;  3P6H A;  4QZT A;  3VE1 A;  4QYP A;  2N93 A;  3JSQ A;  3N91 A;  1LF7 A;  3H3I A;  4IB6 A;  5AQ6 A;  2RCQ A;  1OBP A;  1OEJ A;  2FS7 A;  2XKL A;  3PED A;  1HN2 A;  2HZR A;  2A2U A;  4XMC A;  4PSQ A;  3UEX A;  2QMI A;  1UZ2 X;  5HZ8 A;  1A2D A;  2AMM X;  1YUP A;  1I06 A;  2WR6 A;  5HCD C;  5HZ5 A;  2BLG A;  1A3Y A;  1KT3 A;  4LZV A;  3VG6 A;  1BJ7 A;  1S7D A;  4GNW A;  1EXS A;  2GC9 A;  3F9D A;  2ALL X;  3NQK A;  1TXL A;  4YKO A;  4AZN A;  1ADL A;  4ARH A;  4DQ3 A;  3P6C A;  1GKA A;  1VYG A;  1PMP A;  2AT5 X;  4YDA A;  1MUP A;  3B2I A;  2DM5 A;  4R0B A;  1EUO A;  1SY2 A;  4XMG A;  3OJY C;  4FQB B;  3I0A A;  4YH0 A;  1HMS A;  1DZP A;  2WEW A;  4WFV A;  1I4U A;  4QGX A;  3B2K A;  4AZP A;  4A1Y A;  4IMN A;  1ACD A;  1YWD A;  1TOU A;  5LKF A;  4ORX A;  2CM9 A;  2ASN X;  3U03 A;  2HNX A;  4LQZ A;  5HBS A;  4M7M A;  5B27 A;  4ON1 A;  1X89 A;  1MVG A;  1NGL A;  2YMS A;  2JMB A;  5D47 A;  3MX7 A;  4O3Y A;  1JYJ A;  3KFG A;  4A8Z A;  2OVE A;  3KFF A;  4EXZ A;  1LIC A;  5IO6 A;  4NLI A;  5HTE A;  1MDC A;  3D4R A;  4OS0 A;  2GTF X;  4Y0S A;  1G85 A;  2AT0 X;  3I17 A;  4RUN A;  3ELZ A;  2X8F A;  4ORY A;  5KHP A;  4XME A;  2FT9 A;  3O19 A;  4HFO A;  4ES7 A;  3BS2 A;  4ID2 A;  5H9L A;  1T68 X;  1OPA A;  2HLV A;  1D2U A;  3CQR A;  4KCA A;  1LIB A;  4KH8 A;  3FA6 A;  3HWG A;  3WJC A;  2QO6 A;  3NX1 A;  4BVM A;  4I95 A;  1SY0 A;  1DZM A;  1JYD A;  4KT5 A;  4ZHC A;  1B8E A;  3UEW A;  2FR3 A;  1OEK A;  3T1D A;  3CBC A;  4TKH A;  4NNT A;  4ZCB A;  4ORS A;  1EQD A;  3NP1 A;  4I9R A;  3STN A;  5FEN A;  1SY1 A;  2QOS C;  1IFB A;  1A57 A;  1T0V A;  1X8P A;  2XST A;  1SXX A;  2BHV A;  1S2P A;  3VG2 A;  2FTB A;  2CBS A;  4O4O A;  1KQX A;  1E00 A;  2X8S A;  2CBR A;  5DG4 A;  2A0A A;  2OFM X;  3D96 A;  2AH7 X;  3TGB A;  1QY0 A;  2JU3 A;  2RD7 C;  1JIW I;  1ML7 A;  1HQP A;  3TF6 A;  5FAZ A;  4OS8 A;  1FE3 A;  1RBP A;  4EEJ A;  1EPB A;  2FLJ A;  1DF3 A;  1PM1 X;  1HMR A;  3ELX A;  5JR8 A;  1FEN A;  