4TKBA

The 0.86 angstrom x-ray structure of the human heart fatty acid-binding protein complexed with lauric acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
133
structure length
133
Chain Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Fatty acid-binding protein, heart
publication title Water-mediated recognition of simple alkyl chains by heart-type Fatty-Acid-binding protein
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4tkbA00
4R0BA 3HWDA 5LJGA 3BU1A 5H9AA 1B8EA 5IO5A 1KT6A 2QO5A 5IO6A 2NNQA 5KICA 4A1YA 4I3CA 3HWEA 2QO6A 4LZVA 4NYRA 5IO7A 1DV9A 1LIBA 5HA1A 2MO5A 4ORUA 5HZ9A 5HAEA 1GGLA 3K3LA 3UEUA 1HMTA 4Y0PA 4NYQA 1KT5A 1TOUA 4LZUA 5L8NA 1IKJA 4BOEA 1E06A 1HMSA 3CMPA 4AYHA 4HPCA 3FIQA 1EQDA 1LNMA 4GNWA 1KT3A 1YWCA 3SAOA 5HCCC 5EZ2A 4ZCBA 3FW5A 4Y0SA 4ZHDA 3QKGA 1FEMA 2ANSA 3APWA 2ACPX 3MBTA 3T1DA 1EALA 1QG5A 2HLVA 2Q2MA 4Y0QA 1SA8A 1QFTA 2W2FA 4BVMA 4CK4A 1R0UA 2K23A 3VG4A 4TKBA 4YGZA 1OBUA 5KHPA 5K06A 4XMHA 2OVAA 1DFVA 3WXQA 2NNDA 4K19A 3VG7A 1AVGI 1JBHA 2BLGA 5LJCA 4QGVA 3P6GA 1BEBA 3FEPA 3F9DA 1EIIA 4XMGA 4A8ZA 2RCQA 1N0SA 1BSOA 3STMX 2RCTA 4IB9A 1HQPA 4NNSA 2A0AA 5DPQA 2L5PA 3NADA 2AT6X 1IFCA 4RUUA 3HWFA 5EDBA 3C78X 3S26A 1QWDA 4GKCA 5HZQA 3CR6A 1GM6A 4UU3A 2ASNX 2NNEA 1CBIA 1E00A 5JR8A 1GXAA 1L6MA 1XCAA 4GETA 1JV4A 4TKHA 2WQAE 4ZR2A 4QYPA 4AZNA 5BVSA 4HPAA 3ZQ3A 4YDBA 2XKLA 3NP1A 3KQ0A 4O9SA 3P6FA 1KZWA 1TVQA 3FA6A 1LIFA 2FS7A 5BVTA 3P6DA 3VG5A 5LKFA 1EW3A 1UREA 4I9RA 5H8TA 4QYNA 1QY1A 5C0NA 1GT3A 1I06A 1SXXA 1T8VA 1A57A 4TLJA 3UEVA 2CM9A 3NQ3A 3CQNA 1KOIA 5H9KA 1A3YA 1KT4A 4WBKA 3Q6LA 1CJ5A 1LFOA 1CBQA 1EPAA 1HN2A 2CBSA 5F7GA 1IFBA 1ZNHA 2QOSC 2L9CA 1OEKA 3B2HA 2WR6A 5F6ZA 3G7XA 5B29A 4ORRA 2GTFX 4XMCA 3KZAA 3FR4A 4ZHCA 1SY3A 2X45A 2AL0X 4ZH9A 3BRNA 2ALLX 4Y0RA 3U0DA 1ZNEA 5F58A 2OVDA 2FS6A 3FMZA 3WJEA 3I17A 3ELXA 5EDCA 1O1UA 2W2AA 3ZUIA 2LBVA 2MM3A 1ALBA 1KQXA 1O1VA 4XMDA 3VG2A 2GJ5A 3PPTA 4YBUA 1HBPA 4OMWA 5L8IA 4NP1A 1JJJA 4I9SA 5KIDA 1G74A 3ZUOA 1FTPA 5AQ6A 1OEJA 1PMPA 2F73A 2FLJA 2HZQA 3D96A 2CM4A 4ORXA 2QM9A 3DSZA 4AW8A 1EXSA 4ODDA 2AT3X 4ARHA 2JN3A 4QZTA 1E02A 4IAWA 1JJXA 4YFPA 4RUNA 3EBKA 5D47A 3WBGA 3BDRA 4M7MA 3PH6A 2AT0X 4DQ4A 5LJHA 1A18A 1GKAB 1UZ2X 4AZOA 4NLJA 2LKKA 1LIDA 1DZJA 1MX7A 1LICA 1LKEA 1X8UA 2JU8A 4IB8A 5B27A 1KZXA 2XSTA 4XMFA 3P6EA 2OFMX 1HBQA 1LPJA 1OEEA 2Q39A 2Q4NA 3HK1A 1T0VA 2KTDA 1ZRYA 2X46A 3NPOA 4AZMA 1X8QA 1B56A 3KFHA 1U18A 3APUA 2JOZA 2JU7A 1JYDA 1SXYA 2G78A 1TW4A 4YCEA 4ZHFA 3GAQA 3PEDA 5HCDC 4QGWA 2AH7X 1FDQA 1NGLA 2K62A 4EEJA 1BRPA 1AELA 3HWGA 5CE4A 1LF7A 1I4UA 2LFOA 1OPAA 1CRBA 1KXOA 3O22A 2GC9A 1QY0A 3VG6A 1ICMA 1O8VA 1LIEA 5H9NA 1OBQA 1X71A 4EDEA 1BM5A 4EXZA 1ZNDA 3DTQA 5HZ8A 2WEXA 5FAZA 3FLLA 4OMXA 3FW4A 1I05A 1I04A 3NX2A 3BU9A 3O19A 5F6BA 1X89A 1U17A 3EBWA 2OZQA 3TF6A 3RZYA 2FT9A 3B2JA 4NNTA 2RQ0A 1EPBA 5DG4A 1G7NA 1GT1A 1SXWA 1MDCA 1SY1A 1YP6A 4ZGUA 4N7CA 5D8JA 1BWYA 3FEKA 4A1HA 1KGLA 2PY1A 4YCHA 1NP4A 4YBPA 3NR3A 3TGAA 1X8NA 1CBRA 3JS1A 1P6PA 1KT7A 3TZSA 4QAEA 5D48A 1GX8A 3B2LA 4LKPA 4OS8A 1BJ7A 3UEXA 4BQUA 4QZUA 1YWAA 2WUTA 3KFIA 1TXLA 3FR2A 1JYJA 3UEWA 1D3SA 1FE3A 4IAXA 4YGHA 1DF3A 1CBSA 5H9LA 4TQ2A 2R73A 1ZNKA 4HFOA 3RSWA 4ALOA 2E4JA 4YDAA 4TJZA 1IKEA 3FELA 1QQSA 3WJDA 1EUOA 1ML7A 1OBPA 2HZRA 3EYCA 4D6BA 5LKEA 3APXA 3WJCA 4M6SA 2Q9SA 3ELZA 3AKMA 1PBOA 3FR5A 1GT5A 3KFGA 1DZKA 4YMYA 1YWDA 3D95A 2CZTA 5D4AA 2RD7C 4IB7A 1BSQA 4D6AA 2HMBA 1FELA 5FENA 2QO4A 4ORYA 2LB6A 1T68X 1VYGA 3B2KA 3OJYC 2HYSA 2P8GA 1GT4A 2L68A 2RA6A 2G7BA 4ZHHA 1QFVA 4IB6A 5HCEC 5LJDA 3KFFA 2FWVA 2IFBA 1SY2A 5HA0A 1GKAA 1RBPA 1SY0A 1YWBA 3O2YA 1YP7A 4KIIA 4WFUA 5LJKA 1S44A 3EM0A 2W2BA 1VPRA 3AKNA 2OVEA 1ERXA 4WFVA 2R56A 4LKTA 4DQ3A 3BSZE 4I3BA 1S7DA 1XKIA 3EMMA 3APVA 4EFGA 4YFRA 2EU7X 2AT5X 4GRJA 5LJBA 3STKA 1AQBA 1TOWA 3C77X 4PSQA 3WJFA 1BBPA 3TGCA 1ACDA 1S2PA 1EIOA 3CQRA 5EEEA 4NLIA 1G85A 2AMMX 2KT4B 1Z24A 1E5PA 2DM5A 3L4RA 1U0XA 1PM1X 3P6HA 2POAA 4YKOA 1MX8A 3FA9A 3I0AA 3U9PC 2L67A 4OS3A 2NP1A 3FENA 3WJBA 1D2UA 1YIVA 3C76X 5D45A 3IA8A 2AKQA 4YGGA 1HMRA 3BY0A 1QY2A 1DZMA 1BSYA 4ALBA 5HBSA 4YKMA 2FRSA 5HZ5A 1DZPA 2WQ9A 3CWKA 2WEWA 2YG2A 4TNNA 5EEDA 5EPQA 3PECA 3IFBA 3FA7A 4GE1A 1SXUA 3FA8A 3WJGA 2A2UA 1AB0A 5HTEA 1QABE 3NQ9A 4MVIA 4MVLA 4ORSA 1X8PA 2FR3A 4HPBA 4A60A 1ERBA 4QGXA 2WWPA 1KQWA 4HPDA 5F1EA 5BVQA 4GNYA 4ES7A 2A13A 3U03A 1GX9A 3BS2A 4YFQA 5FFHA 2ACOA 3NX1A 4N7DA 2CZUA 4XMEA 2OFRX 2HNXA 4YH0A 1H91A 3BX8A 4I3DA 3BLGA 4IMNA 1JZUA 4ORWA 1IIUA 2Q2PA 2N93A 1VYFA 3CBCA 3STNA 1ZNLA 4MVKA 2A3FX 3D97A 5L8OA 3VG3A 4UU2A 4AZRA 3P6CA 4IMOA 2O62A 4ZH6A 1DC9A 3PP6A 3CBSA 3BX7A 1ADLA 1G5WA 2WSJA 1YUPA 1B0OA 4TKJA 2LBAA 1OPBA 3WVMA 4AZPA 3F8AA 1MVGA 4OS0A 4GH7A 3JSQA 2G79A 1BLRA 5HTDA 1B4MA 1IW2A 1MUPA 1PEEA 5HWZA 1RLBE 2R74A 4ZHGA 4AZQA 5LJEA 2CBRA 3PH5A 1A2DA 1X8OA 2FR2A 2FTBA 1FENA 1ZNGA 2JU3A 5HZ6A 1BRQA 4ZFXA 1NP1A 3B2IA 4ZJ0A 2AT8X 4IBAA 2MJIA 3TGBA 3MVFA 1ICNA 2A2GA
chains in the Genus database with same CATH superfamily
