4TKBA

The 0.86 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with lauric acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, heart
publication title Water-mediated recognition of simple alkyl chains by heart-type Fatty-Acid-binding protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tkbA00
2AT5X 4QYPA 3U03A 3GAQA 1TVQA 1X8QA 1S44A 4ZHFA 1QY2A 1S7DA 4YFPA 3F8AA 3B2KA 3PPTA 1SY0A 1R0UA 1ZNGA 3RSWA 3FMZA 1X8UA 5D48A 4ZGUA 2Q9SA 5D45A 1ZNEA 1AVGI 2Q4NA 3VG6A 1SXUA 1HN2A 4YMYA 1D2UA 3C78X 4XMHA 1GX9A 2YG2A 2XSTA 1VYGA 2O62A 2Q39A 3D95A 3KQ0A 2AT3X 1H91A 1KQWA 3BU9A 4AZQA 1X8PA 1PBOA 5F7GA 1KZXA 1I4UA 5IO5A 1UZ2X 2IFBA 5L8OA 1SA8A 4HFOA 5LKEA 1BSQA 4IB7A 5HZ5A 2RCQA 1JJJA 3O22A 5LJCA 5C0NA 4PSQA 1P6PA 1SY1A 3JSQA 1EUOA 1ZNLA 1B0OA 3QKGA 2A0AA 4NLJA 2CZTA 4QGWA 4I9RA 1MUPA 3C76X 1QY0A 4CK4A 3MVFA 1ZNKA 2HYSA 4TKHA 4YGGA 4AZMA 1ALBA 3KFGA 3TZSA 1FEMA 3PH6A 4I3CA 4OMXA 4YGHA 2AMMX 3VG2A 4TKJA 1KGLA 2ASNX 3I17A 2OZQA 1LNMA 1GKAA 1LIBA 1LIEA 2KT4B 2WWPA 4ALOA 1E02A 1GXAA 2FRSA 4I3BA 1G5WA 1CBSA 3P6FA 2ACOA 4YKMA 4N7CA 1OEEA 4GE1A 1XKIA 5EEDA 2EU7X 1FDQA 4YFRA 1T0VA 1BSOA 5CE4A 3U0DA 3O19A 2CBSA 4WFVA 1BWYA 1B56A 2KTDA 3NP1A 3G7XA 2XKLA 4IB9A 3APVA 3CMPA 3TGCA 1PMPA 4IB6A 1AB0A 5HZ9A 1D3SA 1SXYA 2DM5A 1FENA 2FR3A 4AYHA 5BVTA 2Q2PA 2WR6A 2AT0X 1YP7A 3P6GA 2WSJA 4GNYA 2CBRA 4QGXA 4A60A 4YFQA 1S2PA 3IA8A 3BDRA 1ERXA 3D97A 4ES7A 3WJCA 3NPOA 4K19A 2AL0X 3BS2A 1O8VA 1OBUA 3IFBA 2A2GA 5H9AA 5L8NA 4YBPA 4DQ3A 5HAEA 1O1VA 3NQ3A 3VG7A 2HNXA 5JR8A 1KT6A 5HZQA 2QOSC 1BM5A 3ZUIA 1EPAA 4GETA 4ORXA 2QO6A 2CM9A 1KT3A 2RD7C 1GT3A 2FS7A 3BX8A 5DPQA 2G7BA 3DSZA 3EYCA 3O2YA 3NR3A 2NNDA 4AZNA 1GX8A 1LIFA 4XMEA 5HWZA 1SXXA 3WJEA 1T8VA 2HLVA 4TLJA 3I0AA 3FEPA 5D4AA 3PECA 4RUNA 1MX8A 2NNQA 5IO7A 4LKTA 1KOIA 1ACDA 3FR2A 1OPAA 5KHPA 3NX1A 3WJDA 1OEJA 1MX7A 1QWDA 2JU8A 5DG4A 4EDEA 1GM6A 1LFOA 2LBVA 3WJGA 4XMGA 3P6CA 4KIIA 3B2LA 5LJEA 3ZQ3A 1A18A 1TOUA 2L5PA 4HPAA 3UEUA 2OFRX 2JOZA 3FEKA 2AT6X 4AW8A 3L4RA 2NNEA 4QZTA 1KT4A 1B8EA 2JU3A 1HQPA 4IMOA 5B27A 3WVMA 5H9LA 1KT7A 4ALBA 2NP1A 3BLGA 2G78A 1QQSA 2JN3A 2OVDA 5F6BA 4AZPA 1KQXA 1CJ5A 2WEWA 3UEWA 1BEBA 1EW3A 1YWBA 1BRQA 1CRBA 1DZJA 2FWVA 2K62A 4EFGA 4UU2A 3F9DA 3RZYA 4TKBA 1EXSA 1NP1A 1OBPA 5F1EA 2FTBA 5HZ8A 1BSYA 4ORUA 5K06A 5LJBA 4ZH6A 4MVIA 1NP4A 1ZNDA 3CQRA 1OEKA 4WBKA 2L9CA 3HWGA 1JYDA 4IB8A 4I3DA 5LJKA 2P8GA 3FLLA 4IAXA 4IAWA 3FENA 1MDCA 3FIQA 4I9SA 1A57A 2WQAE 2OVEA 3NQ9A 4A1YA 1GT4A 1KZWA 3FELA 4ZJ0A 2FLJA 4ZHCA 1XCAA 3FW5A 5EDCA 4ZHGA 3BY0A 3NADA 1A2DA 1SY2A 2WUTA 5HA1A 1U0XA 5BVQA 2AH7X 3APWA 4BQUA 3FR4A 5BVSA 3STNA 3B2JA 2MO5A 2R56A 3D96A 1YUPA 1I04A 5KICA 4R0BA 4ORRA 2AT8X 3APUA 1IFCA 4YDAA 1KXOA 1QABE 4UU3A 2LKKA 4O9SA 2W2BA 3FA9A 5AQ6A 3HWFA 1IIUA 1OBQA 3AKMA 5HCCC 1GGLA 2ACPX 4IMNA 2RCTA 3CBSA 1FELA 5HCDC 3TF6A 4GRJA 1JZUA 4YCEA 3VG3A 4ZFXA 1X8OA 1IKJA 2LFOA 4NYQA 1BRPA 5FAZA 3FA6A 1LPJA 1PEEA 4WFUA 2W2AA 4EEJA 4NNSA 2X46A 5HTEA 2POAA 1CBRA 3BU1A 1RLBE 4D6AA 4HPDA 2X45A 3BX7A 1UREA 3P6EA 3KFIA 3PEDA 4Y0QA 3P6HA 3HWDA 4YH0A 3PP6A 1DZKA 5D8JA 5EPQA 3UEVA 3WXQA 3ZUOA 1X89A 3B2IA 2OVAA 3KFFA 5D47A 2R74A 2BLGA 4MVKA 5EDBA 1QFVA 1HMRA 4RUUA 3K3LA 1E00A 4YKOA 3C77X 2HMBA 5IO6A 4EXZA 3HWEA 2WQ9A 1OPBA 1DZPA 1ADLA 1DFVA 4D6BA 2CZUA 2N93A 3APXA 4AZRA 1E06A 1IW2A 1EPBA 3ELXA 2Q2MA 1HBPA 5EEEA 1IFBA 3FA8A 1TOWA 4Y0RA 1GT5A 4NYRA 1LKEA 1GT1A 1QFTA 3FR5A 4ZH9A 1YWAA 1EIIA 3DTQA 1TXLA 5HCEC 1L6MA 4M6SA 3WJFA 3AKNA 1FE3A 4OS3A 5HTDA 3EBWA 1CBIA 4Y0SA 2ANSA 4ZR2A 3WJBA 4ARHA 1I06A 2HZQA 3UEXA 4ZCBA 4GKCA 2GC9A 4TNNA 2FS6A 2A13A 2QM9A 4MVLA 1BJ7A 4ZHDA 1E5PA 3EM0A 2A2UA 4OMWA 3MBTA 1ERBA 4YCHA 2HZRA 2FT9A 1EQDA 1G7NA 4NLIA 1G85A 1VPRA 3WBGA 1JJXA 2GJ5A 2W2FA 1JV4A 1SY3A 1T68X 4NNTA 4LKPA 1X71A 4NP1A 5HBSA 4TJZA 4ORYA 3CQNA 2AKQA 1YP6A 2LB6A 1ZRYA 1DF3A 4QGVA 2G79A 3CR6A 3TGAA 1SXWA 5H9NA 1NGLA 3FW4A 4YGZA 5LJGA 3S26A 5LKFA 3VG4A 1DV9A 3BRNA 3VG5A 1HMSA 1HMTA 4BOEA 1RBPA 2L67A 5HZ6A 1MVGA 3P6DA 4M7MA 3OJYC 3STKA 1G74A 2QO5A 2WEXA 3B2HA 4OS0A 4TQ2A 3CBCA 5LJDA 1VYFA 3Q6LA 1ZNHA 4LZVA 3CWKA 4BVMA 5KIDA 1O1UA 5FENA 3EMMA 5F6ZA 3FA7A 1DC9A 4A8ZA 5FFHA 1AELA 5H8TA 3TGBA 3PH5A 1TW4A 3BSZE 4QAEA 4AZOA 1B4MA 3ELZA 5HA0A 2K23A 1CBQA 4DQ4A 2QO4A 4YDBA 2L68A 3KZAA 4QZUA 4GNWA 1EALA 1ICMA 5L8IA 1GKAB 1LIDA 3JS1A 1EIOA 1I05A 5B29A 2OFMX 3STMX 4HPBA 1U18A 4YBUA 4A1HA 1BLRA 2GTFX 1Z24A 1IKEA 1ICNA 2PY1A 3U9PC 5LJHA 1HBQA 3KFHA 4XMFA 2RA6A 2ALLX 2A3FX 2F73A 1QG5A 4ODDA 1JBHA 4ORSA 1PM1X 1U17A 3EBKA 3HK1A 1LF7A 5H9KA 4LZUA 3SAOA 1QY1A 4HPCA 2E4JA 4OS8A 1DZMA 2LBAA 2R73A 1FTPA 1YIVA 1KT5A 1A3YA 1LICA 4ORWA 4XMCA 2JU7A 4ZHHA 4GH7A 5F58A 2CM4A 1YWCA 4XMDA 1ML7A 3T1DA 1JYJA 4QYNA 2RQ0A 2FR2A 1BBPA 1N0SA 4Y0PA 5EZ2A 1X8NA 2MJIA 2MM3A 4N7DA 4IBAA 1YWDA 1AQBA 3NX2A
chains in the Genus database with same CATH superfamily