4TLJ A;  4WBK A;  3NX2 A;  5HAE A;  1LKE A;  4QYN A;  1LIE A;  4YFP A;  1SMP I;  1MX8 A;  4MIR A;  2HYS A;  2EU7 X;  4QQ1 A;  2X45 A;  2JOZ A;  5CYB A;  2OFR X;  1G74 A;  1X8O A;  3EM0 A;  4GU8 A;  5FFH A;  3KFI A;  2WWP A;  4YKM A;  3D95 A;  3QKG A;  2G78 A;  4ZJ0 A;  3BX7 A;  3O2Y A;  1O1U A;  4O3W A;  1GT3 A;  3P6F A;  4TKJ A;  4XMF A;  2A3F X;  4U8U M;  5HZQ A;  2RN4 A;  4ZHD A;  1NP4 A;  2K62 A;  4L3R A;  4INN A;  2NP1 A;  4HPD A;  3ZUO A;  5KIC A;  4AW8 A;  3TGA A;  1EII A;  2RA6 A;  4ORU A;  4LZU A;  5F6B A;  4A1H A;  5LJE A;  2WQ9 A;  1TW4 A;  2KD2 A;  4RUU A;  2FS6 A;  3WOV A;  1BLR A;  3BY0 A;  3IFB A;  3NBX X;  2FR2 A;  5EEE A;  3Q6L A;  2X46 A;  4JGL A;  4I9S A;  1EI5 A;  3PP6 A;  3ZQ3 A;  5D45 A;  4LKP A;  1X8U A;  4BOE A;  3KZA A;  2IFB A;  4ML7 B;  3C78 X;  3B2J A;  1GT5 A;  3HOE A;  1BBP A;  4K19 A;  1JJX A;  2AKQ A;  3LV4 A;  4ZH9 A;  5K06 A;  3FA9 A;  4FGI B;  4A60 A;  4HWM A;  3IA8 A;  1CBI A;  4IB7 A;  1ERB A;  5LJD A;  3FA7 A;  1H91 A;  4EDE A;  3G7X A;  1YP7 A;  4COT A;  2Q39 A;  4NNS A;  1LNM A;  4TNN A;  3U9P C;  3K3L A;  3FW5 A;  2QO5 A;  3RWX A;  1I04 A;  2LA7 A;  4ZFX A;  5HTD A;  3D97 A;  5IO5 A;  3NQ3 A;  3NAD A;  3FEP A;  3V8U A;  1T8V A;  3BSZ E;  3MBT A;  2RCT A;  5BVT A;  1YWC A;  5LJC A;  3FEL A;  1AEL A;  4IAX A;  5D4A A;  4YMY A;  1KT5 A;  5BVQ A;  1B56 A;  4N7D A;  4O3Z A;  1XKI A;  1GT4 A;  3FEN A;  4D6A A;  1KQW A;  3HK1 A;  3NR3 A;  2WUT A;  5BVS A;  2Q4N A;  4GE1 A;  2Z4I A;  3APV A;  2RQ0 A;  3CQN A;  2AT6 X;  1QQS A;  1BRQ A;  3CWK A;  1DFV A;  3EYC A;  4U8U O;  3LHN A;  1Z24 A;  3P02 A;  5AJB A;  4FBV A;  3WJD A;  2LB6 A;  3PH6 A;  2P8G A;  3GAQ A;  4IAB A;  4YGZ A;  4ODD A;  4GNY A;  4FBO A;  2ZAG A;  4GZV A;  1VYF A;  4AZR A;  2W2B A;  4U9C A;  2ACO A;  1FEL A;  2L68 A;  2QO4 A;  4YCH A;  1KZX A;  4DQ4 A;  3FEK A;  5LJH A;  5B29 A;  4UU3 A;  4IAW A;  4Y0Q A;  3DTQ A;  1XCA A;  1B0O A;  1SA8 A;  3FR5 A;  3GE2 A;  1MX7 A;  