4R0BA 3HWDA 4CPIA 5LJGA 1MOYA 1SLFB 3BU1A 1MM9A 1B8EA 5H9AA 4CPHA 5IO5A 1SWBA 3KVNA 4QNIA 1KT6A 1SRIA 4FBRA 2JMBA 2QO5A 2NNQA 1NC9A 3S5VA 4A1YA 5IO6A 5KICA 4I3CA 3HPEA 1EI5A 3RDOA 5IXGA 3HWEA 2QO6A 4LZVA 4NYRA 5IO7A 1DV9A 4U8UO 1LIBA 1SWAA 4JNJA 5HA1A 2MO5A 3H3IA 4ORUA 5HZ9A 2OYBO 1LCWA 3EC5A 4CDEA 5HAEA 1GGLA 3K3LA 4ZHHA 1WUBA 2X8FA 3UEUA 1HMTA 1SRJA 4Y0PA 2DJGA 2OF8A 3HOEA 4NYQA 4O4XA 3VHMA 1KT5A 3PQUA 1TOUA 4LZUA 5L8NA 2JGSA 1IKJA 4BOEA 1E06A 1HMSA 3CMPA 4AYHA 3CKGA 4HPCA 3FIQA 1EQDA 1LNMA 3NQKA 1KT3A 4GNWA 4O4SA 1YWCA 3SAOA 5HCCC 4GGTA 1JQPA 2OL7A 5EZ2A 3T2XA 4ZCBA 3FW5A 4Y0SA 1VWIB 4ZHDA 4DCBA 2BC3A 2C4IA 1RAVA 1I9HA 1FEMA 1K3BA 2ANSA 2ACPX 3AEHA 1KL4A 3APWA 3MBTA 3QKGA 3SOTA 3T1DA 4CV7A 1EALA 1QG5A 2HLVA 2Q2MA 4Y0QA 2AVIA 2X32A 4MEEA 4BX7A 1SA8A 1QFTA 2OY7A 2W2FA 4BVMA 4CK4A 1R0UA 2VDFA 2GTLM 2K23A 3VG4A 4TKBA 4YGZA 1OBUA 3FYFA 5KHPA 5K06A 4XMHA 2OVAA 3PQSA 1DFVA 3WXQA 2NNDA 1VWAB 5B2AO 4GGZA 1SWEA 4K19A 3VG7A 1AVGI 1FJ1E 1JBHA 2BLGA 2RTNB 2X8TA 4QGVA 3P6GA 5LJCA 4BX7B 1BEBA 3RY1A 1SLGB 4Z2VA 3FEPA 2MHDA 3F9DA 3T6LA 4BX6B 4CSBA 1EIIA 1RXHA 4XMGA 4A8ZA 2RCQA 1N0SA 1BSOA 1VWEB 3STMX 2RCTA 4IB9A 1HQPA 4NNSA 5LJBA 2A0AA 5DPQA 1VWPB 4DNEA 4ML7B 5L3YA 2L5PA 3NADA 5B11O 5IRUA 2AT6X 3SLOA 4GUZA 1IFCA 3WZPA 4RUUA 3HWFA 3MG5A 2RTOB 2MWHA 2OFBA 3C78X 5EDBA 3S26A 3ZW2A 3ZW1B 1QWDA 1VWRB 4GKCA 2ZSCA 3CR6A 1GM6A 1SWFA 3HOLA 2ASNX 2GTLO 4UU3A 2BSZA 2NNEA 1CBIA 1E00A 2BT9A 2IZFB 5JR8A 1GXAA 1SRGA 1XCAA 1L6MA 3ZI8A 4GETA 1JV4A 4TKHA 1PBYA 2WQAE 4ZR2A 3OE3A 4O3XB 4QYPA 4AZNA 1SWKA 5BVSA 4HPAA 2A5CA 3ZQ3A 2RTEB 4YDBA 2XKLA 2ZAGA 3NP1A 5FQ8E 3KQ0A 2ZAIA 2F09A 4O9SA 3P6FA 1KZWA 1TVQA 3FA6A 3WZNA 1SWHA 1LIFA 2FS7A 2FHNX 3OBLA 5BVTA 3P6DA 1MEPA 1Y0GA 1SWQA 4GJSA 2RTBB 1VWLB 3VG5A 5LKFA 1EW3A 2QMIA 2Z4IA 1UREA 3AUMO 4I9RA 5H8TA 4QYNA 1QY1A 5CSEA 5C0NA 2HKDA 1GT3A 2RTPB 1SRFA 1I06A 4O49A 1SXXA 1T8VA 3RDXA 1A57A 4TLJA 3UEVA 2CM9A 3NQ3A 4KC7A 4EQAC 3CQNA 1KOIA 2QCBA 5H9KA 1A3YA 3WYPA 1VWQB 1KT4A 4WBKA 3Q6LA 1CJ5A 1LFOA 2IZKA 1CBQA 1EPAA 1HN2A 2CBSA 2OL6O 2PI3O 3VHHA 5F7GA 1IFBA 1Y53X 1ZNHA 2QOSC 1RSTB 2DJFA 2L9CA 3EW2A 1OEKA 1E2TA 1SLDB 1Y52X 3B2HA 2WR6A 4JGLA 5F6ZA 4Z27A 3G7XA 4IRWA 3RWXA 2UZ2A 5B29A 2RTAA 4ORRA 2GTFX 4XMCA 3KZAA 3FR4A 4WHIA 4O3WA 4ZHCA 2A5BA 3NBXX 1SY3A 2X45A 5F2BA 2AL0X 2KD2A 4ZH9A 3BRNA 2C1SA 2ALLX 1SWGA 4INNA 4Y0RA 3U0DA 1ZNEA 5F58A 2OVDA 1WBIA 3CKFA 2FS6A 3FMZA 1N9YA 3T2WA 2G5LA 2Y3EA 3WJEA 4QRLA 2RTCB 1N9MA 3I17A 3ELXA 5EDCA 1OSPO 1O1UA 4GGRA 3ZZVA 2W2AA 3ZUIA 2LBVA 4NW4A 1KL5A 1ALBA 2MM3A 1KQXA 1O1VA 4XMDA 3VG2A 5AEOA 5B10O 2GJ5A 3PPTA 4YBUA 5K67A 1HBPA 1MK5A 4OMWA 2AF5A 5L8IA 2FKJA 4NP1A 1JJJA 2X8SA 4I9SA 4GDAA 1G74A 3ZUOA 3RBYA 5KIDA 1FTPA 5AQ6A 5IRAA 1OEJA 1PMPA 2F73A 2FLJA 2HZQA 3D96A 2CM4A 1PTSA 4NV7A 4ORXA 2QM9A 2RTFB 3DSZA 3P02A 4AW8A 1EXSA 4ODDA 4CDDA 5AJCA 2AT3X 1LDOA 4ARHA 2JN3A 2OVSA 4QZTA 1E02A 4IAWA 5B3MO 2IZHB 4YFPA 2RTRB 2IZEB 4RUNA 2IZAA 3EBKA 4Y59A 1HY2A 5D47A 4CPEA 3WBGA 4O3ZA 3BDRA 4M7MA 2KTSA 3PH6A 1JMZA 3D9WA 2AT0X 3JQOA 4DQ4A 2OF9A 4KCAA 5LJHA 1A18A 1GKAB 1UZ2X 2X55A 3ZWEA 4AZOA 4BX6A 4NLJA 4FBVA 2LKKA 4KC8A 4HWMA 1LIDA 3V8UA 1DZJA 1MX7A 1VWJB 1LICA 1LKEA 1X8UA 2JU8A 2X56A 4IB8A 4ORYA 4U9CA 2XSTA 5B27A 3RY2A 1KZXA 4O4UA 4XMFA 3ZW0B 1VWOB 4U8UN 3P6EA 2OFMX 1HBQA 4COTA 4B55A 4EKVA 1LPJA 1OEEA 2Q39A 2Q4NA 3FDCA 3HK1A 3D4RA 1T0VA 2KTDA 1ZRYA 3ZW1A 2X46A 1I78A 3NPOA 1NQMA 4AZMA 1JIWI 1X8QA 4IABA 1B56A 2JW1A 3RDSA 5B5FA 3KFHA 1U18A 1HXLA 1RXJA 2OY8A 2JOZA 3APUA 4BCSA 2IZIA 4NV8A 4Z2PA 2JU7A 1JYDA 3P24A 4QQ1A 1SXYA 2FHLA 2FGSA 2G78A 1TW4A 4YCEA 4ZHFA 3GAQA 3PEDA 5HCDC 4QGWA 2AH7X 1FDQA 4PJ2A 1NGLA 3N91A 2K62A 2CAMA 4EEJA 1BRPA 1AELA 3HWGA 3RE5A 5CE4A 4FGIB 4JHQA 3RE6A 1RSUB 1LF7A 4BBOA 1I4UA 2LFOA 4BX5B 1K24A 1OPAA 2VFBA 4CPFA 1CRBA 1KXOA 3O22A 2GC9A 1QY0A 2Y3FA 3VG6A 3FIDA 5B5GA 1ICMA 1O8VA 1LIEA 1Y55X 2G8CO 1KFFA 1IJ8A 1STRB 5H9NA 1OBQA 1X71A 4EDEA 1BM5A 4EXZA 1ZNDA 3DTQA 5HZ8A 2WEXA 5FAZA 3FLLA 4OMXA 3FW4A 1I05A 1I04A 4L1NA 4CDFA 3NX2A 3BU9A 3O19A 4U46A 1X89A 1U17A 3EBWA 2OZQA 4GD9A 5F6BA 2RTJA 3TF6A 3VE1A 4Z2OA 3RZYA 1GX3A 2FT9A 3B2JA 4NNTA 2RQ0A 1EPBA 5DG4A 3SZIA 1G7NA 1GT1A 1SXWA 1MDCA 1SY1A 1YP6A 3MX7A 4MIRA 3SZJA 4ZGUA 4N7CA 5D8JA 1BWYA 3S5XA 3FEKA 4A1HA 1KGLA 2PY1A 4YCHA 3VGWA 1NP4A 4YBPA 3NR3A 3TGAA 1SWOA 2IZBA 1X8NA 1CBRA 1SRHA 3JS1A 1P6PA 1KT7A 3TZSA 4QAEA 3Q34A 5D48A 3X00A 1GX8A 3B2LA 4LKPA 4OS8A 1BJ7A 3UEXA 4BQUA 4MVEA 4QZUA 1YWAA 2WUTA 3KFIA 1TXLA 2RN4A 3FR2A 2BS6A 1JYJA 3UEWA 4FBOA 2RTGB 1D3SA 1FE3A 1N7YA 1VYOA 1VWCB 4FQBB 4IAXA 4YGHA 1DF3A 1STPA 1CBSA 1VWHB 2OL8O 5H9LA 4TQ2A 2R73A 1ZNKA 2IZDB 4HFOA 1AVEA 3RSWA 3VU1A 4ALOA 2E4JA 4YDAA 4TJZA 1IKEA 3FELA 1QQSA 3WJDA 4JO6A 1EUOA 1ML7A 1OBPA 2HZRA 1SREA 3EYCA 4D6BA 5LKEA 3APXA 3WJCA 3WZQA 1N43A 1SWPA 4ID2A 1W4TA 2UYWA 4M6SA 2Q9SA 1VWMB 3VE2A 3ELZA 5AJBA 3AKMA 1PBOA 3FR5A 1GT5A 3KFGA 3T6FA 1DZKA 3WOVA 4YMYA 1JJXA 1YWDA 3D95A 4Y5DA 2CZTA 5D4AA 2RD7C 2IZJA 4IB7A 4KT5A 1BSQA 4BJ8A 2HMBA 4D6AA 1UYOX 1SLEB 1FELA 5FENA 1HQQA 2QO4A 2LB6A 1T68X 4GK9A 2X4MA 4OELA 1VYGA 3B2KA 3OJYC 2HYSA 2FKGA 1GT4A 2L68A 2P8GA 