2AT5X 4QYPA 3CKFA 3U03A 3GAQA 1TVQA 1X8QA 1S44A 4ZHFA 1QY2A 3S60A 1S7DA 4YFPA 3F8AA 3B2KA 3PPTA 1SY0A 4FBVA 1R0UA 1ZNGA 2RTFB 4GK9A 4O3XB 3RSWA 3RWXA 3SZIA 3FMZA 1X8UA 5D48A 4ZGUA 2IZAA 3N91A 4JO6A 2Q9SA 5D45A 1ZNEA 1AVGI 3WYQA 3H3IA 2Q4NA 3RDQA 3VG6A 2X34A 1RSTB 1SXUA 2OY1O 1HN2A 1NBXA 2BSZA 4YMYA 1D2UA 3C78X 2OL8O 2QCBA 1W5RA 4XMHA 5B10O 2JMBA 1SWFA 1GX9A 2YG2A 2FHNX 2XSTA 2GTLN 1LCZA 1VYGA 2O62A 2Q39A 3D95A 1N4JA 3KQ0A 4FBOA 4LQZA 2GTLM 2M4LA 2AT3X 1H91A 1KQWA 1SLEB 2UYWA 3BU9A 4U3QA 3MM0A 4AZQA 1X8PA 1Y9TA 1PBOA 1LUQA 5F7GA 4CPIA 2IZEB 1KZXA 1I4UA 4COTA 1E2TA 3T2WA 5IO5A 1UZ2X 2IFBA 5L8OA 1SA8A 4HFOA 5K68A 1BSQA 5LKEA 4IB7A 5HZ5A 2RCQA 1JJJA 3O22A 5LJCA 1STPA 5C0NA 4PSQA 1JJUA 1VWBB 2PI3O 1P6PA 1SY1A 2MF6A 1HQQA 1HXLA 1EUOA 3JSQA 1ZNLA 4CDEA 4YVBA 1B0OA 3QKGA 2OYBO 2A0AA 4NLJA 2CZTA 4Z27A 2RTOB 4BX7A 4QGWA 4I9RA 1MUPA 3C76X 1QY0A 4CK4A 4CPHB 5AEOA 3MVFA 4GUZA 4INNA 1ZNKA 2HYSA 2RTIB 4TKHA 2OF9A 1KL3A 5CHKA 1ALBA 4YGGA 4AZMA 3KFGA 3TZSA 2RTMA 1FEMA 2X8FA 3PH6A 4BBOA 1SRGA 2X32A 1LELA 4I3CA 4OMXA 4IABA 4YGHA 2AMMX 3FDCA 5AJBA 3SLOA 3VG2A 4TKJA 4GZVA 1KGLA 2ASNX 3I17A 2OZQA 1LNMA 1GKAA 3VE2A 1LIBA 1LIEA 2KT4B 2RTBB 2WWPA 5FQ8E 1E02A 1GXAA 1JIWI 2FRSA 4I3BA 4CV7A 1G5WA 1CBSA 1FJ1E 3P6FA 3RY2A 2ACOA 5IRWA 4YKMA 4I60A 4N7CA 4CSBA 1OEEA 3ZI8A 4GE1A 1XKIA 5EEDA 2EU7X 2BC3A 1FDQA 4MIRA 1T0VA 2C4IA 4YFRA 1NQMA 1BSOA 5CE4A 3U0DA 4CDCA 1HXZA 2CBSA 3O19A 4O49A 4WFVA 2GH7A 1BWYA 2FKGA 1B56A 2KTDA 3NP1A 3G7XA 4CPEA 2F09A 2XKLA 3APVA 1SWPA 3CMPA 1PMPA 1STSB 3HOEA 4IB6A 4IB9A 1AB0A 1VYOA 2IZFB 5HZ9A 1JQPA 1D3SA 5IXGA 1SXYA 2DM5A 1FENA 2FR3A 4AYHA 4GD9A 2Q2PA 2WR6A 5BVTA 2X55A 2AT0X 4MISA 4I6SA 1VWKB 1YP7A 1VWFB 3P6GA 2WSJA 5B11O 4GNYA 2CBRA 4QGXA 4A60A 1NC9A 1SRIA 1SWOA 4YFQA 3RE5A 1AVDA 1S2PA 3BDRA 1ERXA 1VWQB 1W4TA 3D97A 3IA8A 3WJCA 3NPOA 4K19A 4ES7A 2AL0X 3BS2A 1O8VA 1OBUA 3IFBA 2A2GA 5H9AA 5L8NA 4YBPA 1SWAA 3P02A 3RDMA 4CPFA 4DQ3A 5HAEA 1O1VA 2BS6A 3HOLA 3NQ3A 3VG7A 2HNXA 5JR8A 4U8UN 1KT6A 5HZQA 2QOSC 3UAQA 1BM5A 3ZUIA 4GJVA 1EPAA 4GETA 4ORXA 1LDQA 2QO6A 2CM9A 1KT3A 2RD7C 1GT3A 5B3MO 4ALOA 2FS7A 3BX8A 4L1NA 1VWMB 5DPQA 2G7BA 4QRLA 1AVEA 3DSZA 3RDSA 1MK5A 3EYCA 2OF8A 3NR3A 3O2YA 2IZGB 3RDOA 2NNDA 4AZNA 1GX8A 1LIFA 3EC5A 4XMEA 1SXXA 3SLJA 5HWZA 3WJEA 2AVIA 1T8VA 2HLVA 4TLJA 3VPJE 3I0AA 3FEPA 5D4AA 3PECA 4RUNA 1MX8A 2NNQA 4Z2OA 5IO7A 4O4XA 4LKTA 1KOIA 1ACDA 1W6FA 1OPAA 3FR2A 2OVSA 4ID2A 5KHPA 3NX1A 3WJDA 1OEJA 1MX7A 1SLFB 5AJCA 1QWDA 2JU8A 5DG4A 4EDEA 1GM6A 2IZKA 1VWDB 1NDJA 1LFOA 2LBVA 3WJGA 4XMGA 1SRJA 3P6CA 1SMPI 4KIIA 1VWLB 3B2LA 1WBIA 5LJEA 3ZQ3A 1A18A 1TOUA 2L5PA 4HPAA 2IZCB 3UEUA 2OFRX 4ML7B 2JOZA 2RTKA 3FEKA 2AT6X 3SLTA 4AW8A 1MEPA 2DJFA 2NNEA 3L4RA 4QZTA 1KT4A 1B8EA 2ZAGA 3EW2A 3PDFA 2JU3A 1HQPA 4IMOA 5B27A 2G5LA 3WVMA 5H9LA 1KT7A 4ALBA 1SWKA 2NP1A 2G78A 1QQSA 2JN3A 2OVDA 3BLGA 2LA7A 5F6BA 1KQXA 3RY1A 4AZPA 1CJ5A 3T6LA 4O4SA 2WEWA 4MVEA 3UEWA 1MM9A 1BEBA 2QOMA 2WPUA 1EW3A 1YWBA 2RTAA 4BX6A 2AF5A 1BRQA 1CRBA 1DZJA 2FWVA 4CPHA 2K62A 4EFGA 1Y53X 4BX5A 4UU2A 3VHHA 3F9DA 3RZYA 1LCWA 3VHMA 2IZHB 1EXSA 1NP1A 3HPEA 4TKBA 1OBPA 2FGSA 2OY8A 1I9HA 4GDZA 1Y55X 5F1EA 1RXHA 2FTBA 4Z2VA 1KL5A 1BSYA 1SWLA 2RTHB 4ORUA 5HZ8A 5K06A 2YMSA 1N43A 5LJBA 4ZH6A 4MVIA 1NP4A 1VWCB 1ZNDA 3CQRA 1OEKA 4WBKA 5FQ6E 2L9CA 3ZW0A 1SREA 3HWGA 1JYDA 1K3BA 3F6ZB 4I3DA 2C1SA 4IB8A 2BHVA 2P8GA 3FLLA 4IAXA 4IAWA 3FENA 1MDCA 3FIQA 4I9SA 4KH8A 2WQAE 3VHIA 4BX6B 1A57A 3MX7A 2OVEA 3NQ9A 5F2BA 5IRUA 4FQBB 4A1YA 4BX5B 4JNJA 1WUBA 1GT4A 3SZJA 2GTLO 2I5VO 1KZWA 3FELA 4O3YA 1VWHB 4ZJ0A 4OELA 2FLJA 1JMXA 4ZHCA 1XCAA 3FW5A 4PJ2A 4Y59A 5EDCA 4ZHGA 3BY0A 3NADA 1A2DA 1SY2A 2WUTA 5HA1A 1U0XA 2JGSA 3HTYA 5BVQA 2AH7X 3APWA 4BQUA 2VFBA 3FR4A 5BVSA 3STNA 3B2JA 2MO5A 2RTPB 3ZW0B 3AEHA 3NQKA 2CAMA 2F01A 2R56A 3D96A 1YUPA 1Y52X 1I04A 5KICA 1Y9LA 1VWRB 3AUMO 4R0BA 1SWNA 4ORRA 3LTWA 2AT8X 3APUA 4Z28A 3OD9A 1IFCA 4YDAA 1KXOA 1SLGB 3OBLA 5L3YA 1QABE 4UU3A 2LKKA 4O9SA 5FQ7E 3ZUOA 2W2BA 3FA9A 5AQ6A 3HWFA 3NBXX 1IIUA 1OBQA 3AKMA 4C5PA 5HCCC 1GGLA 2ACPX 4IMNA 1SWEA 1UYNX 1PTSA 2RCTA 3CBSA 1FELA 4GJSA 4HWMA 5HCDC 1N7YA 3TF6A 4GRJA 2RN4A 3RDXA 1JZUA 4YCEA 3VG3A 4ZFXA 1SRFA 1X8OA 1IKJA 2LFOA 4NYQA 1BRPA 5FAZA 3FIDA 3FA6A 4JGLA 1LPJA 2MWHA 1PEEA 2Y32A 4WFUA 1SWJA 1Y0GA 2ZAIA 4FBRA 4Z6JA 2W2AA 4EEJA 4NNSA 2X46A 1VWGB 2FHLA 5HTEA 2POAA 1PBYA 1CBRA 3BU1A 1RLBE 5CYBA 4BGFA 4D6AA 4U8UM 3VE1A 3JQOA 4L3RA 4HPDA 2X45A 3BX7A 2G8CO 1UREA 5B2AO 3P6EA 2BS5A 3CKGA 3KFIA 4Y5DA 2FKJA 3PEDA 4Y0QA 3P6HA 3HWDA 2X4MA 2KTSA 1DZKA 3PP6A 4YH0A 5D8JA 5EPQA 3UEVA 3WXQA 2RTCB 1X89A 4O3ZA 3B2IA 3SOTA 2OVAA 1K24A 1N9YA 3KFFA 1SWBA 2KD2A 1RAVA 5D47A 1OSPO 2R74A 1SWDA 5K67A 2OFBA 3OE3A 2BLGA 4MVKA 5EDBA 1QFVA 1HMRA 4RUUA 3K3LA 2A5CA 2Y3EA 1E00A 4YKOA 3C77X 2HMBA 1RXKA 4MEEA 2KW1A 3ZW1A 4EXZA 1VWJB 3HWEA 5B5FA 2A8GA 5IO6A 4EQAC 3RBYA 2WQ9A 1OPBA 1DZPA 1LCVA 3SZHA 1ADLA 1DFVA 4D6BA 1VWOB 4NV7A 2CZUA 2N93A 3APXA 3S5XA 4AZRA 4BJ8A 1E06A 4IRWA 1IW2A 3WOVA 3P24A 1EPBA 2RTGB 1STRB 2Q2MA 3ELXA 4KC7A 3WZNA 5HZ6A 2IZLB 4FGIB 1HBPA 5EEEA 1SWUA 5IRAA 3FYFA 1IFBA 3FA8A 1TOWA 4O4OA 4Y0RA 1GT5A 4NYRA 1LKEA 1GT1A 1SWGA 1QFTA 4GGZA 3ZW1B 3RE6A 1UYOX 1KL4A 4DCBA 3FR5A 4ZH9A 4GU8A 1YWAA 1SRHA 4O4UA 1IJ8A 5LJKA 3TGCA 1EIIA 3DTQA 4I95A 3RDUA 1TXLA 5HCEC 1L6MA 4M6SA 3WJFA 3AKNA 1FE3A 3D9WA 4OS3A 5HTDA 3EBWA 4GGTA 1EI5A 2OY5O 1CBIA 4Y0SA 2ANSA 4ZR2A 3WJBA 4ARHA 1I06A 2HZQA 3UEXA 4ZCBA 4GKCA 2GC9A 4TNNA 2FS6A 2A13A 3WZQA 3X00A 2QM9A 4MVLA 1BJ7A 4ZHDA 1E5PA 3EM0A 2Z4IA 2A2UA 4OMWA 4ZGFA 2X8SA 2OFAA 3MBTA 1ERBA 2OL7A 3E3CA 3V8UA 4YCHA 2HZRA 2FT9A 1EQDA 1G7NA 4NLIA 1G85A 1VPRA 3WBGA 1JJXA 2GJ5A 2RTNB 3WZPA 2W2FA 1JV4A 4U46A 1SY3A 2MHDA 1T68X 3WZOA 4NNTA 1DF8A 4LKPA 1SLDB 1X71A 5CSEA 4NP1A 5HBSA 4TJZA 4ORYA 3CQNA 3WYPA 1SWQA 2AKQA 4Z2PA 1YP6A 1SWHA 4CDFA 2IZBA 2LB6A 1ZRYA 1JMZA 1DF3A 4QGVA 2G79A 3CR6A 1VWIB 1SXWA 3TGAA 5H9NA 1NGLA 3ZWEA 1GX3A 3FW4A 4ON1A 4YGZA 5LJGA 4JHQA 4QNIA 2Z4HA 5LKFA 3S26A 3VG4A 1RSUB 1DV9A 3BRNA 3LHNA 2DJGA 2C1QA 3VG5A 3PQUA 1HMSA 3LV4A 1HMTA 2UZ2A 4OKAA 1RBPA 