2HMB A;  5HA0 A;  2LBA A;  1A18 A;  3STK A;  1KGL A;  3VG7 A;  1YWB A;  2WQA E;  3JQO A;  5HZ9 A;  5H8T A;  1FEM A;  1YWA A;  3ZUI A;  3FLL A;  5DPQ A;  1VPR A;  2L9C A;  4QGW A;  2OVA A;  3PH5 A;  1AB0 A;  2AT3 X;  4AZQ A;  5D48 A;  1HBP A;  1SY3 A;  4ORR A;  1BWY A;  4M6S A;  4OMW A;  3UAQ A;  1BRP A;  4PJ2 A;  4MVL A;  1PBO A;  4ZHH A;  1OEE A;  1R0U A;  1ZNH A;  1CBR A;  1ICM A;  3FW4 A;  1LPJ A;  2OZQ A;  3OBL A;  1HMT A;  4O3X B;  2OVD A;  1Y9L A;  2Q9S A;  1HBQ A;  4TJZ A;  1TVQ A;  3BRN A;  5EDC A;  1Y9T A;  5AEO A;  3VG3 A;  3BX8 A;  2CZU A;  4WFU A;  4HPA A;  3APX A;  2PY1 A;  4Y0R A;  1GX9 A;  3FYF A;  1E06 A;  1E02 A;  2M4L A;  2Q2M A;  4I3D A;  1GX8 A;  2FRS A;  2F73 A;  3ZW2 A;  1YP6 A;  3S5V A;  4I3B A;  2R74 A;  5HZ6 A;  1KZW A;  1X71 A;  4AYH A;  4KII A;  4YBU A;  1QG5 A;  1ZRY A;  4EFG A;  3BDR A;  5HA1 A;  3ZZV A;  4MVE A;  3FMZ A;  5LJB A;  2JU8 A;  5EDB A;  4ZHG A;  1P6P A;  1BSY A;  3TGC A;  3S60 A;  4U8U N;  4YGG A;  3VE2 A;  2F09 A;  4GH7 A;  4YCE A;  1CJ5 A;  5EPQ A;  3SAO A;  1E5P A;  2Z4H A;  3PQS A;  5LJG A;  4D6B A;  1IFC A;  3JS1 A;  5F7G A;  2NNE A;  5FQ6 E;  2LFO A;  4GK9 A;  4ALB A;  4QNI A;  1B4M A;  2JU7 A;  1EW3 A;  2NNQ A;  4YBP A;  2JW1 A;  4WHI A;  2K23 A;  2OVS A;  2MHD A;  2YG2 A;  3F6Z B;  5H9A A;  3FR4 A;  1KT6 A;  2MO5 A;  1JBH A;  3BLG A;  5HWZ A;  1GM6 A;  2FWV A;  3NQ9 A;  1O1V A;  3HWE A;  4IB9 A;  1BSO A;  5D8J A;  2POA A;  1U18 A;  1GKA B;  4I3C A;  1ZNL A;  2GJ5 A;  4TQ2 A;  1DZK A;  3TZS A;  2W2F A;  5L8O A;  3VU1 A;  1IKE A;  2KTS A;  3P6G A;  5IO7 A;  4YDB A;  1SXW A;  3EBW A;  4FBR A;  1QFV A;  1I05 A;  3P24 A;  3PPT A;  1SXU A;  2AL0 X;  2QM9 A;  4HPC A;  5FQ8 E;  3EBK A;  5KID A;  1JV4 A;  2L5P A;  4O4S A;  4MVI A;  1QY1 A;  1KXO A;  3EMM A;  4NP1 A;  1TOW A;  4ALO A;  3F8A A;  4HPB A;  4MVK A;  2MWH A;  3S5X A;  3S26 A;  2A13 A;  3ZWE A;  1OBQ A;  3HWF A;  3HWD A;  2LBV A;  3HTY A;  5FQ7 E;  1IIU A;  3ZW1 B;  1CBS