2G7BA 2RA6A 2YMSA 1QFVA 4IB6A 3WZOA 5HCEC 5LJDA 3KFFA 2FWVA 1SWJA 2IFBA 1SY2A 2OFAA 5HA0A 1GKAA 1RBPA 1SY0A 1YWBA 3O2YA 1YP7A 4I6SA 4KIIA 4WFUA 5JD2A 5LJKA 3VPJE 4GU8A 1S44A 2IZCB 4OKAA 1NDJA 3EM0A 4BGFA 3GE2A 4CPHB 2W2BA 1VPRA 3AKNA 2OVEA 1ERXA 4WFVA 3ZW0A 2R56A 3MM0A 4LKTA 3WYQA 3BSZE 4DQ3A 2I5ZO 4I3BA 1S7DA 1XKIA 3EMMA 3LV4A 3APVA 4OEMA 4U3QA 4EFGA 4YFRA 2EU7X 2AT5X 3QQ2A 4GRJA 3STKA 1AQBA 1TOWA 2KW1A 1SWUA 3C77X 5FQ6E 4Z6JA 4PSQA 3WJFA 1BBPA 5BYPA 3TGCA 1ACDA 1S2PA 1EIOA 3CQRA 5EEEA 1LELA 4GJVA 1JMXA 1G85A 4NLIA 2AMMX 2KT4B 1Z24A 5IRWA 1E5PA 2DM5A 3L4RA 2Z4HA 1SWRA 1U0XA 4C5PA 1JJUA 1PM1X 3P6HA 4I95A 2POAA 3F6ZB 1SWLA 1Y9TA 4YKOA 1MX8A 3FA9A 3I0AA 2LA7A 1RXKA 3U9PC 2L67A 4OS3A 2NP1A 3FENA 3WJBA 1NBXA 2C1QA 1LDQA 1D2UA 1LUQA 1HXZA 3HTYA 1YIVA 3C76X 5D45A 1NQNA 2AKQA 3IA8A 4YGGA 1HMRA 3BY0A 4CDCA 2RTLA 1QY2A 1DZMA 1BSYA 4ALBA 5HBSA 4YKMA 2FRSA 2MF6A 2RTKA 2RTIB 5HZ5A 2RTQB 1DZPA 4ZGFA 4BX5A 2WQ9A 3CWKA 2WEWA 2YG2A 4TNNA 1KL3A 5EEDA 5EPQA 3PECA 3IFBA 3SLTA 3FA7A 4L3RA 4GE1A 1SXUA 3FA8A 1SWCA 3WJGA 2A2UA 3E3CA 3RKGA 1AB0A 5HTEA 1QABE 3NQ9A 4MVIA 4MVLA 4ORSA 2X34A 1X8PA 4O4OA 2FR3A 4HPBA 2IZGB 1ERBA 4QGXA 4A60A 2WWPA 1KQWA 4HPDA 2F01A 3RDMA 5F1EA 2M4LA 5BVQA 4GNYA 4ES7A 2RTHB 2A13A 3OD9A 3U03A 1GX9A 2RTMA 3BS2A 4YFQA 1VWDB 5FFHA 2ACOA 3RDQA 3NX1A 4N7DA 4YVBA 2CZUA 4XMEA 2OFRX 1N4JA 2HNXA 4I60A 1H91A 1SMPI 3BX8A 4I3DA 3BLGA 4YH0A 5CYBA 4IMNA 1DF8A 3LTWA 3UAQA 1JZUA 1SWDA 1IIUA 2Q2PA 4ORWA 2N93A 1VYFA 2VFCA 3CBCA 3STNA 1ZNLA 4MVKA 2A3FX 3D97A 5L8OA 4ON1A 5HZQA 3VG3A 4UU2A 1W6FA 4AZRA 3P6CA 1Y9LA 2BS5A 2O62A 4IMOA 2GH7A 4ZH6A 1DC9A 1VWFB 3PP6A 2GTLN 3CBSA 4Z28A 5K68A 3BX7A 1ADLA 1G5WA 2WSJA 4O3YA 1W5RA 1YUPA 2Y32A 1SWTA 2QOMA 1B0OA 4TKJA 5FQ7E 2LBAA 1OPBA 3WVMA 2BHVA 3PDFA 4AZPA 3F8AA 3SZHA 1MVGA 4OS0A 4GH7A 3S60A 3JSQA 2G79A 1BLRA 5HTDA 1B4MA 1SWNA 3RDUA 3LHNA 4LQZA 1IW2A 1MUPA 1STSB 2I5VO 4GZVA 1PEEA 2A8GA 5HWZA 1RLBE 1UYNX 1VWGB 2R74A 4ZHGA 4AZQA 5LJEA 1VWNB 2OY5O 2WPUA 2CBRA 3PH5A 1LCZA 3SLJA 3VHIA 1A2DA 1VWKB 1X8OA 2IZLB 4U8UM 2FR2A 4MISA 2FTBA 1FENA 1ZNGA 2JU3A 3PK2A 5HZ6A 1BRQA 1LCVA 4ZFXA 1NP1A 3B2IA 4ZJ0A 4KH8A 2AT8X 1AVDA 2RTDB 4GDZA 4IBAA 2MJIA 1VWBB 2OY1O 3EW1A 3MVFA 5CHKA 1ICNA 3TGBA 2A2GA 1SWSA
chains in the Genus database with same CATH topology
4R0BA 3HWDA 5LJGA 3BU1A 5H9AA 1B8EA 5IO5A 4QNIA 1KT6A 4FBRA 2JMBA 2QO5A 2NNQA 3S5VA 5IO6A 4A1YA 5KICA 4I3CA 1EI5A 3HWEA 2QO6A 4LZVA 4NYRA 5IO7A 1DV9A 4U8UO 1LIBA 5HA1A 2MO5A 3H3IA 4ORUA 5HZ9A 5HAEA 1GGLA 3K3LA 2X8FA 3UEUA 1HMTA 4Y0PA 4O4XA 3HOEA 4NYQA 1KT5A 3PQUA 1TOUA 4LZUA 5L8NA 1IKJA 4BOEA 1E06A 1HMSA 3CMPA 4AYHA 4HPCA 3FIQA 1EQDA 1LNMA 3NQKA 1KT3A 4GNWA 4O4SA 1YWCA 3SAOA 5HCCC 5EZ2A 4ZCBA 3FW5A 4Y0SA 4ZHDA 3QKGA 1FEMA 2ANSA 3APWA 2ACPX 3MBTA 3SOTA 4CV7A 3T1DA 1EALA 1QG5A 2HLVA 2Q2MA 4Y0QA 1SA8A 1QFTA 2W2FA 4BVMA 4CK4A 1R0UA 2GTLM 2K23A 3VG4A 4TKBA 4YGZA 1OBUA 3FYFA 5KHPA 5K06A 4XMHA 2OVAA 3PQSA 1DFVA 3WXQA 2NNDA 4K19A 3VG7A 1AVGI 1JBHA 2BLGA 2X8TA 4QGVA 5LJCA 3P6GA 1BEBA 3FEPA 2MHDA 3F9DA 4CSBA 1EIIA 4XMGA 4A8ZA 2RCQA 1N0SA 1BSOA 3STMX 2RCTA 4IB9A 1HQPA 4NNSA 2A0AA 5DPQA 4ML7B 2L5PA 3NADA 2AT6X 1IFCA 4RUUA 3HWFA 3ZW2A 2MWHA 5EDBA 3C78X 3ZW1B 3S26A 1QWDA 4GKCA 5HZQA 3CR6A 1GM6A 3HOLA 4UU3A 2ASNX 2GTLO 2NNEA 1CBIA 1E00A 2BT9A 5JR8A 1GXAA 1L6MA 1XCAA 3ZI8A 4GETA 1JV4A 4TKHA 2WQAE 4ZR2A 3OE3A 4O3XB 4QYPA 4AZNA 5BVSA 4HPAA 3ZQ3A 4YDBA 2XKLA 2ZAGA 3NP1A 5FQ8E 3KQ0A 2ZAIA 2F09A 4O9SA 3P6FA 1KZWA 1TVQA 3FA6A 1LIFA 2FS7A 3OBLA 5BVTA 3P6DA 3VG5A 5LKFA 1EW3A 2QMIA 2Z4IA 1UREA 4I9RA 5H8TA 4QYNA 1QY1A 5C0NA 1GT3A 1I06A 4O49A 1SXXA 1T8VA 1A57A 4TLJA 3UEVA 2CM9A 3NQ3A 4KC7A 4EQAC 3CQNA 1KOIA 5H9KA 1A3YA 1KT4A 4WBKA 3Q6LA 1CJ5A 1LFOA 1CBQA 1EPAA 1HN2A 2CBSA 5F7GA 1IFBA 1ZNHA 2QOSC 2L9CA 1OEKA 3B2HA 4JGLA 2WR6A 5F6ZA 3G7XA 3RWXA 5B29A 4ORRA 2GTFX 4XMCA 3KZAA 3FR4A 4WHIA 4O3WA 4ZHCA 3NBXX 1SY3A 2X45A 2AL0X 2KD2A 4ZH9A 3BRNA 2ALLX 4INNA 4Y0RA 3U0DA 1ZNEA 5F58A 2OVDA 2FS6A 3FMZA 3WJEA 4QRLA 3I17A 3ELXA 5EDCA 3ZZVA 1O1UA 2W2AA 3ZUIA 2LBVA 4NW4A 2MM3A 1ALBA 1KQXA 1O1VA 4XMDA 3VG2A 5AEOA 2GJ5A 3PPTA 4YBUA 1HBPA 4OMWA 5L8IA 4NP1A 1JJJA 2X8SA 4I9SA 5KIDA 1G74A 3ZUOA 3RBYA 1FTPA 5AQ6A 1OEJA 1PMPA 2F73A 2FLJA 2HZQA 3D96A 2CM4A 4ORXA 2QM9A 3DSZA 3P02A 4AW8A 1EXSA 4ODDA 5AJCA 2AT3X 4ARHA 2JN3A 2OVSA 4QZTA 1E02A 4IAWA 1JJXA 4YFPA 4RUNA 3EBKA 5D47A 3WBGA 4O3ZA 3BDRA 4M7MA 2KTSA 3PH6A 2AT0X 3JQOA 4DQ4A 4KCAA 5LJHA 1A18A 1GKAB 1UZ2X 3ZWEA 4AZOA 4NLJA 4FBVA 2LKKA 4KC8A 4HWMA 1LIDA 3V8UA 1DZJA 1MX7A 1LICA 1LKEA 1X8UA 2JU8A 4IB8A 5B27A 1KZXA 4U9CA 2XSTA 4O4UA 4XMFA 3ZW0B 4U8UN 3P6EA 2OFMX 1HBQA 4COTA 1LPJA 1OEEA 2Q39A 2Q4NA 3HK1A 3D4RA 1T0VA 2KTDA 1ZRYA 3ZW1A 2X46A 3NPOA 4AZMA 1JIWI 1X8QA 4IABA 1B56A 2JW1A 3KFHA 1U18A 3APUA 2JOZA 2JU7A 1JYDA 3P24A 4QQ1A 1SXYA 2G78A 1TW4A 4YCEA 4ZHFA 3GAQA 3PEDA 5HCDC 4QGWA 2AH7X 1FDQA 4PJ2A 1NGLA 3N91A 2K62A 4EEJA 1BRPA 1AELA 3HWGA 5CE4A 4FGIB 1LF7A 1I4UA 2LFOA 1OPAA 1CRBA 1KXOA 3O22A 2GC9A 1QY0A 3VG6A 1ICMA 1O8VA 1LIEA 5H9NA 1OBQA 1X71A 4EDEA 1BM5A 4EXZA 1ZNDA 3DTQA 