2L67A 4WHIA 4BOEA 1MVGA 3P6DA 2RTJA 1VWNB 4GGRA 4KCAA 4M7MA 3OJYC 3Q34A 3STKA 1G74A 2QO5A 4U9CA 2WEXA 3B2HA 4OS0A 4TQ2A 3CBCA 5LJDA 1VYFA 2RTLA 3Q6LA 1ZNHA 4LZVA 4O3WA 3T2XA 1SWCA 3CWKA 2RTDB 4BVMA 5KIDA 2RTEB 4DNEA 1O1UA 2X56A 3EMMA 3VGWA 5F6ZA 3ZZVA 5FENA 3FA7A 1DC9A 2HKDA 5FFHA 4A8ZA 5H8TA 4BX7B 3T6FA 3TGBA 1AELA 3PH5A 1TW4A 3BSZE 1VWAB 4QAEA 2A5BA 3ZW2A 3S5VA 4AZOA 1B4MA 1VWEB 3ELZA 1SWTA 3MG5A 2K23A 5HA0A 1CBQA 5BYPA 4DQ4A 1NQNA 2QO4A 4YDBA 2L68A 3KZAA 2QMIA 3KVNA 2IZDB 4QZUA 4GNWA 3VU1A 1EALA 1ICMA 3PQSA 5L8IA 1GKAB 2IZJA 1LIDA 3JS1A 1EIOA 1I05A 4EKVA 5B29A 1I78A 2OFMX 1MOYA 4OEMA 3STMX 4HPBA 1U18A 4YBUA 4NW4A 3EW1A 4A1HA 1BLRA 2GTFX 1Z24A 3RKGA 1IKEA 1N9MA 4BCSA 5JD2A 1ICNA 2PY1A 4GDAA 3U9PC 5LJHA 1HBQA 3KFHA 4XMFA 2RA6A 1HY2A 2ALLX 2A3FX 2RTRB 2RTQB 2Y3FA 2IZIA 1VWPB 2F73A 1SWSA 1QG5A 4ODDA 1JBHA 4ORSA 1PM1X 1U17A 2OL6O 3D4RA 1LF7A 3EBKA 3HK1A 4LZUA 2X8TA 5H9KA 3SAOA 2VFCA 1QY1A 4HPCA 2E4JA 4OS8A 1DZMA 4NV8A 2LBAA 2R73A 1FTPA 2BT9A 1YIVA 1KT5A 1A3YA 1LICA 4ORWA 4XMCA 2JU7A 4B55A 2VDFA 4CDDA 4KC8A 4ZHHA 4GH7A 4KT5A 5F58A 4U8UO 5B5GA 1KFFA 3GE2A 2CM4A 1YWCA 2I5ZO 2OY7A 4XMDA 1ML7A 3T1DA 1JYJA 4QYNA 1SWRA 2RQ0A 2FR2A 1BBPA 1N0SA 3PK2A 4QQ1A 4Y0PA 5EZ2A 2JW1A 1X8NA 2MJIA 2MM3A 4N7DA 4IBAA 1LDOA 2ZSCA 3QQ2A 1YWDA 1AQBA 3NX2A 1RXJA
chains in the Genus database with same CATH topology
2AT5X 4QYPA 3U03A 3GAQA 1TVQA 1X8QA 1S44A 4ZHFA 1QY2A 3S60A 1S7DA 4YFPA 3F8AA 3B2KA 3PPTA 1SY0A 4FBVA 1R0UA 1ZNGA 4GK9A 4O3XB 3RSWA 3RWXA 3FMZA 1X8UA 5D48A 4ZGUA 3N91A 2Q9SA 5D45A 1ZNEA 1AVGI 3H3IA 2Q4NA 3VG6A 1SXUA 1HN2A 4YMYA 1D2UA 3C78X 4XMHA 2JMBA 1GX9A 2YG2A 2XSTA 2GTLN 1VYGA 2O62A 2Q39A 3D95A 3KQ0A 4FBOA 4LQZA 2GTLM 2M4LA 2AT3X 1H91A 1KQWA 4U3QA 3BU9A 4AZQA 1X8PA 1Y9TA 1PBOA 5F7GA 1KZXA 1I4UA 4COTA 5IO5A 1UZ2X 2IFBA 5L8OA 1SA8A 4HFOA 5LKEA 1BSQA 4IB7A 5HZ5A 2RCQA 1JJJA 3O22A 5LJCA 5C0NA 4PSQA 1P6PA 1SY1A 3JSQA 1EUOA 1ZNLA 1B0OA 3QKGA 2A0AA 4NLJA 2CZTA 4QGWA 4I9RA 1MUPA 3C76X 1QY0A 4CK4A 5AEOA 3MVFA 4INNA 1ZNKA 2HYSA 4TKHA 4YGGA 4AZMA 1ALBA 3KFGA 3TZSA 1FEMA 2X8FA 3PH6A 4I3CA 4OMXA 4IABA 4YGHA 2AMMX 5AJBA 3VG2A 4TKJA 4GZVA 1KGLA 2ASNX 3I17A 2OZQA 1LNMA 1GKAA 3VE2A 1LIBA 1LIEA 2KT4B 2WWPA 5FQ8E 4ALOA 1E02A 1GXAA 1JIWI 2FRSA 4I3BA 4CV7A 1G5WA 1CBSA 3P6FA 2ACOA 4YKMA 4N7CA 1OEEA 3ZI8A 4GE1A 1XKIA 5EEDA 2EU7X 1FDQA 4MIRA 1T0VA 4YFRA 1BSOA 5CE4A 3U0DA 3O19A 2CBSA 4O49A 4WFVA 1BWYA 1B56A 2KTDA 3NP1A 3G7XA 4CSBA 2F09A 2XKLA 3APVA 3CMPA 3HOEA 1PMPA 4IB9A 4IB6A 3TGCA 1AB0A 5HZ9A 1D3SA 1SXYA 2DM5A 1FENA 2FR3A 4AYHA 5BVTA 2Q2PA 2WR6A 2AT0X 4MISA 4I6SA 1YP7A 3P6GA 2WSJA 4GNYA 2CBRA 4QGXA 4A60A 4YFQA 1S2PA 3IA8A 3BDRA 1ERXA 3D97A 4ES7A 3WJCA 3NPOA 4K19A 2AL0X 3BS2A 1O8VA 1OBUA 3IFBA 2A2GA 5H9AA 5L8NA 4YBPA 3P02A 4DQ3A 5HAEA 1O1VA 2BS6A 3HOLA 3NQ3A 3VG7A 2HNXA 5JR8A 4U8UN 1KT6A 5HZQA 2QOSC 3UAQA 1BM5A 3ZUIA 1EPAA 4GETA 4ORXA 2QO6A 2CM9A 1KT3A 2RD7C 1GT3A 2FS7A 3BX8A 4L1NA 5DPQA 2G7BA 4QRLA 3DSZA 3EYCA 3O2YA 3NR3A 2NNDA 4AZNA 1GX8A 1LIFA 4XMEA 5HWZA 1SXXA 3WJEA 1T8VA 2HLVA 4TLJA 3VPJE 3I0AA 3FEPA 5D4AA 3PECA 4RUNA 1MX8A 2NNQA 5IO7A 4O4XA 4LKTA 1KOIA 1ACDA 3FR2A 1OPAA 2OVSA 4ID2A 5KHPA 3NX1A 3WJDA 1OEJA 1MX7A 5AJCA 1QWDA 2JU8A 5DG4A 4EDEA 1GM6A 1LFOA 2LBVA 3WJGA 4XMGA 3P6CA 1SMPI 4KIIA 3B2LA 5LJEA 3ZQ3A 1A18A 1TOUA 2L5PA 4HPAA 3UEUA 2OFRX 4ML7B 2JOZA 3FEKA 2AT6X 4AW8A 3L4RA 2NNEA 4QZTA 1KT4A 1B8EA 2ZAGA 2JU3A 1HQPA 4IMOA 5B27A 3WVMA 4EQAC 5H9LA 1KT7A 4ALBA 2NP1A 3BLGA 2G78A 1QQSA 2JN3A 2OVDA 5F6BA 2LA7A 4AZPA 1KQXA 1CJ5A 4O4SA 2WEWA 4MVEA 3UEWA 1BEBA 1EW3A 1YWBA 1BRQA 1CRBA 1DZJA 2FWVA 2K62A 4EFGA 4UU2A 3F9DA 3RZYA 4TKBA 1EXSA 1NP1A 1OBPA 4GDZA 5F1EA 2FTBA 5HZ8A 1BSYA 4ORUA 5K06A 2YMSA 5LJBA 4ZH6A 4MVIA 1NP4A 1ZNDA 3CQRA 1OEKA 4WBKA 5FQ6E 2L9CA 3ZW0A 3HWGA 1JYDA 4IB8A 3F6ZB 4I3DA 5LJKA 2BHVA 2P8GA 3FLLA 4IAXA 4IAWA 3FENA 1MDCA 3FIQA 4I9SA 4KH8A 2WQAE 1A57A 3MX7A 2OVEA 3NQ9A 4A1YA 4FQBB 1GT4A 2GTLO 1KZWA 3FELA 4O3YA 4ZJ0A 2FLJA 4ZHCA 1XCAA 3FW5A 4PJ2A 5EDCA 4ZHGA 3BY0A 3NADA 1A2DA 1SY2A 2WUTA 5HA1A 1U0XA 3HTYA 5BVQA 2AH7X 3APWA 4BQUA 3FR4A 5BVSA 3STNA 3B2JA 2MO5A 3ZW0B 3NQKA 2R56A 3D96A 1YUPA 1I04A 5KICA 1Y9LA 4R0BA 4ORRA 2AT8X 3APUA 3OD9A 1IFCA 4YDAA 1KXOA 3OBLA 1QABE 4UU3A 2LKKA 4O9SA 5FQ7E 2W2BA 3FA9A 5AQ6A 3HWFA 3NBXX 1IIUA 1OBQA 3AKMA 5HCCC 1GGLA 2ACPX 4IMNA 2RCTA 3CBSA 1FELA 5HCDC 4HWMA 3TF6A 4GRJA 2RN4A 1JZUA 4YCEA 3VG3A 4ZFXA 1X8OA 1IKJA 2LFOA 4NYQA 1BRPA 5FAZA 3FA6A 4JGLA 1LPJA 2MWHA 1PEEA 4WFUA 2ZAIA 4FBRA 2W2AA 4EEJA 4NNSA 2X46A 5HTEA 2POAA 1CBRA 3BU1A 1RLBE 5CYBA 4D6AA 4U8UM 3VE1A 3JQOA 4L3RA 4HPDA 2X45A 3BX7A 1UREA 3P6EA 2BS5A 3KFIA 3PEDA 4Y0QA 3P6HA 3HWDA 4YH0A 2KTSA 1DZKA 3PP6A 5D8JA 5EPQA 3UEVA 3WXQA 3ZUOA 1X89A 4O3ZA 3B2IA 3SOTA 2OVAA 3KFFA 5D47A 2KD2A 2R74A 3OE3A 2BLGA 4MVKA 5EDBA 1QFVA 1HMRA 4RUUA 3K3LA 1E00A 4YKOA 3C77X 2HMBA 3ZW1A 2KW1A 5IO6A 4EXZA 3HWEA 3RBYA 2WQ9A 1OPBA 1DZPA 1ADLA 1DFVA 4D6BA 2CZUA 2N93A 3APXA 3S5XA 4AZRA 1E06A 1IW2A 3WOVA 3P24A 1EPBA 3ELXA 2Q2MA 4KC7A 4FGIB 1HBPA 5EEEA 3FYFA 1IFBA 3FA8A 1TOWA 4O4OA 4Y0RA 1GT5A 4NYRA 1LKEA 1GT1A 1QFTA 3ZW1B 3FR5A 4ZH9A 4GU8A 1YWAA 4O4UA 1EIIA 3DTQA 4I95A 1TXLA 5HCEC 1L6MA 4M6SA 3WJFA 3AKNA 1FE3A 4OS3A 5HTDA 3EBWA 1EI5A 1CBIA 4Y0SA 2ANSA 4ZR2A 3WJBA 4ARHA 1I06A 2HZQA 3UEXA 4ZCBA 4GKCA 2GC9A 4TNNA 2FS6A 2A13A 2QM9A 4MVLA 1BJ7A 4ZHDA 1E5PA 3EM0A 2Z4IA 2A2UA 4OMWA 4ZGFA 2X8SA 3MBTA 1ERBA 3E3CA 3V8UA 4YCHA 2HZRA 2FT9A 1EQDA 1G7NA 4NLIA 1G85A 1VPRA 