A;  1IKJ A;  1EIO A;  1OPB A;  1CRB A;  2G79 A;  3OE3 A;  4KC7 A;  1G5W A;  2KTD A;  1GXA A;  1QFT A;  4O4X A;  1ZNK A;  3O22 A;  4IBA A;  1GGL A;  4ZR2 A;  3WVM A;  5LJK A;  5L8I A;  3APU A;  5EED A;  1FDQ A;  1JZU A;  2KW1 A;  1ICN A;  2GTL M;  1RLB E;  2A2G A;  4AZO A;  3U0D A;  3VG4 A;  2BS5 A;  1KOI A;  2BT9 A;  1EPA A;  1ZNE A;  2GTL N;  1ZNG A;  3FR2 A;  3NPO A;  3HOL A;  4XMD A;  1ERX A;  3RBY A;  2E4J A;  1ALB A;  4QAE A;  5HCC C;  3CBS A;  2WEX A;  4YFR A;  3WJE A;  3ZW1 A;  4YFQ A;  3WJB A;  3CR6 A;  5LKE A;  4NW4 A;  4ORW A;  1SXY A;  4OS3 A;  3PEC A;  3WXQ A;  3CMP A;  3FA8 A;  4IB8 A;  3WJG A;  4NLJ A;  3ZW0 B;  4Y0P A;  3FIQ A;  4O9S A;  3WBG A;  2R73 A;  3OD9 A;  4QZU A;  4UU2 A;  3ZI8 A;  1YIV A;  2KT4 B;  2MM3 A;  1LFO A;  4YGH A;  1S44 A;  1X8N A;  3BU1 A;  4ZHF A;  2ANS A;  3UEV A;  5H9N A;  1AVG I;  1L6M A;  3UEU A;  4KC8 A;  2X8T A;  1DV9 A;  1QAB E;  1D3S A;  1X8Q A;  2W2A A;  5L8N A;  1EAL A;  1QY2 A;  4MIS A;  5F58 A;  3VG5 A;  3P6D A;  4AZM A;  1JJJ A;  3KFH A;  1DC9 A;  1LIF A;  1FTP A;  1O8V A;  1ZND A;  3RSW A;  5CE4 A;  3AKN A;  5HCE C;  1BSQ A;  5C0N A;  2JN3 A;  3ZW0 A;  1NP1 A;  3C76 X;  1G7N A;  2O62 A;  1KT7 A;  1PEE A;  4ZGF A;  3MVF A;  5EZ2 A;  2CZT A;  2G7B A;  2Q2P A;  3RKG A;  5F6Z A;  1U0X A;  4GDZ A;  2MJI A;  3E3C A;  1OBU A;  1CBQ A;  4NYR A;  3RZY A;  5AJC A;  2R56 A;  5F1E A;  4CSB A;  4CV7 A;  1LID A;  3DSZ A;  3BU9 A;  2L67 A;  3WJF A;  1IW2 A;  4QRL A;  2GTL O;  3B2L A;  4GKC A;  4CK4 A;  3P6E A;  3SOT A;  5H9K A;  4GET A;  3KQ0 A;  1URE A;  2LKK A;  2BS6 A;  3PQU A;  2AT8 X;  4XMH A;  1BEB A;  4L1N A;  4U3Q A;  4N7C A;  4TKB A;  4IMO A;  3STM X;  1GT1 A;  1U17 A;  3L4R A;  4I6S A;  1DZJ A;  3VPJ E;  3B2H A;  4ZGU A;  2ACP X;  2NND A;  4BQU A;  1QWD A;  4O4U A;  4OMX A;  2WSJ A;  3AKM A;  4NYQ A;  1AQB A;  4ZH6 A;  1BM5 A;  3C77 X;  4GRJ A;  2CM4 A;  4O49 A;  2HZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...