5HZ8A 2WEXA 5FAZA 3FLLA 4OMXA 3FW4A 1I05A 1I04A 4L1NA 3NX2A 3BU9A 3O19A 5F6BA 1X89A 1U17A 3EBWA 2OZQA 3TF6A 3VE1A 3RZYA 2FT9A 3B2JA 4NNTA 2RQ0A 1EPBA 5DG4A 1G7NA 1GT1A 1SXWA 1MDCA 1SY1A 1YP6A 3MX7A 4MIRA 4ZGUA 4N7CA 5D8JA 1BWYA 3S5XA 3FEKA 4A1HA 1KGLA 2PY1A 4YCHA 1NP4A 4YBPA 3NR3A 3TGAA 1X8NA 1CBRA 3JS1A 1P6PA 1KT7A 3TZSA 4QAEA 5D48A 1GX8A 3B2LA 4LKPA 4OS8A 1BJ7A 3UEXA 4BQUA 4MVEA 4QZUA 1YWAA 2WUTA 3KFIA 1TXLA 2RN4A 3FR2A 2BS6A 1JYJA 3UEWA 4FBOA 1D3SA 1FE3A 4FQBB 4IAXA 4YGHA 1DF3A 1CBSA 5H9LA 4TQ2A 2R73A 1ZNKA 4HFOA 3RSWA 4ALOA 3VU1A 2E4JA 4YDAA 4TJZA 1IKEA 3FELA 1QQSA 3WJDA 1EUOA 1ML7A 1OBPA 2HZRA 3EYCA 4D6BA 5LKEA 3APXA 3WJCA 4ID2A 4M6SA 2Q9SA 3VE2A 3ELZA 5AJBA 3AKMA 1PBOA 3FR5A 1GT5A 3KFGA 1DZKA 3WOVA 4YMYA 1YWDA 3D95A 2CZTA 5D4AA 2RD7C 4IB7A 4KT5A 1BSQA 4D6AA 2HMBA 1FELA 5FENA 2QO4A 4ORYA 2LB6A 1T68X 4GK9A 1VYGA 3B2KA 3OJYC 2HYSA 2P8GA 1GT4A 2L68A 2RA6A 2G7BA 2YMSA 4ZHHA 1QFVA 4IB6A 5HCEC 5LJDA 3KFFA 2FWVA 2IFBA 1SY2A 5HA0A 1GKAA 1RBPA 1SY0A 1YWBA 3O2YA 1YP7A 4I6SA 4KIIA 4WFUA 5LJKA 3VPJE 4GU8A 1S44A 3EM0A 3GE2A 2W2BA 1VPRA 3AKNA 2OVEA 1ERXA 4WFVA 3ZW0A 2R56A 4LKTA 4DQ3A 3BSZE 4I3BA 1S7DA 1XKIA 3EMMA 3LV4A 3APVA 4U3QA 4EFGA 4YFRA 2EU7X 2AT5X 4GRJA 5LJBA 3STKA 1AQBA 1TOWA 2KW1A 3C77X 5FQ6E 4PSQA 3WJFA 1BBPA 5BYPA 3TGCA 1ACDA 1S2PA 1EIOA 3CQRA 5EEEA 4NLIA 1G85A 2AMMX 2KT4B 1Z24A 1E5PA 2DM5A 3L4RA 2Z4HA 1U0XA 1PM1X 3P6HA 4I95A 2POAA 3F6ZB 1Y9TA 4YKOA 1MX8A 3FA9A 3I0AA 2LA7A 3U9PC 2L67A 4OS3A 2NP1A 3FENA 3WJBA 1D2UA 3HTYA 1YIVA 3C76X 5D45A 3IA8A 2AKQA 4YGGA 1HMRA 3BY0A 1QY2A 1DZMA 1BSYA 4ALBA 5HBSA 4YKMA 2FRSA 5HZ5A 1DZPA 4ZGFA 2WQ9A 3CWKA 2WEWA 2YG2A 4TNNA 5EEDA 5EPQA 3PECA 3IFBA 3FA7A 4L3RA 4GE1A 1SXUA 3FA8A 3WJGA 2A2UA 3E3CA 3RKGA 1AB0A 5HTEA 1QABE 3NQ9A 4MVIA 4MVLA 4ORSA 1X8PA 4O4OA 2FR3A 4HPBA 4A60A 1ERBA 4QGXA 2WWPA 1KQWA 4HPDA 5F1EA 2M4LA 5BVQA 4GNYA 4ES7A 2A13A 3OD9A 3U03A 1GX9A 3BS2A 4YFQA 5FFHA 2ACOA 3NX1A 4N7DA 2CZUA 4XMEA 2OFRX 2HNXA 4YH0A 1H91A 1SMPI 3BX8A 4I3DA 3BLGA 5CYBA 4IMNA 3UAQA 1JZUA 4ORWA 1IIUA 2Q2PA 2N93A 1VYFA 3CBCA 3STNA 1ZNLA 4MVKA 2A3FX 3D97A 5L8OA 4ON1A 3VG3A 4UU2A 4AZRA 3P6CA 1Y9LA 2BS5A 2O62A 4IMOA 4ZH6A 1DC9A 3PP6A 2GTLN 3CBSA 3BX7A 1ADLA 1G5WA 2WSJA 4O3YA 1YUPA 1B0OA 4TKJA 5FQ7E 2LBAA 1OPBA 3WVMA 2BHVA 4AZPA 3F8AA 1MVGA 4OS0A 4GH7A 3S60A 3JSQA 2G79A 1BLRA 5HTDA 1B4MA 3LHNA 4LQZA 1IW2A 1MUPA 4GZVA 1PEEA 5HWZA 1RLBE 2R74A 4ZHGA 4AZQA 5LJEA 2CBRA 3PH5A 1A2DA 4U8UM 1X8OA 2FR2A 4MISA 2FTBA 1FENA 1ZNGA 2JU3A 5HZ6A 1BRQA 4ZFXA 1NP1A 3B2IA 4ZJ0A 4KH8A 2AT8X 4GDZA 4IBAA 2MJIA 3TGBA 3MVFA 1ICNA 2A2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0B A;  3HWD A;  5LJG A;  3BU1 A;  5H9A A;  1B8E A;  5IO5 A;  1KT6 A;  2QO5 A;  5IO6 A;  2NNQ A;  5KIC A;  4A1Y A;  4I3C A;  3HWE A;  2QO6 A;  4LZV A;  4NYR A;  5IO7 A;  1DV9 A;  1LIB A;  5HA1 A;  2MO5 A;  4ORU A;  5HZ9 A;  5HAE A;  1GGL A;  3K3L A;  3UEU A;  1HMT A;  4Y0P A;  4NYQ A;  1KT5 A;  1TOU A;  4LZU A;  5L8N A;  1IKJ A;  4BOE A;  1E06 A;  1HMS A;  3CMP A;  4AYH A;  4HPC A;  3FIQ A;  1EQD A;  1LNM A;  4GNW A;  1KT3 A;  1YWC A;  3SAO A;  5HCC C;  5EZ2 A;  4ZCB A;  3FW5 A;  4Y0S A;  4ZHD A;  3QKG A;  1FEM A;  2ANS A;  3APW A;  2ACP X;  3MBT A;  3T1D A;  1EAL A;  1QG5 A;  2HLV A;  2Q2M A;  4Y0Q A;  1SA8 A;  1QFT A;  2W2F A;  4BVM A;  4CK4 A;  1R0U A;  2K23 A;  3VG4 A;  4TKB A;  4YGZ A;  1OBU A;  5KHP A;  5K06 A;  4XMH A;  2OVA A;  1DFV A;  3WXQ A;  2NND A;  4K19 A;  3VG7 A;  1AVG I;  1JBH A;  2BLG A;  5LJC A;  4QGV A;  3P6G A;  1BEB A;  3FEP A;  3F9D A;  1EII A;  4XMG A;  4A8Z A;  2RCQ A;  1N0S A;  1BSO A;  3STM X;  2RCT A;  4IB9 A;  1HQP A;  4NNS A;  2A0A A;  5DPQ A;  2L5P A;  3NAD A;  2AT6 X;  1IFC A;  4RUU A;  3HWF A;  5EDB A;  3C78 X;  3S26 A;  1QWD A;  4GKC A;  5HZQ A;  3CR6 A;  1GM6 A;  4UU3 A;  2ASN X;  2NNE A;  1CBI A;  1E00 A;  5JR8 A;  1GXA A;  1L6M A;  1XCA A;  4GET A;  1JV4 A;  4TKH A;  2WQA E;  4ZR2 A;  4QYP A;  4AZN A;  5BVS A;  4HPA A;  3ZQ3 A;  4YDB A;  2XKL A;  3NP1 A;  3KQ0 A;  4O9S A;  3P6F A;  1KZW A;  1TVQ A;  3FA6 A;  1LIF A;  2FS7 A;  5BVT A;  3P6D A;  3VG5 A;  5LKF A;  1EW3 A;  1URE A;  4I9R A;  5H8T A;  4QYN A;  1QY1 A;  5C0N A;  1GT3 A;  1I06 A;  1SXX A;  1T8V A;  1A57 A;  4TLJ A;  3UEV A;  2CM9 A;  3NQ3 A;  3CQN A;  1KOI A;  5H9K A;  1A3Y A;  1KT4 A;  4WBK A;  3Q6L A;  1CJ5 A;  1LFO A;  1CBQ A;  1EPA A;  1HN2 A;  2CBS A;  5F7G A;  1IFB A;  1ZNH A;  2QOS C;  2L9C A;  1OEK A;  3B2H A;  2WR6 A;  5F6Z A;  3G7X A;  5B29 A;  4ORR A;  2GTF X;  4XMC A;  3KZA A;  3FR4 A;  4ZHC A;  1SY3 A;  2X45 A;  2AL0 X;  4ZH9 A;  3BRN A;  2ALL X;  4Y0R A;  3U0D A;  1ZNE A;  5F58 A;  2OVD A;  2FS6 A;  3FMZ A;  3WJE A;  3I17 A;  3ELX A;  5EDC A;  1O1U A;  2W2A A;  3ZUI A;  2LBV A;  2MM3 A;  1ALB A;  1KQX A;  1O1V A;  4XMD A;  3VG2 A;  2GJ5 A;  3PPT A;  4YBU A;  1HBP A;  4OMW A;  5L8I A;  4NP1 A;  1JJJ A;  4I9S A;  5KID A;  1G74 A;  3ZUO A;  1FTP A;  5AQ6 A;  1OEJ A;  1PMP A;  2F73 A;  2FLJ A;  2HZQ A;  3D96 A;  2CM4 A;  4ORX A;  2QM9 A;  3DSZ A;  