3WBGA 1JJXA 2GJ5A 2W2FA 1JV4A 1SY3A 2MHDA 1T68X 4NNTA 4LKPA 1X71A 4NP1A 5HBSA 4TJZA 4ORYA 3CQNA 2AKQA 1YP6A 2LB6A 1ZRYA 1DF3A 4QGVA 2G79A 3CR6A 3TGAA 1SXWA 5H9NA 1NGLA 3ZWEA 3FW4A 4YGZA 4ON1A 5LJGA 4QNIA 3S26A 2Z4HA 5LKFA 3VG4A 1DV9A 3BRNA 3LHNA 3VG5A 3PQUA 1HMSA 3LV4A 1HMTA 4BOEA 1RBPA 2L67A 4WHIA 5HZ6A 1MVGA 3P6DA 4M7MA 4KCAA 3OJYC 3STKA 1G74A 2QO5A 4U9CA 2WEXA 3B2HA 4OS0A 4TQ2A 3CBCA 5LJDA 1VYFA 3Q6LA 1ZNHA 4LZVA 4O3WA 3CWKA 4BVMA 5KIDA 1O1UA 5FENA 3EMMA 5F6ZA 3ZZVA 3FA7A 1DC9A 4A8ZA 5FFHA 1AELA 5H8TA 3TGBA 3PH5A 1TW4A 3BSZE 4QAEA 3ZW2A 3S5VA 4AZOA 1B4MA 3ELZA 5HA0A 2K23A 1CBQA 5BYPA 4DQ4A 2QO4A 4YDBA 2L68A 3KZAA 2QMIA 4QZUA 4GNWA 3VU1A 1EALA 1ICMA 3PQSA 5L8IA 1GKAB 1LIDA 3JS1A 1EIOA 1I05A 5B29A 2OFMX 3STMX 4HPBA 1U18A 4YBUA 4NW4A 4A1HA 1BLRA 2GTFX 1Z24A 3RKGA 1IKEA 1ICNA 2PY1A 3U9PC 5LJHA 1HBQA 3KFHA 4XMFA 2RA6A 2ALLX 2A3FX 2F73A 1QG5A 4ODDA 1JBHA 4ORSA 1PM1X 1U17A 3D4RA 3EBKA 1LF7A 3HK1A 5H9KA 4LZUA 2X8TA 3SAOA 1QY1A 4HPCA 2E4JA 4OS8A 1DZMA 2LBAA 2R73A 1FTPA 2BT9A 1YIVA 1KT5A 1A3YA 1LICA 4ORWA 4XMCA 2JU7A 4KC8A 4ZHHA 4GH7A 4KT5A 5F58A 4U8UO 3GE2A 2CM4A 1YWCA 4XMDA 1ML7A 3T1DA 1JYJA 4QYNA 2RQ0A 2FR2A 1BBPA 1N0SA 4QQ1A 4Y0PA 5EZ2A 2JW1A 1X8NA 2MJIA 2MM3A 4N7DA 4IBAA 1YWDA 1AQBA 3NX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AT5 X;  4QYP A;  3U03 A;  3GAQ A;  1TVQ A;  1X8Q A;  1S44 A;  4ZHF A;  1QY2 A;  1S7D A;  4YFP A;  3F8A A;  3B2K A;  3PPT A;  1SY0 A;  1R0U A;  1ZNG A;  3RSW A;  3FMZ A;  1X8U A;  5D48 A;  4ZGU A;  2Q9S A;  5D45 A;  1ZNE A;  1AVG I;  2Q4N A;  3VG6 A;  1SXU A;  1HN2 A;  4YMY A;  1D2U A;  3C78 X;  4XMH A;  1GX9 A;  2YG2 A;  2XST A;  1VYG A;  2O62 A;  2Q39 A;  3D95 A;  3KQ0 A;  2AT3 X;  1H91 A;  1KQW A;  3BU9 A;  4AZQ A;  1X8P A;  1PBO A;  5F7G A;  1KZX A;  1I4U A;  5IO5 A;  1UZ2 X;  2IFB A;  5L8O A;  1SA8 A;  4HFO A;  5LKE A;  1BSQ A;  4IB7 A;  5HZ5 A;  2RCQ A;  1JJJ A;  3O22 A;  5LJC A;  5C0N A;  4PSQ A;  1P6P A;  1SY1 A;  3JSQ A;  1EUO A;  1ZNL A;  1B0O A;  3QKG A;  2A0A A;  4NLJ A;  2CZT A;  4QGW A;  4I9R A;  1MUP A;  3C76 X;  1QY0 A;  4CK4 A;  3MVF A;  1ZNK A;  2HYS A;  4TKH A;  4YGG A;  4AZM A;  1ALB A;  3KFG A;  3TZS A;  1FEM A;  3PH6 A;  4I3C A;  4OMX A;  4YGH A;  2AMM X;  3VG2 A;  4TKJ A;  1KGL A;  2ASN X;  3I17 A;  2OZQ A;  1LNM A;  1GKA A;  1LIB A;  1LIE A;  2KT4 B;  2WWP A;  4ALO A;  1E02 A;  1GXA A;  2FRS A;  4I3B A;  1G5W A;  1CBS A;  3P6F A;  2ACO A;  4YKM A;  4N7C A;  1OEE A;  4GE1 A;  1XKI A;  5EED A;  2EU7 X;  1FDQ A;  4YFR A;  1T0V A;  1BSO A;  5CE4 A;  3U0D A;  3O19 A;  2CBS A;  4WFV A;  1BWY A;  1B56 A;  2KTD A;  3NP1 A;  3G7X A;  2XKL A;  4IB9 A;  3APV A;  3CMP A;  3TGC A;  1PMP A;  4IB6 A;  1AB0 A;  5HZ9 A;  1D3S A;  1SXY A;  2DM5 A;  1FEN A;  2FR3 A;  4AYH A;  5BVT A;  2Q2P A;  2WR6 A;  2AT0 X;  1YP7 A;  3P6G A;  2WSJ A;  4GNY A;  2CBR A;  4QGX A;  4A60 A;  4YFQ A;  1S2P A;  3IA8 A;  3BDR A;  1ERX A;  3D97 A;  4ES7 A;  3WJC A;  3NPO A;  4K19 A;  2AL0 X;  3BS2 A;  1O8V A;  1OBU A;  3IFB A;  2A2G A;  5H9A A;  5L8N A;  4YBP A;  4DQ3 A;  5HAE A;  1O1V A;  3NQ3 A;  3VG7 A;  2HNX A;  5JR8 A;  1KT6 A;  5HZQ A;  2QOS C;  1BM5 A;  3ZUI A;  1EPA A;  4GET A;  4ORX A;  2QO6 A;  2CM9 A;  1KT3 A;  2RD7 C;  1GT3 A;  2FS7 A;  3BX8 A;  5DPQ A;  2G7B A;  3DSZ A;  3EYC A;  3O2Y A;  3NR3 A;  2NND A;  4AZN A;  1GX8 A;  1LIF A;  4XME A;  5HWZ A;  1SXX A;  3WJE A;  1T8V A;  2HLV A;  4TLJ A;  3I0A A;  3FEP A;  5D4A A;  3PEC A;  4RUN A;  1MX8 A;  2NNQ A;  5IO7 A;  4LKT A;  1KOI A;  1ACD A;  3FR2 A;  1OPA A;  5KHP A;  3NX1 A;  3WJD A;  1OEJ A;  1MX7 A;  1QWD A;  2JU8 A;  5DG4 A;  4EDE A;  1GM6 A;  1LFO A;  2LBV A;  3WJG A;  4XMG A;  3P6C A;  4KII A;  3B2L A;  5LJE A;  3ZQ3 A;  1A18 A;  1TOU A;  2L5P A;  4HPA A;  3UEU A;  2OFR X;  2JOZ A;  3FEK A;  2AT6 X;  4AW8 A;  3L4R A;  2NNE A;  4QZT A;  1KT4 A;  1B8E A;  2JU3 A;  1HQP A;  4IMO A;  5B27 A;  3WVM A;  5H9L A;  1KT7 A;  4ALB A;  2NP1 A;  3BLG A;  2G78 A;  1QQS A;  2JN3 A;  2OVD A;  5F6B A;  4AZP A;  1KQX A;  1CJ5 A;  2WEW A;  3UEW A;  1BEB A;  1EW3 A;  1YWB A;  1BRQ A;  1CRB A;  1DZJ A;  2FWV A;  2K62 A;  4EFG A;  4UU2 A;  3F9D A;  3RZY A;  4TKB A;  1EXS A;  1NP1 A;  1OBP A;  5F1E A;  2FTB A;  5HZ8 A;  1BSY A;  4ORU A;  5K06 A;  5LJB A;  4ZH6 A;  4MVI A;  1NP4 A;  1ZND A;  3CQR A;  1OEK A;  4WBK A;  2L9C A;  3HWG A;  1JYD A;  4IB8 A;  4I3D A;  5LJK A;  2P8G A;  3FLL A;  4IAX A;  4IAW A;  3FEN A;  1MDC A;  3FIQ A;  4I9S A;  1A57 A;  2WQA E;  2OVE A;  3NQ9 A;  4A1Y A;  1GT4 A;  1KZW A;  3FEL A;  4ZJ0 A;  2FLJ A;  4ZHC A;  1XCA A;  3FW5 A;  5EDC A;  4ZHG A;  3BY0 A;  3NAD A;  1A2D A;  1SY2 A;  2WUT A;  5HA1 A;  1U0X A;  5BVQ A;  2AH7 X;  3APW A;  4BQU A;  3FR4 A;  5BVS A;  3STN A;  3B2J A;  2MO5 A;  2R56 A;  3D96 A;  1YUP A;  1I04 A;  5KIC A;  4R0B A;  4ORR A;  2AT8 X;  3APU A;  1IFC A;  4YDA A;  1KXO A;  1QAB E;  4UU3 A;  2LKK A;  4O9S A;  2W2B A;  3FA9 A;  5AQ6 A;  3HWF A;  1IIU A;  1OBQ A;  3AKM A;  5HCC C;  1GGL A;  2ACP X;  4IMN A;  2RCT A;  3CBS A;  1FEL A;  5HCD C;  3TF6 A;  4GRJ A;  1JZU A;  4YCE A;  3VG3 A;  4ZFX A;  1X8O A;  1IKJ A;  2LFO A;  4NYQ A;  1BRP A;  5FAZ A;  3FA6 A;  1LPJ A;  1PEE A;  4WFU A;  2W2A A;  4EEJ A;  4NNS A;  2X46 A;  5HTE A;  2POA A;  1CBR A;  3BU1 A;  1RLB E;  4D6A A;  4HPD A;  2X45 A;  3BX7 A;  1URE A;  3P6E A;  3KFI A;  3PED A;  4Y0Q A;  3P6H A;  3HWD A;  4YH0 A;  3PP6 A;  1DZK A;  5D8J A;  5EPQ A;  3UEV A;  3WXQ A;  3ZUO A;  1X89 A;  3B2I A;  2OVA A;  3KFF A;  5D47 A;  2R74 A;  2BLG A;  4MVK A;  5EDB A;  1QFV A;  1HMR A;  4RUU A;  3K3L A;  1E00 A;  4YKO A;  3C77 X;  2HMB A;  5IO6 A;  4EXZ A;  3HWE A;  2WQ9 A;  1OPB A;  1DZP A;  1ADL A;  1DFV A;  4D6B A;  2CZU A;  2N93 A;  3APX A;  4AZR A;  1E06 A;  1IW2 A;  1EPB A;  3ELX A;  2Q2M A;  1HBP A;  5EEE A;  1IFB A;  3FA8 A;  1TOW A;  4Y0R A;  1GT5 A;  4NYR A;  1LKE A;  1GT1 A;  1QFT A;  3FR5 A;  4ZH9 A;  1YWA A;  1EII A;  3DTQ A;  1TXL A;  5HCE C;  1L6M A;  4M6S A;  3WJF A;  3AKN A;  1FE3 A;  4OS3 A;  5HTD A;  3EBW A;  1CBI A;  4Y0S A;  2ANS A;  4ZR2 A;  3WJB A;  4ARH A;  1I06 A;  2HZQ A;  3UEX A;  4ZCB A;  4GKC A;  2GC9 A;  4TNN A;  2FS6 A;  2A13 A;  2QM9 A;  4MVL A;  1BJ7 A;  4ZHD A;  1E5P A;  3EM0 A;  2A2U A;  4OMW A;  3MBT A;  1ERB A;  4YCH A;  2HZR A;  2FT9 A;  1EQD A;  1G7N A;  4NLI A;  1G85 A;  1VPR A;  3WBG A;  1JJX A;  2GJ5 A;  2W2F A;  1JV4 A;  1SY3 A;  1T68 X;  4NNT A;  4LKP A;  1X71 A;  4NP1 A;  5HBS A;  4TJZ A;  4ORY A;  3CQN A;  2AKQ A;  1YP6 A;  2LB6 A;  1ZRY A;  1DF3 A;  4QGV A;  2G79 A;  3CR6 A;  3TGA A;  1SXW A;  5H9N A;  1NGL A;  3FW4 A;  4YGZ A;  5LJG A;  3S26 A;  5LKF A;  3VG4 A;  1DV9 A;  3BRN A;  3VG5 A;  1HMS A;  1HMT A;  4BOE A;  1RBP A;  2L67 A;  5HZ6 A;  1MVG A;  3P6D A;  4M7M A;  3OJY C;  3STK A;  1G74 A;  2QO5 A;  2WEX A;  3B2H A;  4OS0 A;  4TQ2 A;  3CBC A;  5LJD A;  1VYF A;  3Q6L A;  1ZNH A;  4LZV A;  3CWK A;  4BVM A;  5KID A;  1O1U A;  5FEN A;  3EMM A;  5F6Z A;  3FA7 A;  1DC9 A;  4A8Z A;  5FFH A;  1AEL A;  5H8T A;  3TGB A;  3PH5 A;  1TW4 A;  3BSZ E;  4QAE A;  4AZO A;  1B4M A;  3ELZ A;  5HA0 A;  2K23 A;  1CBQ A;  4DQ4 A;  2QO4 A;  4YDB A;  2L68 A;  3KZA A;  4QZU A;  4GNW A;  1EAL A;  1ICM A;  5L8I A;  1GKA B;  1LID A;  3JS1 A;  1EIO A;  1I05 A;  5B29 A;  2OFM X;  3STM X;  4HPB A;  1U18 A;  4YBU A;  4A1H A;  1BLR A;  2GTF X;  1Z24 A;  1IKE A;  1ICN A;  2PY1 A;  3U9P C;  5LJH A;  1HBQ A;  3KFH A;  4XMF A;  2RA6 A;  2ALL X;  2A3F X;  2F73 A;  1QG5 A;  4ODD A;  1JBH A;  4ORS A;  1PM1 X;  1U17 A;  3EBK A;  3HK1 A;  1LF7 A;  5H9K A;  4LZU A;  3SAO A;  1QY1 A;  4HPC A;  2E4J A;  4OS8 A;  1DZM A;  2LBA A;  2R73 A;  1FTP A;  1YIV A;  1KT5 A;  1A3Y A;  1LIC A;  4ORW A;  4XMC A;  2JU7 A;  4ZHH A;  4GH7 A;  5F58 A;  2CM4 A;  1YWC A;  4XMD A;  1ML7 A;  3T1D A;  1JYJ A;  4QYN A;  2RQ0 A;  2FR2 A;  1BBP A;  1N0S A;  4Y0P A;  5EZ2 A;  1X8N A;  2MJI A;  2MM3 A;  4N7D A;  4IBA A;  1YWD A;  1AQB A;  3NX2 A; 
#chains in the Genus database with same CATH topology
 2AT5 X;  4QYP A;  3CKF A;  3U03 A;  3GAQ A;  1TVQ A;  1X8Q A;  1S44 A;  4ZHF A;  1QY2 A;  3S60 A;  1S7D A;  4YFP A;  3F8A A;  3B2K A;  3PPT A;  1SY0 A;  4FBV A;  1R0U A;  1ZNG A;  2RTF B;  4GK9 A;  4O3X B;  3RSW A;  3RWX A;  3SZI A;  3FMZ A;  1X8U A;  5D48 A;  4ZGU A;  2IZA A;  3N91 A;  4JO6 A;  2Q9S A;  5D45 A;  1ZNE A;  1AVG I;  3WYQ A;  3H3I A;  2Q4N A;  3RDQ A;  3VG6 A;  2X34 A;  1RST B;  1SXU A;  2OY1 O;  1HN2 A;  1NBX A;  2BSZ A;  4YMY A;  1D2U A;  3C78 X;  2OL8 O;  2QCB A;  1W5R A;  4XMH A;  5B10 O;  2JMB A;  1SWF A;  1GX9 A;  2YG2 A;  2FHN X;  2XST A;  2GTL N;  1LCZ A;  1VYG A;  2O62 A;  2Q39 A;  3D95 A;  1N4J A;  3KQ0 A;  4FBO A;  4LQZ A;  2GTL M;  2M4L A;  2AT3 X;  1H91 A;  1KQW A;  1SLE B;  2UYW A;  3BU9 A;  4U3Q A;  3MM0 A;  4AZQ A;  1X8P A;  1Y9T A;  1PBO A;  1LUQ A;  5F7G A;  4CPI A;  2IZE B;  1KZX A;  1I4U A;  4COT A;  1E2T A;  3T2W A;  5IO5 A;  1UZ2 X;  2IFB A;  5L8O A;  1SA8 A;  4HFO A;  5K68 A;  1BSQ A;  5LKE A;  4IB7 A;  5HZ5 A;  2RCQ A;  1JJJ A;  3O22 A;  5LJC A;  1STP A;  5C0N A;  4PSQ A;  1JJU A;  1VWB B;  2PI3 O;  1P6P A;  1SY1 A;  2MF6 A;  1HQQ A;  1HXL A;  1EUO A;  3JSQ A;  1ZNL A;  4CDE A;  4YVB A;  1B0O A;  3QKG A;  2OYB O;  2A0A A;  4NLJ A;  2CZT A;  4Z27 A;  2RTO B;  4BX7 A;  4QGW A;  4I9R A;  1MUP A;  3C76 X;  1QY0 A;  4CK4 A;  4CPH B;  5AEO A;  3MVF A;  4GUZ A;  4INN A;  1ZNK A;  2HYS A;  2RTI B;  4TKH A;  2OF9 A;  1KL3 A;  5CHK A;  1ALB A;  4YGG A;  4AZM A;  3KFG A;  3TZS A;  2RTM A;  1FEM A;  2X8F A;  3PH6 A;  4BBO A;  1SRG A;  2X32 A;  1LEL A;  4I3C A;  4OMX A;  4IAB A;  4YGH A;  2AMM X;  3FDC A;  5AJB A;  3SLO A;  3VG2 A;  4TKJ A;  4GZV A;  1KGL A;  2ASN X;  3I17 A;  2OZQ A;  1LNM A;  1GKA A;  3VE2 A;  1LIB A;  1LIE A;  2KT4 B;  2RTB B;  2WWP A;  5FQ8 E;  1E02 A;  1GXA A;  1JIW I;  2FRS A;  4I3B A;  4CV7 A;  1G5W A;  1CBS A;  1FJ1 E;  3P6F A;  3RY2 A;  2ACO A;  5IRW A;  4YKM A;  4I60 A;  4N7C A;  4CSB A;  1OEE A;  3ZI8 A;  4GE1 A;  1XKI A;  5EED A;  2EU7 X;  2BC3 A;  1FDQ A;  4MIR A;  1T0V A;  2C4I A;  4YFR A;  1NQM A;  1BSO A;  5CE4 A;  3U0D A;  4CDC A;  1HXZ A;  2CBS A;  3O19 A;  4O49 A;  4WFV A;  2GH7 A;  1BWY A;  2FKG A;  1B56 A;  2KTD A;  3NP1 A;  3G7X A;  4CPE A;  2F09 A;  2XKL A;  3APV A;  1SWP A;  3CMP A;  1PMP A;  1STS B;  3HOE A;  4IB6 A;  4IB9 A;  1AB0 A;  1VYO A;  2IZF B;  5HZ9 A;  1JQP A;  1D3S A;  5IXG A;  1SXY A;  2DM5 A;  1FEN A;  2FR3 A;  4AYH A;  4GD9 A;  2Q2P A;  2WR6 A;  5BVT A;  2X55 A;  2AT0 X;  4MIS A;  4I6S A;  1VWK B;  1YP7 A;  1VWF B;  3P6G A;  2WSJ A;  5B11 O;  4GNY A;  2CBR A;  4QGX A;  4A60 A;  1NC9 A;  1SRI A;  1SWO A;  4YFQ A;  3RE5 A;  1AVD A;  1S2P A;  3BDR A;  1ERX A;  1VWQ B;  1W4T A;  3D97 A;  3IA8 A;  3WJC A;  3NPO A;  4K19 A;  4ES7 A;  2AL0 X;  3BS2 A;  1O8V A;  1OBU A;  3IFB