4AW8 A;  1EXS A;  4ODD A;  2AT3 X;  4ARH A;  2JN3 A;  4QZT A;  1E02 A;  4IAW A;  1JJX A;  4YFP A;  4RUN A;  3EBK A;  5D47 A;  3WBG A;  3BDR A;  4M7M A;  3PH6 A;  2AT0 X;  4DQ4 A;  5LJH A;  1A18 A;  1GKA B;  1UZ2 X;  4AZO A;  4NLJ A;  2LKK A;  1LID A;  1DZJ A;  1MX7 A;  1LIC A;  1LKE A;  1X8U A;  2JU8 A;  4IB8 A;  5B27 A;  1KZX A;  2XST A;  4XMF A;  3P6E A;  2OFM X;  1HBQ A;  1LPJ A;  1OEE A;  2Q39 A;  2Q4N A;  3HK1 A;  1T0V A;  2KTD A;  1ZRY A;  2X46 A;  3NPO A;  4AZM A;  1X8Q A;  1B56 A;  3KFH A;  1U18 A;  3APU A;  2JOZ A;  2JU7 A;  1JYD A;  1SXY A;  2G78 A;  1TW4 A;  4YCE A;  4ZHF A;  3GAQ A;  3PED A;  5HCD C;  4QGW A;  2AH7 X;  1FDQ A;  1NGL A;  2K62 A;  4EEJ A;  1BRP A;  1AEL A;  3HWG A;  5CE4 A;  1LF7 A;  1I4U A;  2LFO A;  1OPA A;  1CRB A;  1KXO A;  3O22 A;  2GC9 A;  1QY0 A;  3VG6 A;  1ICM A;  1O8V A;  1LIE A;  5H9N A;  1OBQ A;  1X71 A;  4EDE A;  1BM5 A;  4EXZ A;  1ZND A;  3DTQ A;  5HZ8 A;  2WEX A;  5FAZ A;  3FLL A;  4OMX A;  3FW4 A;  1I05 A;  1I04 A;  3NX2 A;  3BU9 A;  3O19 A;  5F6B A;  1X89 A;  1U17 A;  3EBW A;  2OZQ A;  3TF6 A;  3RZY A;  2FT9 A;  3B2J A;  4NNT A;  2RQ0 A;  1EPB A;  5DG4 A;  1G7N A;  1GT1 A;  1SXW A;  1MDC A;  1SY1 A;  1YP6 A;  4ZGU A;  4N7C A;  5D8J A;  1BWY A;  3FEK A;  4A1H A;  1KGL A;  2PY1 A;  4YCH A;  1NP4 A;  4YBP A;  3NR3 A;  3TGA A;  1X8N A;  1CBR A;  3JS1 A;  1P6P A;  1KT7 A;  3TZS A;  4QAE A;  5D48 A;  1GX8 A;  3B2L A;  4LKP A;  4OS8 A;  1BJ7 A;  3UEX A;  4BQU A;  4QZU A;  1YWA A;  2WUT A;  3KFI A;  1TXL A;  3FR2 A;  1JYJ A;  3UEW A;  1D3S A;  1FE3 A;  4IAX A;  4YGH A;  1DF3 A;  1CBS A;  5H9L A;  4TQ2 A;  2R73 A;  1ZNK A;  4HFO A;  3RSW A;  4ALO A;  2E4J A;  4YDA A;  4TJZ A;  1IKE A;  3FEL A;  1QQS A;  3WJD A;  1EUO A;  1ML7 A;  1OBP A;  2HZR A;  3EYC A;  4D6B A;  5LKE A;  3APX A;  3WJC A;  4M6S A;  2Q9S A;  3ELZ A;  3AKM A;  1PBO A;  3FR5 A;  1GT5 A;  3KFG A;  1DZK A;  4YMY A;  1YWD A;  3D95 A;  2CZT A;  5D4A A;  2RD7 C;  4IB7 A;  1BSQ A;  4D6A A;  2HMB A;  1FEL A;  5FEN A;  2QO4 A;  4ORY A;  2LB6 A;  1T68 X;  1VYG A;  3B2K A;  3OJY C;  2HYS A;  2P8G A;  1GT4 A;  2L68 A;  2RA6 A;  2G7B A;  4ZHH A;  1QFV A;  4IB6 A;  5HCE C;  5LJD A;  3KFF A;  2FWV A;  2IFB A;  1SY2 A;  5HA0 A;  1GKA A;  1RBP A;  1SY0 A;  1YWB A;  3O2Y A;  1YP7 A;  4KII A;  4WFU A;  5LJK A;  1S44 A;  3EM0 A;  2W2B A;  1VPR A;  3AKN A;  2OVE A;  1ERX A;  4WFV A;  2R56 A;  4LKT A;  4DQ3 A;  3BSZ E;  4I3B A;  1S7D A;  1XKI A;  3EMM A;  3APV A;  4EFG A;  4YFR A;  2EU7 X;  2AT5 X;  4GRJ A;  5LJB A;  3STK A;  1AQB A;  1TOW A;  3C77 X;  4PSQ A;  3WJF A;  1BBP A;  3TGC A;  1ACD A;  1S2P A;  1EIO A;  3CQR A;  5EEE A;  4NLI A;  1G85 A;  2AMM X;  2KT4 B;  1Z24 A;  1E5P A;  2DM5 A;  3L4R A;  1U0X A;  1PM1 X;  3P6H A;  2POA A;  4YKO A;  1MX8 A;  3FA9 A;  3I0A A;  3U9P C;  2L67 A;  4OS3 A;  2NP1 A;  3FEN A;  3WJB A;  1D2U A;  1YIV A;  3C76 X;  5D45 A;  3IA8 A;  2AKQ A;  4YGG A;  1HMR A;  3BY0 A;  1QY2 A;  1DZM A;  1BSY A;  4ALB A;  5HBS A;  4YKM A;  2FRS A;  5HZ5 A;  1DZP A;  2WQ9 A;  3CWK A;  2WEW A;  2YG2 A;  4TNN A;  5EED A;  5EPQ A;  3PEC A;  3IFB A;  3FA7 A;  4GE1 A;  1SXU A;  3FA8 A;  3WJG A;  2A2U A;  1AB0 A;  5HTE A;  1QAB E;  3NQ9 A;  4MVI A;  4MVL A;  4ORS A;  1X8P A;  2FR3 A;  4HPB A;  4A60 A;  1ERB A;  4QGX A;  2WWP A;  1KQW A;  4HPD A;  5F1E A;  5BVQ A;  4GNY A;  4ES7 A;  2A13 A;  3U03 A;  1GX9 A;  3BS2 A;  4YFQ A;  5FFH A;  2ACO A;  3NX1 A;  4N7D A;  2CZU A;  4XME A;  2OFR X;  2HNX A;  4YH0 A;  1H91 A;  3BX8 A;  4I3D A;  3BLG A;  4IMN A;  1JZU A;  4ORW A;  1IIU A;  2Q2P A;  2N93 A;  1VYF A;  3CBC A;  3STN A;  1ZNL A;  4MVK A;  2A3F X;  3D97 A;  5L8O A;  3VG3 A;  4UU2 A;  4AZR A;  3P6C A;  4IMO A;  2O62 A;  4ZH6 A;  1DC9 A;  3PP6 A;  3CBS A;  3BX7 A;  1ADL A;  1G5W A;  2WSJ A;  1YUP A;  1B0O A;  4TKJ A;  2LBA A;  1OPB A;  3WVM A;  4AZP A;  3F8A A;  1MVG A;  4OS0 A;  4GH7 A;  3JSQ A;  2G79 A;  1BLR A;  5HTD A;  1B4M A;  1IW2 A;  1MUP A;  1PEE A;  5HWZ A;  1RLB E;  2R74 A;  4ZHG A;  4AZQ A;  5LJE A;  2CBR A;  3PH5 A;  1A2D A;  1X8O A;  2FR2 A;  2FTB A;  1FEN A;  1ZNG A;  2JU3 A;  5HZ6 A;  1BRQ A;  4ZFX A;  1NP1 A;  3B2I A;  4ZJ0 A;  2AT8 X;  4IBA A;  2MJI A;  3TGB A;  3MVF A;  1ICN A;  2A2G A; 
#chains in the Genus database with same CATH topology