A;  2A2G A;  5H9A A;  5L8N A;  4YBP A;  1SWA A;  3P02 A;  3RDM A;  4CPF A;  4DQ3 A;  5HAE A;  1O1V A;  2BS6 A;  3HOL A;  3NQ3 A;  3VG7 A;  2HNX A;  5JR8 A;  4U8U N;  1KT6 A;  5HZQ A;  2QOS C;  3UAQ A;  1BM5 A;  3ZUI A;  4GJV A;  1EPA A;  4GET A;  4ORX A;  1LDQ A;  2QO6 A;  2CM9 A;  1KT3 A;  2RD7 C;  1GT3 A;  5B3M O;  4ALO A;  2FS7 A;  3BX8 A;  4L1N A;  1VWM B;  5DPQ A;  2G7B A;  4QRL A;  1AVE A;  3DSZ A;  3RDS A;  1MK5 A;  3EYC A;  2OF8 A;  3NR3 A;  3O2Y A;  2IZG B;  3RDO A;  2NND A;  4AZN A;  1GX8 A;  1LIF A;  3EC5 A;  4XME A;  1SXX A;  3SLJ A;  5HWZ A;  3WJE A;  2AVI A;  1T8V A;  2HLV A;  4TLJ A;  3VPJ E;  3I0A A;  3FEP A;  5D4A A;  3PEC A;  4RUN A;  1MX8 A;  2NNQ A;  4Z2O A;  5IO7 A;  4O4X A;  4LKT A;  1KOI A;  1ACD A;  1W6F A;  1OPA A;  3FR2 A;  2OVS A;  4ID2 A;  5KHP A;  3NX1 A;  3WJD A;  1OEJ A;  1MX7 A;  1SLF B;  5AJC A;  1QWD A;  2JU8 A;  5DG4 A;  4EDE A;  1GM6 A;  2IZK A;  1VWD B;  1NDJ A;  1LFO A;  2LBV A;  3WJG A;  4XMG A;  1SRJ A;  3P6C A;  1SMP I;  4KII A;  1VWL B;  3B2L A;  1WBI A;  5LJE A;  3ZQ3 A;  1A18 A;  1TOU A;  2L5P A;  4HPA A;  2IZC B;  3UEU A;  2OFR X;  4ML7 B;  2JOZ A;  2RTK A;  3FEK A;  2AT6 X;  3SLT A;  4AW8 A;  1MEP A;  2DJF A;  2NNE A;  3L4R A;  4QZT A;  1KT4 A;  1B8E A;  2ZAG A;  3EW2 A;  3PDF A;  2JU3 A;  1HQP A;  4IMO A;  5B27 A;  2G5L A;  3WVM A;  5H9L A;  1KT7 A;  4ALB A;  1SWK A;  2NP1 A;  2G78 A;  1QQS A;  2JN3 A;  2OVD A;  3BLG A;  2LA7 A;  5F6B A;  1KQX A;  3RY1 A;  4AZP A;  1CJ5 A;  3T6L A;  4O4S A;  2WEW A;  4MVE A;  3UEW A;  1MM9 A;  1BEB A;  2QOM A;  2WPU A;  1EW3 A;  1YWB A;  2RTA A;  4BX6 A;  2AF5 A;  1BRQ A;  1CRB A;  1DZJ A;  2FWV A;  4CPH A;  2K62 A;  4EFG A;  1Y53 X;  4BX5 A;  4UU2 A;  3VHH A;  3F9D A;  3RZY A;  1LCW A;  3VHM A;  2IZH B;  1EXS A;  1NP1 A;  3HPE A;  4TKB A;  1OBP A;  2FGS A;  2OY8 A;  1I9H A;  4GDZ A;  1Y55 X;  5F1E A;  1RXH A;  2FTB A;  4Z2V A;  1KL5 A;  1BSY A;  1SWL A;  2RTH B;  4ORU A;  5HZ8 A;  5K06 A;  2YMS A;  1N43 A;  5LJB A;  4ZH6 A;  4MVI A;  1NP4 A;  1VWC B;  1ZND A;  3CQR A;  1OEK A;  4WBK A;  5FQ6 E;  2L9C A;  3ZW0 A;  1SRE A;  3HWG A;  1JYD A;  1K3B A;  3F6Z B;  4I3D A;  2C1S A;  4IB8 A;  2BHV A;  2P8G A;  3FLL A;  4IAX A;  4IAW A;  3FEN A;  1MDC A;  3FIQ A;  4I9S A;  4KH8 A;  2WQA E;  3VHI A;  4BX6 B;  1A57 A;  3MX7 A;  2OVE A;  3NQ9 A;  5F2B A;  5IRU A;  4FQB B;  4A1Y A;  4BX5 B;  4JNJ A;  1WUB A;  1GT4 A;  3SZJ A;  2GTL O;  2I5V O;  1KZW A;  3FEL A;  4O3Y A;  1VWH B;  4ZJ0 A;  4OEL A;  2FLJ A;  1JMX A;  4ZHC A;  1XCA A;  3FW5 A;  4PJ2 A;  4Y59 A;  5EDC A;  4ZHG A;  3BY0 A;  3NAD A;  1A2D A;  1SY2 A;  2WUT A;  5HA1 A;  1U0X A;  2JGS A;  3HTY A;  5BVQ A;  2AH7 X;  3APW A;  4BQU A;  2VFB A;  3FR4 A;  5BVS A;  3STN A;  3B2J A;  2MO5 A;  2RTP B;  3ZW0 B;  3AEH A;  3NQK A;  2CAM A;  2F01 A;  2R56 A;  3D96 A;  1YUP A;  1Y52 X;  1I04 A;  5KIC A;  1Y9L A;  1VWR B;  3AUM O;  4R0B A;  1SWN A;  4ORR A;  3LTW A;  2AT8 X;  3APU A;  4Z28 A;  3OD9 A;  1IFC A;  4YDA A;  1KXO A;  1SLG B;  3OBL A;  5L3Y A;  1QAB E;  4UU3 A;  2LKK A;  4O9S A;  5FQ7 E;  3ZUO A;  2W2B A;  3FA9 A;  5AQ6 A;  3HWF A;  3NBX X;  1IIU A;  1OBQ A;  3AKM A;  4C5P A;  5HCC C;  1GGL A;  2ACP X;  4IMN A;  1SWE A;  1UYN X;  1PTS A;  2RCT A;  3CBS A;  1FEL A;  4GJS A;  4HWM A;  5HCD C;  1N7Y A;  3TF6 A;  4GRJ A;  2RN4 A;  3RDX A;  1JZU A;  4YCE A;  3VG3 A;  4ZFX A;  1SRF A;  1X8O A;  1IKJ A;  2LFO A;  4NYQ A;  1BRP A;  5FAZ A;  3FID A;  3FA6 A;  4JGL A;  1LPJ A;  2MWH A;  1PEE A;  2Y32 A;  4WFU A;  1SWJ A;  1Y0G A;  2ZAI A;  4FBR A;  4Z6J A;  2W2A A;  4EEJ A;  4NNS A;  2X46 A;  1VWG B;  2FHL A;  5HTE A;  2POA A;  1PBY A;  1CBR A;  3BU1 A;  1RLB E;  5CYB A;  4BGF A;  4D6A A;  4U8U M;  3VE1 A;  3JQO A;  4L3R A;  4HPD A;  2X45 A;  3BX7 A;  2G8C O;  1URE A;  5B2A O;  3P6E A;  2BS5 A;  3CKG A;  3KFI A;  4Y5D A;  2FKJ A;  3PED A;  4Y0Q A;  3P6H A;  3HWD A;  2X4M A;  2KTS A;  1DZK A;  3PP6 A;  4YH0 A;  5D8J A;  5EPQ A;  3UEV A;  3WXQ A;  2RTC B;  1X89 A;  4O3Z A;  3B2I A;  3SOT A;  2OVA A;  1K24 A;  1N9Y A;  3KFF A;  1SWB A;  2KD2 A;  1RAV A;  5D47 A;  1OSP O;  2R74 A;  1SWD A;  5K67 A;  2OFB A;  3OE3 A;  2BLG A;  4MVK A;  5EDB A;  1QFV A;  1HMR A;  4RUU A;  3K3L A;  2A5C A;  2Y3E A;  1E00 A;  4YKO A;  3C77 X;  2HMB A;  1RXK A;  4MEE A;  2KW1 A;  3ZW1 A;  4EXZ A;  1VWJ B;  3HWE A;  5B5F A;  2A8G A;  5IO6 A;  4EQA C;  3RBY A;  2WQ9 A;  1OPB A;  1DZP A;  1LCV A;  3SZH A;  1ADL A;  1DFV A;  4D6B A;  1VWO B;  4NV7 A;  2CZU A;  2N93 A;  3APX A;  3S5X A;  4AZR A;  4BJ8 A;  1E06 A;  4IRW A;  1IW2 A;  3WOV A;  3P24 A;  1EPB A;  2RTG B;  1STR B;  2Q2M A;  3ELX A;  4KC7 A;  3WZN A;  5HZ6 A;  2IZL B;  4FGI B;  1HBP A;  5EEE A;  1SWU A;  5IRA A;  3FYF A;  1IFB A;  3FA8 A;  1TOW A;  4O4O A;  4Y0R A;  1GT5 A;  4NYR A;  1LKE A;  1GT1 A;  1SWG A;  1QFT A;  4GGZ A;  3ZW1 B;  3RE6 A;  1UYO X;  1KL4 A;  4DCB A;  3FR5 A;  4ZH9 A;  4GU8 A;  1YWA A;  1SRH A;  4O4U A;  1IJ8 A;  5LJK A;  3TGC A;  1EII A;  3DTQ A;  4I95 A;  3RDU A;  1TXL A;  5HCE C;  1L6M A;  4M6S A;  3WJF A;  3AKN A;  1FE3 A;  3D9W A;  4OS3 A;  5HTD A;  3EBW A;  4GGT A;  1EI5 A;  2OY5 O;  1CBI A;  4Y0S A;  2ANS A;  4ZR2 A;  3WJB A;  4ARH A;  1I06 A;  2HZQ A;  3UEX A;  4ZCB A;  4GKC A;  2GC9 A;  4TNN A;  2FS6 A;  2A13 A;  3WZQ A;  3X00 A;  2QM9 A;  4MVL A;  1BJ7 A;  4ZHD A;  1E5P A;  3EM0 A;  2Z4I A;  2A2U A;  4OMW A;  4ZGF A;  2X8S A;  2OFA A;  3MBT A;  1ERB A;  2OL7 A;  3E3C A;  3V8U A;  4YCH A;  2HZR A;  2FT9 A;  1EQD A;  1G7N A;  4NLI A;  1G85 A;  1VPR A;  3WBG A;  1JJX A;  2GJ5 A;  2RTN B;  3WZP A;  2W2F A;  1JV4 A;  4U46 A;  1SY3 A;  2MHD A;  1T68 X;  3WZO A;  4NNT A;  1DF8 A;  4LKP A;  1SLD B;  1X71 A;  5CSE A;  4NP1 A;  5HBS A;  4TJZ A;  4ORY A;  3CQN A;  3WYP A;  1SWQ A;  2AKQ A;  4Z2P A;  1YP6 A;  1SWH A;  4CDF A;  2IZB A;  2LB6 A;  1ZRY A;  1JMZ A;  1DF3 A;  4QGV A;  2G79 A;  3CR6 A;  1VWI B;  1SXW A;  3TGA A;  5H9N A;  1NGL A;  3ZWE A;  1GX3 A;  3FW4 A;  4ON1 A;  4YGZ A;  5LJG A;  4JHQ A;  4QNI A;  2Z4H A;  5LKF A;  3S26 A;  3VG4 A;  1RSU B;  1DV9 A;  3BRN A;  3LHN A;  2DJG A;  2C1Q A;  3VG5 A;  3PQU A;  1HMS A;  3LV4 A;  1HMT A;  2UZ2 A;  4OKA A;  1RBP A;  2L67 A;  4WHI A;  4BOE A;  1MVG A;  3P6D A;  2RTJ A;  1VWN B;  4GGR A;  4KCA A;  4M7M A;  3OJY C;  3Q34 A;  3STK A;  1G74 A;  2QO5 A;  4U9C A;  2WEX A;  3B2H A;  4OS0 A;  4TQ2 A;  3CBC A;  5LJD A;  1VYF A;  2RTL A;  3Q6L A;  1ZNH A;  4LZV A;  4O3W A;  3T2X A;  1SWC A;  3CWK A;  2RTD B;  4BVM A;  5KID A;  2RTE B;  4DNE A;  1O1U A;  2X56 A;  3EMM A;  3VGW A;  5F6Z A;  3ZZV A;  5FEN A;  3FA7 A;  1DC9 A;  2HKD A;  5FFH A;  4A8Z A;  5H8T A;  4BX7 B;  3T6F A;  3TGB A;  1AEL A;  3PH5 A;  1TW4 A;  3BSZ E;  1VWA B;  4QAE A;  2A5B A;  3ZW2 A;  3S5V A;  4AZO A;  1B4M A;  1VWE B;  3ELZ A;  1SWT A;  3MG5 A;  2K23 A;  5HA0 A;  1CBQ A;  5BYP A;  4DQ4 A;  1NQN A;  2QO4 A;  4YDB A;  2L68 A;  3KZA A;  2QMI A;  3KVN A;  2IZD B;  4QZU A;  4GNW A;  3VU1 A;  1EAL A;  1ICM A;  3PQS A;  5L8I A;  1GKA B;  2IZJ A;  1LID A;  3JS1 A;  1EIO A;  1I05 A;  4EKV A;  5B29 A;  1I78 A;  2OFM X;  1MOY A;  4OEM A;  3STM X;  4HPB A;  1U18 A;  4YBU A;  4NW4 A;  3EW1 A;  4A1H A;  1BLR A;  2GTF X;  1Z24 A;  3RKG A;  1IKE A;  1N9M A;  4BCS A;  5JD2 A;  1ICN A;  2PY1 A;  4GDA A;  3U9P C;  5LJH A;  1HBQ A;  3KFH A;  4XMF A;  2RA6 A;  1HY2 A;  2ALL X;  2A3F X;  2RTR B;  2RTQ B;  2Y3F A;  2IZI A;  1VWP B;  2F73 A;  1SWS A;  1QG5 A;  4ODD A;  1JBH A;  4ORS A;  1PM1 X;  1U17 A;  2OL6 O;  3D4R A;  1LF7 A;  3EBK A;  3HK1 A;  4LZU A;  2X8T A;  5H9K A;  3SAO A;  2VFC A;  1QY1 A;  4HPC A;  2E4J A;  4OS8 A;  1DZM A;  4NV8 A;  2LBA A;  2R73 A;  1FTP A;  2BT9 A;  1YIV A;  1KT5 A;  1A3Y A;  1LIC A;  4ORW A;  4XMC A;  2JU7 A;  4B55 A;  2VDF A;  4CDD A;  4KC8 A;  4ZHH A;  4GH7 A;  4KT5 A;  5F58 A;  4U8U O;  5B5G A;  1KFF A;  3GE2 A;  2CM4 A;  1YWC A;  2I5Z O;  2OY7 A;  4XMD A;  1ML7 A;  3T1D A;  1JYJ A;  4QYN A;  1SWR A;  2RQ0 A;  2FR2 A;  1BBP A;  1N0S A;  3PK2 A;  4QQ1 A;  4Y0P A;  5EZ2 A;  2JW1 A;  1X8N A;  2MJI A;  2MM3 A;  4N7D A;  4IBA A;  1LDO A;  2ZSC A;  3QQ2 A;  1YWD A;  1AQB A;  3NX2 A;  1RXJ A; 
#chains in the Genus database with same CATH homology
 2AT5 X;  4QYP A;  3U03 A;  3GAQ A;  1TVQ A;  1X8Q A;  1S44 A;  4ZHF A;  1QY2 A;  3S60 A;  1S7D A;  4YFP A;  3F8A A;  3B2K A;  3PPT A;  1SY0 A;  4FBV A;  1R0U A;  1ZNG A;  4GK9 A;  4O3X B;  3RSW A;  3RWX A;  3FMZ A;  1X8U A;  5D48 A;  4ZGU A;  3N91 A;  2Q9S A;  5D45 A;  1ZNE A;  1AVG I;  3H3I A;  2Q4N A;  3VG6 A;  1SXU A;  1HN2 A;  4YMY A;  1D2U A;  3C78 X;  4XMH A;  2JMB A;  1GX9 A;  2YG2 A;  2XST A;  2GTL N;  1VYG A;  2O62 A;  2Q39 A;  3D95 A;  3KQ0 A;  4FBO A;  4LQZ A;  2GTL M;  2M4L A;  2AT3 X;  1H91 A;  1KQW A;  4U3Q A;  3BU9 A;  4AZQ A;  1X8P A;  1Y9T A;  1PBO A;  5F7G A;  1KZX A;  1I4U A;  4COT A;  5IO5 A;  1UZ2 X;  2IFB A;  5L8O A;  1SA8 A;  4HFO A;  5LKE A;  1BSQ A;  4IB7 A;  5HZ5 A;  2RCQ A;  1JJJ A;  3O22 A;  5LJC A;  5C0N A;  4PSQ A;  1P6P A;  1SY1 A;  3JSQ A;  1EUO A;  1ZNL A;  1B0O A;  3QKG A;  2A0A A;  4NLJ A;  2CZT A;  4QGW A;  4I9R A;  1MUP A;  3C76 X;  1QY0 A;  4CK4 A;  5AEO A;  3MVF A;  4INN A;  1ZNK A;  2HYS A;  4TKH A;  4YGG A;  4AZM A;  1ALB A;  3KFG A;  3TZS A;  1FEM A;  2X8F A;  3PH6 A;  4I3C A;  4OMX A;  4IAB A;  4YGH A;  2AMM X;  5AJB A;  3VG2 A;  4TKJ A;  4GZV A;  1KGL A;  2ASN X;  3I17 A;  2OZQ A;  1LNM A;  1GKA A;  3VE2 A;  1LIB A;  1LIE A;  2KT4 B;  2WWP A;  5FQ8 E;  4ALO A;  1E02 A;  1GXA A;  1JIW I;  2FRS A;  4I3B A;  4CV7 A;  1G5W A;  1CBS A;  3P6F A;  2ACO A;  4YKM A;  4N7C A;  1OEE A;  3ZI8 A;  4GE1 A;  1XKI A;  5EED A;  2EU7 X;  1FDQ A;  4MIR A;  1T0V A;  4YFR A;  1BSO A;  5CE4 A;  3U0D A;  3O19 A;  2CBS A;  4O49 A;  4WFV A;  1BWY A;  1B56 A;  2KTD A;  3NP1 A;  3G7X A;  4CSB A;  2F09 A;  2XKL A;  3APV A;  3CMP A;  3HOE A;  1PMP A;  4IB9 A;  4IB6 A;  3TGC A;  1AB0 A;  5HZ9 A;  1D3S A;  1SXY A;  2DM5 A;  1FEN A;  2FR3 A;  4AYH A;  5BVT A;  2Q2P A;  2WR6 A;  2AT0 X;  4MIS A;  4I6S A;  1YP7 A;  3P6G A;  2WSJ A;  4GNY A;  2CBR A;  4QGX A;  4A60 A;  4YFQ A;  1S2P A;  3IA8 A;  3BDR A;  1ERX A;  3D97 A;  4ES7 A;  3WJC A;  3NPO A;  4K19 A;  2AL0 X;  3BS2 A;  1O8V A;  1OBU A;  3IFB A;  2A2G A;  5H9A A;  5L8N A;  4YBP A;  3P02 A;  4DQ3 A;  5HAE A;  1O1V A;  2BS6 A;  3HOL A;  3NQ3 A;  3VG7 A;  2HNX A;  5JR8 A;  4U8U N;  1KT6 A;  5HZQ A;  2QOS C;  3UAQ A;  1BM5 A;  3ZUI A;  1EPA A;  4GET A;  4ORX A;  2QO6 A;  2CM9 A;  1KT3 A;  2RD7 C;  1GT3 A;  2FS7 A;  3BX8 A;  4L1N A;  5DPQ A;  2G7B A;  4QRL A;  3DSZ A;  3EYC A;  3O2Y A;  3NR3 A;  2NND A;  4AZN A;  1GX8 A;  1LIF A;  4XME A;  5HWZ A;  1SXX A;  3WJE A;  1T8V A;  2HLV A;  4TLJ A;  3VPJ E;  3I0A A;  3FEP A;  5D4A A;  3PEC A;  4RUN A;  1MX8 A;  2NNQ A;  5IO7 A;  4O4X A;  4LKT