 4R0B A;  3HWD A;  4CPI A;  5LJG A;  1MOY A;  1SLF B;  3BU1 A;  1MM9 A;  1B8E A;  5H9A A;  4CPH A;  5IO5 A;  1SWB A;  3KVN A;  4QNI A;  1KT6 A;  1SRI A;  4FBR A;  2JMB A;  2QO5 A;  2NNQ A;  1NC9 A;  3S5V A;  4A1Y A;  5IO6 A;  5KIC A;  4I3C A;  3HPE A;  1EI5 A;  3RDO A;  5IXG A;  3HWE A;  2QO6 A;  4LZV A;  4NYR A;  5IO7 A;  1DV9 A;  4U8U O;  1LIB A;  1SWA A;  4JNJ A;  5HA1 A;  2MO5 A;  3H3I A;  4ORU A;  5HZ9 A;  2OYB O;  1LCW A;  3EC5 A;  4CDE A;  5HAE A;  1GGL A;  3K3L A;  4ZHH A;  1WUB A;  2X8F A;  3UEU A;  1HMT A;  1SRJ A;  4Y0P A;  2DJG A;  2OF8 A;  3HOE A;  4NYQ A;  4O4X A;  3VHM A;  1KT5 A;  3PQU A;  1TOU A;  4LZU A;  5L8N A;  2JGS A;  1IKJ A;  4BOE A;  1E06 A;  1HMS A;  3CMP A;  4AYH A;  3CKG A;  4HPC A;  3FIQ A;  1EQD A;  1LNM A;  3NQK A;  1KT3 A;  4GNW A;  4O4S A;  1YWC A;  3SAO A;  5HCC C;  4GGT A;  1JQP A;  2OL7 A;  5EZ2 A;  3T2X A;  4ZCB A;  3FW5 A;  4Y0S A;  1VWI B;  4ZHD A;  4DCB A;  2BC3 A;  2C4I A;  1RAV A;  1I9H A;  1FEM A;  1K3B A;  2ANS A;  2ACP X;  3AEH A;  1KL4 A;  3APW A;  3MBT A;  3QKG A;  3SOT A;  3T1D A;  4CV7 A;  1EAL A;  1QG5 A;  2HLV A;  2Q2M A;  4Y0Q A;  2AVI A;  2X32 A;  4MEE A;  4BX7 A;  1SA8 A;  1QFT A;  2OY7 A;  2W2F A;  4BVM A;  4CK4 A;  1R0U A;  2VDF A;  2GTL M;  2K23 A;  3VG4 A;  4TKB A;  4YGZ A;  1OBU A;  3FYF A;  5KHP A;  5K06 A;  4XMH A;  2OVA A;  3PQS A;  1DFV A;  3WXQ A;  2NND A;  1VWA B;  5B2A O;  4GGZ A;  1SWE A;  4K19 A;  3VG7 A;  1AVG I;  1FJ1 E;  1JBH A;  2BLG A;  2RTN B;  2X8T A;  4QGV A;  3P6G A;  5LJC A;  4BX7 B;  1BEB A;  3RY1 A;  1SLG B;  4Z2V A;  3FEP A;  2MHD A;  3F9D A;  3T6L A;  4BX6 B;  4CSB A;  1EII A;  1RXH A;  4XMG A;  4A8Z A;  2RCQ A;  1N0S A;  1BSO A;  1VWE B;  3STM X;  2RCT A;  4IB9 A;  1HQP A;  4NNS A;  5LJB A;  2A0A A;  5DPQ A;  1VWP B;  4DNE A;  4ML7 B;  5L3Y A;  2L5P A;  3NAD A;  5B11 O;  5IRU A;  2AT6 X;  3SLO A;  4GUZ A;  1IFC A;  3WZP A;  4RUU A;  3HWF A;  3MG5 A;  2RTO B;  2MWH A;  2OFB A;  3C78 X;  5EDB A;  3S26 A;  3ZW2 A;  3ZW1 B;  1QWD A;  1VWR B;  4GKC A;  2ZSC A;  3CR6 A;  1GM6 A;  1SWF A;  3HOL A;  2ASN X;  2GTL O;  4UU3 A;  2BSZ A;  2NNE A;  1CBI A;  1E00 A;  2BT9 A;  2IZF B;  5JR8 A;  1GXA A;  1SRG A;  1XCA A;  1L6M A;  3ZI8 A;  4GET A;  1JV4 A;  4TKH A;  1PBY A;  2WQA E;  4ZR2 A;  3OE3 A;  4O3X B;  4QYP A;  4AZN A;  1SWK A;  5BVS A;  4HPA A;  2A5C A;  3ZQ3 A;  2RTE B;  4YDB A;  2XKL A;  2ZAG A;  3NP1 A;  5FQ8 E;  3KQ0 A;  2ZAI A;  2F09 A;  4O9S A;  3P6F A;  1KZW A;  1TVQ A;  3FA6 A;  3WZN A;  1SWH A;  1LIF A;  2FS7 A;  2FHN X;  3OBL A;  5BVT A;  3P6D A;  1MEP A;  1Y0G A;  1SWQ A;  4GJS A;  2RTB B;  1VWL B;  3VG5 A;  5LKF A;  1EW3 A;  2QMI A;  2Z4I A;  1URE A;  3AUM O;  4I9R A;  5H8T A;  4QYN A;  1QY1 A;  5CSE A;  5C0N A;  2HKD A;  1GT3 A;  2RTP B;  1SRF A;  1I06 A;  4O49 A;  1SXX A;  1T8V A;  3RDX A;  1A57 A;  4TLJ A;  3UEV A;  2CM9 A;  3NQ3 A;  4KC7 A;  4EQA C;  3CQN A;  1KOI A;  2QCB A;  5H9K A;  1A3Y A;  3WYP A;  1VWQ B;  1KT4 A;  4WBK A;  3Q6L A;  1CJ5 A;  1LFO A;  2IZK A;  1CBQ A;  1EPA A;  1HN2 A;  2CBS A;  2OL6 O;  2PI3 O;  3VHH A;  5F7G A;  1IFB A;  1Y53 X;  1ZNH A;  2QOS C;  1RST B;  2DJF A;  2L9C A;  3EW2 A;  1OEK A;  1E2T A;  1SLD B;  1Y52 X;  3B2H A;  2WR6 A;  4JGL A;  5F6Z A;  4Z27 A;  3G7X A;  4IRW A;  3RWX A;  2UZ2 A;  5B29 A;  2RTA A;  4ORR A;  2GTF X;  4XMC A;  3KZA A;  3FR4 A;  4WHI A;  4O3W A;  4ZHC A;  2A5B A;  3NBX X;  1SY3 A;  2X45 A;  5F2B A;  2AL0 X;  2KD2 A;  4ZH9 A;  3BRN A;  2C1S A;  2ALL X;  1SWG A;  4INN A;  4Y0R A;  3U0D A;  1ZNE A;  5F58 A;  2OVD A;  1WBI A;  3CKF A;  2FS6 A;  3FMZ A;  1N9Y A;  3T2W A;  2G5L A;  2Y3E A;  3WJE A;  4QRL A;  2RTC B;  1N9M A;  3I17 A;  3ELX A;  5EDC A;  1OSP O;  1O1U A;  4GGR A;  3ZZV A;  2W2A A;  3ZUI A;  2LBV A;  4NW4 A;  1KL5 A;  1ALB A;  2MM3 A;  1KQX A;  1O1V A;  4XMD A;  3VG2 A;  5AEO A;  5B10 O;  2GJ5 A;  3PPT A;  4YBU A;  5K67 A;  1HBP A;  1MK5 A;  4OMW A;  2AF5 A;  5L8I A;  2FKJ A;  4NP1 A;  1JJJ A;  2X8S A;  4I9S A;  4GDA A;  1G74 A;  3ZUO A;  3RBY A;  5KID A;  1FTP A;  5AQ6 A;  5IRA A;  1OEJ A;  1PMP A;  2F73 A;  2FLJ A;  2HZQ A;  3D96 A;  2CM4 A;  1PTS A;  4NV7 A;  4ORX A;  2QM9 A;  2RTF B;  3DSZ A;  3P02 A;  4AW8 A;  1EXS A;  4ODD A;  4CDD A;  5AJC A;  2AT3 X;  1LDO A;  4ARH A;  2JN3 A;  2OVS A;  4QZT A;  1E02 A;  4IAW A;  5B3M O;  2IZH B;  4YFP A;  2RTR B;  2IZE B;  4RUN A;  2IZA A;  3EBK A;  4Y59 A;  1HY2 A;  5D47 A;  4CPE A;  3WBG A;  4O3Z A;  3BDR A;  4M7M A;  2KTS A;  3PH6 A;  1JMZ A;  3D9W A;  2AT0 X;  3JQO A;  4DQ4 A;  2OF9 A;  4KCA A;  5LJH A;  1A18 A;  1GKA B;  1UZ2 X;  2X55 A;  3ZWE A;  4AZO A;  4BX6 A;  4NLJ A;  4FBV A;  2LKK A;  4KC8 A;  4HWM A;  1LID A;  3V8U A;  1DZJ A;  1MX7 A;  1VWJ B;  1LIC A;  1LKE A;  1X8U A;  2JU8 A;  2X56 A;  4IB8 A;  4ORY A;  4U9C A;  2XST A;  5B27 A;  3RY2 A;  1KZX A;  4O4U A;  4XMF A;  3ZW0 B;  1VWO B;  4U8U N;  3P6E A;  2OFM X;  1HBQ A;  4COT A;  4B55 A;  4EKV A;  1LPJ A;  1OEE A;  2Q39 A;  2Q4N A;  3FDC A;  3HK1 A;  3D4R A;  1T0V A;  2KTD A;  1ZRY A;  3ZW1 A;  2X46 A;  1I78 A;  3NPO A;  1NQM A;  4AZM A;  1JIW I;  1X8Q A;  4IAB A;  1B56 A;  2JW1 A;  3RDS A;  5B5F A;  3KFH A;  1U18 A;  1HXL A;  1RXJ A;  2OY8 A;  2JOZ A;  3APU A;  4BCS A;  2IZI A;  4NV8 A;  4Z2P A;  2JU7 A;  1JYD A;  3P24 A;  4QQ1 A;  1SXY A;  2FHL A;  2FGS A;  2G78 A;  1TW4 A;  4YCE A;  4ZHF A;  3GAQ A;  3PED A;  5HCD C;  4QGW A;  2AH7 X;  1FDQ A;  4PJ2 A;  1NGL A;  3N91 A;  2K62 A;  2CAM A;  4EEJ A;  1BRP A;  1AEL A;  3HWG A;  3RE5 A;  5CE4 A;  4FGI B;  4JHQ A;  3RE6 A;  1RSU B;  1LF7 A;  4BBO A;  1I4U A;  2LFO A;  4BX5 B;  1K24 A;  1OPA A;  2VFB A;  4CPF A;  1CRB A;  1KXO A;  3O22 A;  2GC9 A;  1QY0 A;  2Y3F A;  3VG6 A;  3FID A;  5B5G