A;  1KOI A;  1ACD A;  3FR2 A;  1OPA A;  2OVS A;  4ID2 A;  5KHP A;  3NX1 A;  3WJD A;  1OEJ A;  1MX7 A;  5AJC A;  1QWD A;  2JU8 A;  5DG4 A;  4EDE A;  1GM6 A;  1LFO A;  2LBV A;  3WJG A;  4XMG A;  3P6C A;  1SMP I;  4KII A;  3B2L A;  5LJE A;  3ZQ3 A;  1A18 A;  1TOU A;  2L5P A;  4HPA A;  3UEU A;  2OFR X;  4ML7 B;  2JOZ A;  3FEK A;  2AT6 X;  4AW8 A;  3L4R A;  2NNE A;  4QZT A;  1KT4 A;  1B8E A;  2ZAG A;  2JU3 A;  1HQP A;  4IMO A;  5B27 A;  3WVM A;  4EQA C;  5H9L A;  1KT7 A;  4ALB A;  2NP1 A;  3BLG A;  2G78 A;  1QQS A;  2JN3 A;  2OVD A;  5F6B A;  2LA7 A;  4AZP A;  1KQX A;  1CJ5 A;  4O4S A;  2WEW A;  4MVE A;  3UEW A;  1BEB A;  1EW3 A;  1YWB A;  1BRQ A;  1CRB A;  1DZJ A;  2FWV A;  2K62 A;  4EFG A;  4UU2 A;  3F9D A;  3RZY A;  4TKB A;  1EXS A;  1NP1 A;  1OBP A;  4GDZ A;  5F1E A;  2FTB A;  5HZ8 A;  1BSY A;  4ORU A;  5K06 A;  2YMS A;  5LJB A;  4ZH6 A;  4MVI A;  1NP4 A;  1ZND A;  3CQR A;  1OEK A;  4WBK A;  5FQ6 E;  2L9C A;  3ZW0 A;  3HWG A;  1JYD A;  4IB8 A;  3F6Z B;  4I3D A;  5LJK A;  2BHV A;  2P8G A;  3FLL A;  4IAX A;  4IAW A;  3FEN A;  1MDC A;  3FIQ A;  4I9S A;  4KH8 A;  2WQA E;  1A57 A;  3MX7 A;  2OVE A;  3NQ9 A;  4A1Y A;  4FQB B;  1GT4 A;  2GTL O;  1KZW A;  3FEL A;  4O3Y A;  4ZJ0 A;  2FLJ A;  4ZHC A;  1XCA A;  3FW5 A;  4PJ2 A;  5EDC A;  4ZHG A;  3BY0 A;  3NAD A;  1A2D A;  1SY2 A;  2WUT A;  5HA1 A;  1U0X A;  3HTY A;  5BVQ A;  2AH7 X;  3APW A;  4BQU A;  3FR4 A;  5BVS A;  3STN A;  3B2J A;  2MO5 A;  3ZW0 B;  3NQK A;  2R56 A;  3D96 A;  1YUP A;  1I04 A;  5KIC A;  1Y9L A;  4R0B A;  4ORR A;  2AT8 X;  3APU A;  3OD9 A;  1IFC A;  4YDA A;  1KXO A;  3OBL A;  1QAB E;  4UU3 A;  2LKK A;  4O9S A;  5FQ7 E;  2W2B A;  3FA9 A;  5AQ6 A;  3HWF A;  3NBX X;  1IIU A;  1OBQ A;  3AKM A;  5HCC C;  1GGL A;  2ACP X;  4IMN A;  2RCT A;  3CBS A;  1FEL A;  5HCD C;  4HWM A;  3TF6 A;  4GRJ A;  2RN4 A;  1JZU A;  4YCE A;  3VG3 A;  4ZFX A;  1X8O A;  1IKJ A;  2LFO A;  4NYQ A;  1BRP A;  5FAZ A;  3FA6 A;  4JGL A;  1LPJ A;  2MWH A;  1PEE A;  4WFU A;  2ZAI A;  4FBR A;  2W2A A;  4EEJ A;  4NNS A;  2X46 A;  5HTE A;  2POA A;  1CBR A;  3BU1 A;  1RLB E;  5CYB A;  4D6A A;  4U8U M;  3VE1 A;  3JQO A;  4L3R A;  4HPD A;  2X45 A;  3BX7 A;  1URE A;  3P6E A;  2BS5 A;  3KFI A;  3PED A;  4Y0Q A;  3P6H A;  3HWD A;  4YH0 A;  2KTS A;  1DZK A;  3PP6 A;  5D8J A;  5EPQ A;  3UEV A;  3WXQ A;  3ZUO A;  1X89 A;  4O3Z A;  3B2I A;  3SOT A;  2OVA A;  3KFF A;  5D47 A;  2KD2 A;  2R74 A;  3OE3 A;  2BLG A;  4MVK A;  5EDB A;  1QFV A;  1HMR A;  4RUU A;  3K3L A;  1E00 A;  4YKO A;  3C77 X;  2HMB A;  3ZW1 A;  2KW1 A;  5IO6 A;  4EXZ A;  3HWE A;  3RBY A;  2WQ9 A;  1OPB A;  1DZP A;  1ADL A;  1DFV A;  4D6B A;  2CZU A;  2N93 A;  3APX A;  3S5X A;  4AZR A;  1E06 A;  1IW2 A;  3WOV A;  3P24 A;  1EPB A;  3ELX A;  2Q2M A;  4KC7 A;  4FGI B;  1HBP A;  5EEE A;  3FYF A;  1IFB A;  3FA8 A;  1TOW A;  4O4O A;  4Y0R A;  1GT5 A;  4NYR A;  1LKE A;  1GT1 A;  1QFT A;  3ZW1 B;  3FR5 A;  4ZH9 A;  4GU8 A;  1YWA A;  4O4U A;  1EII A;  3DTQ A;  4I95 A;  1TXL A;  5HCE C;  1L6M A;  4M6S A;  3WJF A;  3AKN A;  1FE3 A;  4OS3 A;  5HTD A;  3EBW A;  1EI5 A;  1CBI A;  4Y0S A;  2ANS A;  4ZR2 A;  3WJB A;  4ARH A;  1I06 A;  2HZQ A;  3UEX A;  4ZCB A;  4GKC A;  2GC9 A;  4TNN A;  2FS6 A;  2A13 A;  2QM9 A;  4MVL A;  1BJ7 A;  4ZHD A;  1E5P A;  3EM0 A;  2Z4I A;  2A2U A;  4OMW A;  4ZGF A;  2X8S A;  3MBT A;  1ERB A;  3E3C A;  3V8U A;  4YCH A;  2HZR A;  2FT9 A;  1EQD A;  1G7N A;  4NLI A;  1G85 A;  1VPR A;  3WBG A;  1JJX A;  2GJ5 A;  2W2F A;  1JV4 A;  1SY3 A;  2MHD A;  1T68 X;  4NNT A;  4LKP A;  1X71 A;  4NP1 A;  5HBS A;  4TJZ A;  4ORY A;  3CQN A;  2AKQ A;  1YP6 A;  2LB6 A;  1ZRY A;  1DF3 A;  4QGV A;  2G79 A;  3CR6 A;  3TGA A;  1SXW A;  5H9N A;  1NGL A;  3ZWE A;  3FW4 A;  4YGZ A;  4ON1 A;  5LJG A;  4QNI A;  3S26 A;  2Z4H A;  5LKF A;  3VG4 A;  1DV9 A;  3BRN A;  3LHN A;  3VG5 A;  3PQU A;  1HMS A;  3LV4 A;  1HMT A;  4BOE A;  1RBP A;  2L67 A;  4WHI A;  5HZ6 A;  1MVG A;  3P6D A;  4M7M A;  4KCA A;  3OJY C;  3STK A;  1G74 A;  2QO5 A;  4U9C A;  2WEX A;  3B2H A;  4OS0 A;  4TQ2 A;  3CBC A;  5LJD A;  1VYF A;  3Q6L A;  1ZNH A;  4LZV A;  4O3W A;  3CWK A;  4BVM A;  5KID A;  1O1U A;  5FEN A;  3EMM A;  5F6Z A;  3ZZV A;  3FA7 A;  1DC9 A;  4A8Z A;  5FFH A;  1AEL A;  5H8T A;  3TGB A;  3PH5 A;  1TW4 A;  3BSZ E;  4QAE A;  3ZW2 A;  3S5V A;  4AZO A;  1B4M A;  3ELZ A;  5HA0 A;  2K23 A;  1CBQ A;  5BYP A;  4DQ4 A;  2QO4 A;  4YDB A;  2L68 A;  3KZA A;  2QMI A;  4QZU A;  4GNW A;  3VU1 A;  1EAL A;  1ICM A;  3PQS A;  5L8I A;  1GKA B;  1LID A;  3JS1 A;  1EIO A;  1I05 A;  5B29 A;  2OFM X;  3STM X;  4HPB A;  1U18 A;  4YBU A;  4NW4 A;  4A1H A;  1BLR A;  2GTF X;  1Z24 A;  3RKG A;  1IKE A;  1ICN A;  2PY1 A;  3U9P C;  5LJH A;  1HBQ A;  3KFH A;  4XMF A;  2RA6 A;  2ALL X;  2A3F X;  2F73 A;  1QG5 A;  4ODD A;  1JBH A;  4ORS A;  1PM1 X;  1U17 A;  3D4R A;  3EBK A;  1LF7 A;  3HK1 A;  5H9K A;  4LZU A;  2X8T A;  3SAO A;  1QY1 A;  4HPC A;  2E4J A;  4OS8 A;  1DZM A;  2LBA A;  2R73 A;  1FTP A;  2BT9 A;  1YIV A;  1KT5 A;  1A3Y A;  1LIC A;  4ORW A;  4XMC A;  2JU7 A;  4KC8 A;  4ZHH A;  4GH7 A;  4KT5 A;  5F58 A;  4U8U O;  3GE2 A;  2CM4 A;  1YWC A;  4XMD A;  1ML7 A;  3T1D A;  1JYJ A;  4QYN A;  2RQ0 A;  2FR2 A;  1BBP A;  1N0S A;  4QQ1 A;  4Y0P A;  5EZ2 A;  2JW1 A;  1X8N A;  2MJI A;  2MM3 A;  4N7D A;  4IBA A;  1YWD A;  1AQB A;  3NX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...