A;  1ICM A;  1O8V A;  1LIE A;  1Y55 X;  2G8C O;  1KFF A;  1IJ8 A;  1STR B;  5H9N A;  1OBQ A;  1X71 A;  4EDE A;  1BM5 A;  4EXZ A;  1ZND A;  3DTQ A;  5HZ8 A;  2WEX A;  5FAZ A;  3FLL A;  4OMX A;  3FW4 A;  1I05 A;  1I04 A;  4L1N A;  4CDF A;  3NX2 A;  3BU9 A;  3O19 A;  4U46 A;  1X89 A;  1U17 A;  3EBW A;  2OZQ A;  4GD9 A;  5F6B A;  2RTJ A;  3TF6 A;  3VE1 A;  4Z2O A;  3RZY A;  1GX3 A;  2FT9 A;  3B2J A;  4NNT A;  2RQ0 A;  1EPB A;  5DG4 A;  3SZI A;  1G7N A;  1GT1 A;  1SXW A;  1MDC A;  1SY1 A;  1YP6 A;  3MX7 A;  4MIR A;  3SZJ A;  4ZGU A;  4N7C A;  5D8J A;  1BWY A;  3S5X A;  3FEK A;  4A1H A;  1KGL A;  2PY1 A;  4YCH A;  3VGW A;  1NP4 A;  4YBP A;  3NR3 A;  3TGA A;  1SWO A;  2IZB A;  1X8N A;  1CBR A;  1SRH A;  3JS1 A;  1P6P A;  1KT7 A;  3TZS A;  4QAE A;  3Q34 A;  5D48 A;  3X00 A;  1GX8 A;  3B2L A;  4LKP A;  4OS8 A;  1BJ7 A;  3UEX A;  4BQU A;  4MVE A;  4QZU A;  1YWA A;  2WUT A;  3KFI A;  1TXL A;  2RN4 A;  3FR2 A;  2BS6 A;  1JYJ A;  3UEW A;  4FBO A;  2RTG B;  1D3S A;  1FE3 A;  1N7Y A;  1VYO A;  1VWC B;  4FQB B;  4IAX A;  4YGH A;  1DF3 A;  1STP A;  1CBS A;  1VWH B;  2OL8 O;  5H9L A;  4TQ2 A;  2R73 A;  1ZNK A;  2IZD B;  4HFO A;  1AVE A;  3RSW A;  3VU1 A;  4ALO A;  2E4J A;  4YDA A;  4TJZ A;  1IKE A;  3FEL A;  1QQS A;  3WJD A;  4JO6 A;  1EUO A;  1ML7 A;  1OBP A;  2HZR A;  1SRE A;  3EYC A;  4D6B A;  5LKE A;  3APX A;  3WJC A;  3WZQ A;  1N43 A;  1SWP A;  4ID2 A;  1W4T A;  2UYW A;  4M6S A;  2Q9S A;  1VWM B;  3VE2 A;  3ELZ A;  5AJB A;  3AKM A;  1PBO A;  3FR5 A;  1GT5 A;  3KFG A;  3T6F A;  1DZK A;  3WOV A;  4YMY A;  1JJX A;  1YWD A;  3D95 A;  4Y5D A;  2CZT A;  5D4A A;  2RD7 C;  2IZJ A;  4IB7 A;  4KT5 A;  1BSQ A;  4BJ8 A;  2HMB A;  4D6A A;  1UYO X;  1SLE B;  1FEL A;  5FEN A;  1HQQ A;  2QO4 A;  2LB6 A;  1T68 X;  4GK9 A;  2X4M A;  4OEL A;  1VYG A;  3B2K A;  3OJY C;  2HYS A;  2FKG A;  1GT4 A;  2L68 A;  2P8G A;  2G7B A;  2RA6 A;  2YMS A;  1QFV A;  4IB6 A;  3WZO A;  5HCE C;  5LJD A;  3KFF A;  2FWV A;  1SWJ A;  2IFB A;  1SY2 A;  2OFA A;  5HA0 A;  1GKA A;  1RBP A;  1SY0 A;  1YWB A;  3O2Y A;  1YP7 A;  4I6S A;  4KII A;  4WFU A;  5JD2 A;  5LJK A;  3VPJ E;  4GU8 A;  1S44 A;  2IZC B;  4OKA A;  1NDJ A;  3EM0 A;  4BGF A;  3GE2 A;  4CPH B;  2W2B A;  1VPR A;  3AKN A;  2OVE A;  1ERX A;  4WFV A;  3ZW0 A;  2R56 A;  3MM0 A;  4LKT A;  3WYQ A;  3BSZ E;  4DQ3 A;  2I5Z O;  4I3B A;  1S7D A;  1XKI A;  3EMM A;  3LV4 A;  3APV A;  4OEM A;  4U3Q A;  4EFG A;  4YFR A;  2EU7 X;  2AT5 X;  3QQ2 A;  4GRJ A;  3STK A;  1AQB A;  1TOW A;  2KW1 A;  1SWU A;  3C77 X;  5FQ6 E;  4Z6J A;  4PSQ A;  3WJF A;  1BBP A;  5BYP A;  3TGC A;  1ACD A;  1S2P A;  1EIO A;  3CQR A;  5EEE A;  1LEL A;  4GJV A;  1JMX A;  1G85 A;  4NLI A;  2AMM X;  2KT4 B;  1Z24 A;  5IRW A;  1E5P A;  2DM5 A;  3L4R A;  2Z4H A;  1SWR A;  1U0X A;  4C5P A;  1JJU A;  1PM1 X;  3P6H A;  4I95 A;  2POA A;  3F6Z B;  1SWL A;  1Y9T A;  4YKO A;  1MX8 A;  3FA9 A;  3I0A A;  2LA7 A;  1RXK A;  3U9P C;  2L67 A;  4OS3 A;  2NP1 A;  3FEN A;  3WJB A;  1NBX A;  2C1Q A;  1LDQ A;  1D2U A;  1LUQ A;  1HXZ A;  3HTY A;  1YIV A;  3C76 X;  5D45 A;  1NQN A;  2AKQ A;  3IA8 A;  4YGG A;  1HMR A;  3BY0 A;  4CDC A;  2RTL A;  1QY2 A;  1DZM A;  1BSY A;  4ALB A;  5HBS A;  4YKM A;  2FRS A;  2MF6 A;  2RTK A;  2RTI B;  5HZ5 A;  2RTQ B;  1DZP A;  4ZGF A;  4BX5 A;  2WQ9 A;  3CWK A;  2WEW A;  2YG2 A;  4TNN A;  1KL3 A;  5EED A;  5EPQ A;  3PEC A;  3IFB A;  3SLT A;  3FA7 A;  4L3R A;  4GE1 A;  1SXU A;  3FA8 A;  1SWC A;  3WJG A;  2A2U A;  3E3C A;  3RKG A;  1AB0 A;  5HTE A;  1QAB E;  3NQ9 A;  4MVI A;  4MVL A;  4ORS A;  2X34 A;  1X8P A;  4O4O A;  2FR3 A;  4HPB A;  2IZG B;  1ERB A;  4QGX A;  4A60 A;  2WWP A;  1KQW A;  4HPD A;  2F01 A;  3RDM A;  5F1E A;  2M4L A;  5BVQ A;  4GNY A;  4ES7 A;  2RTH B;  2A13 A;  3OD9 A;  3U03 A;  1GX9 A;  2RTM A;  3BS2 A;  4YFQ A;  1VWD B;  5FFH A;  2ACO A;  3RDQ A;  3NX1 A;  4N7D A;  4YVB A;  2CZU A;  4XME A;  2OFR X;  1N4J A;  2HNX A;  4I60 A;  1H91 A;  1SMP I;  3BX8 A;  4I3D A;  3BLG A;  4YH0 A;  5CYB A;  4IMN A;  1DF8 A;  3LTW A;  3UAQ A;  1JZU A;  1SWD A;  1IIU A;  2Q2P A;  4ORW A;  2N93 A;  1VYF A;  2VFC A;  3CBC A;  3STN A;  1ZNL A;  4MVK A;  2A3F X;  3D97 A;  5L8O A;  4ON1 A;  5HZQ A;  3VG3 A;  4UU2 A;  1W6F A;  4AZR A;  3P6C A;  1Y9L A;  2BS5 A;  2O62 A;  4IMO A;  2GH7 A;  4ZH6 A;  1DC9 A;  1VWF B;  3PP6 A;  2GTL N;  3CBS A;  4Z28 A;  5K68 A;  3BX7 A;  1ADL A;  1G5W A;  2WSJ A;  4O3Y A;  1W5R A;  1YUP A;  2Y32 A;  1SWT A;  2QOM A;  1B0O A;  4TKJ A;  5FQ7 E;  2LBA A;  1OPB A;  3WVM A;  2BHV A;  3PDF A;  4AZP A;  3F8A A;  3SZH A;  1MVG A;  4OS0 A;  4GH7 A;  3S60 A;  3JSQ A;  2G79 A;  1BLR A;  5HTD A;  1B4M A;  1SWN A;  3RDU A;  3LHN A;  4LQZ A;  1IW2 A;  1MUP A;  1STS B;  2I5V O;  4GZV A;  1PEE A;  2A8G A;  5HWZ A;  1RLB E;  1UYN X;  1VWG B;  2R74 A;  4ZHG A;  4AZQ A;  5LJE A;  1VWN B;  2OY5 O;  2WPU A;  2CBR A;  3PH5 A;  1LCZ A;  3SLJ A;  3VHI A;  1A2D A;  1VWK B;  1X8O A;  2IZL B;  4U8U M;  2FR2 A;  4MIS A;  2FTB A;  1FEN A;  1ZNG A;  2JU3 A;  3PK2 A;  5HZ6 A;  1BRQ A;  1LCV A;  4ZFX A;  1NP1 A;  3B2I A;  4ZJ0 A;  4KH8 A;  2AT8 X;  1AVD A;  2RTD B;  4GDZ A;  4IBA A;  2MJI A;  1VWB B;  2OY1 O;  3EW1 A;  3MVF A;  5CHK A;  1ICN A;  3TGB A;  2A2G A;  1SWS A; 
#chains in the Genus database with same CATH homology
 4R0B A;  3HWD A;  5LJG A;  3BU1 A;  5H9A A;  1B8E A;  5IO5 A;  4QNI A;  1KT6 A;  4FBR A;  2JMB A;  2QO5 A;  2NNQ A;  3S5V A;  5IO6 A;  4A1Y A;  5KIC A;  4I3C A;  1EI5 A;  3HWE A;  2QO6 A;  4LZV A;  4NYR A;  5IO7 A;  1DV9 A;  4U8U O;  1LIB A;  5HA1 A;  2MO5 A;  3H3I A;  4ORU A;  5HZ9 A;  5HAE A;  1GGL A;  3K3L A;  2X8F A;  3UEU A;  1HMT A;  4Y0P A;  4O4X A;  3HOE A;  4NYQ A;  1KT5 A;  3PQU A;  1TOU A;  4LZU A;  5L8N A;  1IKJ A;  4BOE A;  1E06 A;  1HMS A;  3CMP A;  4AYH A;  4HPC A;  3FIQ A;  1EQD A;  1LNM A;  3NQK A;  1KT3 A;  4GNW A;  4O4S A;  1YWC A;  3SAO A;  5HCC C;  5EZ2 A;  4ZCB A;  3FW5 A;  4Y0S A;  4ZHD A;  3QKG A;  1FEM A;  2ANS A;  3APW A;  2ACP X;  3MBT A;  3SOT A;  4CV7 A;  3T1D A;  1EAL A;  1QG5 A;  2HLV A;  2Q2M A;  4Y0Q A;  1SA8 A;  1QFT A;  2W2F A;  4BVM A;  4CK4 A;  1R0U A;  2GTL M;  2K23 A;  3VG4 A;  4TKB A;  4YGZ A;  1OBU A;  3FYF A;  5KHP A;  5K06 A;  4XMH A;  2OVA A;  3PQS A;  1DFV A;  3WXQ A;  2NND A;  4K19 A;  3VG7 A;  1AVG I;  1JBH A;  2BLG A;  2X8T A;  4QGV A;  5LJC A;  3P6G A;  1BEB A;  3FEP A;  2MHD A;  3F9D A;  4CSB A;  1EII A;  4XMG A;  4A8Z A;  2RCQ A;  1N0S A;  1BSO A;  3STM X;  2RCT A;  4IB9 A;  1HQP A;  4NNS A;  2A0A A;  5DPQ A;  4ML7 B;  2L5P A;  3NAD A;  2AT6 X;  1IFC A;  4RUU A;  3HWF A;  3ZW2 A;  2MWH A;  5EDB A;  3C78 X;  3ZW1 B;  3S26 A;  1QWD A;  4GKC A;  5HZQ A;  3CR6 A;  1GM6 A;  3HOL A;  4UU3 A;  2ASN X;  2GTL O;  2NNE A;  1CBI A;  1E00 A;  2BT9 A;  5JR8 A;  1GXA A;  1L6M A;  1XCA A;  3ZI8 A;  4GET A;  1JV4 A;  4TKH A;  2WQA E;  4ZR2 A;  3OE3 A;  4O3X B;  4QYP A;  4AZN A;  5BVS A;  4HPA A;  3ZQ3 A;  4YDB A;  2XKL A;  2ZAG A;  3NP1 A;  5FQ8 E;  3KQ0 A;  2ZAI A;  2F09 A;  4O9S A;  3P6F A;  1KZW A;  1TVQ A;  3FA6 A;  1LIF A;  2FS7 A;  3OBL A;  5BVT A;  3P6D A;  3VG5 A;  5LKF A;  1EW3 A;  2QMI A;  2Z4I A;  1URE A;  4I9R A;  5H8T A;  4QYN A;  1QY1 A;  5C0N A;  1GT3 A;  1I06 A;  4O49 A;  1SXX A;  1T8V A;  1A57 A;  4TLJ A;  3UEV A;  2CM9 A;  3NQ3 A;  4KC7 A;  4EQA C;  3CQN A;  1KOI A;  5H9K A;  1A3Y A;  1KT4 A;  4WBK A;  3Q6L A;  1CJ5 A;  1LFO A;  1CBQ A;  1EPA A;  1HN2 A;  2CBS A;  5F7G A;  1IFB A;  1ZNH A;  2QOS C;  2L9C A;  1OEK A;  3B2H A;  4JGL A;  2WR6 A;  5F6Z A;  3G7X A;  3RWX A;  5B29 A;  4ORR A;  2GTF X;  4XMC A;  3KZA A;  3FR4 A;  4WHI A;  4O3W A;  4ZHC A;  3NBX X;  1SY3 A;  2X45 A;  2AL0 X;  2KD2 A;  4ZH9 A;  3BRN A;  2ALL X;  4INN A;  4Y0R A;  3U0D A;  1ZNE A;  5F58 A;  2OVD A;  2FS6 A;  3FMZ A;  3WJE A;  4QRL A;  3I17 A;  3ELX A;  5EDC A;  3ZZV A;  1O1U A;  2W2A A;  3ZUI A;  2LBV A;  4NW4 A;  2MM3 A;  1ALB A;  1KQX A;  1O1V A;  4XMD A;  3VG2 A;  5AEO A;  2GJ5 A;  3PPT A;  4YBU A;  1HBP A;  4OMW A;  5L8I A;  4NP1 A;  1JJJ A;  2X8S A;  4I9S A;  5KID A;  1G74 A;  3ZUO A;  3RBY A;  1FTP A;  5AQ6 A;  1OEJ A;  1PMP A;  2F73 A;  2FLJ A;  2HZQ A;  3D96 A;  2CM4 A;  4ORX A;  2QM9 A;  3DSZ A;  3P02 A;  4AW8 A;  1EXS A;  4ODD A;  5AJC A;  2AT3 X;  4ARH A;  2JN3 A;  2OVS A;  4QZT A;  1E02 A;  4IAW A;  1JJX A;  4YFP A;  4RUN A;  3EBK A;  5D47 A;  3WBG A;  4O3Z A;  3BDR A;  4M7M A;  2KTS A;  3PH6 A;  2AT0 X;  3JQO A;  4DQ4 A;  4KCA A;  5LJH A;  1A18 A;  1GKA B;  1UZ2 X;  3ZWE A;  4AZO A;  4NLJ A;  4FBV A;  2LKK A;  4KC8 A;  4HWM A;  1LID A;  3V8U A;  1DZJ A;  1MX7 A;  1LIC A;  1LKE A;  1X8U A;  2JU8 A;  4IB8 A;  5B27 A;  1KZX A;  4U9C A;  2XST A;  4O4U A;  4XMF A;  3ZW0 B;  4U8U N;  3P6E A;  2OFM X;  1HBQ A;  4COT A;  1LPJ A;  1OEE A;  2Q39 A;  2Q4N A;  3HK1 A;  3D4R A;  1T0V A;  2KTD A;  1ZRY A;  3ZW1 A;  2X46 A;  3NPO A;  4AZM A;  1JIW I;  1X8Q A;  4IAB A;  1B56 A;  2JW1 A;  3KFH A;  1U18 A;  3APU A;  2JOZ A;  2JU7 A;  1JYD A;  3P24 A;  4QQ1 A;  1SXY A;  2G78 A;  1TW4 A;  4YCE A;  4ZHF A;  3GAQ A;  3PED A;  5HCD C;  4QGW A;  2AH7 X;  1FDQ A;  4PJ2 A;  1NGL A;  3N91 A;  2K62 A;  4EEJ A;  1BRP A;  1AEL A;  3HWG A;  5CE4 A;  4FGI B;  1LF7 A;  1I4U A;  2LFO A;  1OPA A;  1CRB A;  1KXO A;  3O22 A;  2GC9 A;  1QY0 A;  3VG6 A;  1ICM A;  1O8V A;  1LIE A;  5H9N A;  1OBQ A;  1X71 A;  4EDE A;  1BM5 A;  4EXZ A;  1ZND A;  3DTQ A;  5HZ8 A;  2WEX A;  5FAZ A;  3FLL A;  4OMX A;  3FW4 A;  1I05 A;  1I04 A;  4L1N A;  3NX2 A;  3BU9 A;  3O19 A;  5F6B A;  1X89 A;  1U17 A;  3EBW A;  2OZQ A;  3TF6 A;  3VE1 A;  3RZY A;  2FT9 A;  3B2J A;  4NNT A;  2RQ0 A;  1EPB A;  5DG4 A;  1G7N A;  1GT1 A;  1SXW A;  1MDC A;  1SY1 A;  1YP6 A;  3MX7 A;  4MIR A;  4ZGU A;  4N7C A;  5D8J A;  1BWY A;  3S5X A;  3FEK A;  4A1H A;  1KGL A;  2PY1 A;  4YCH A;  1NP4 A;  4YBP A;  3NR3 A;  3TGA A;  1X8N A;  1CBR A;  3JS1 A;  1P6P A;  1KT7 A;  3TZS A;  4QAE A;  5D48 A;  1GX8 A;  3B2L A;  4LKP A;  4OS8 A;  1BJ7 A;  3UEX A;  4BQU A;  4MVE A;  4QZU A;  1YWA A;  2WUT A;  3KFI A;  1TXL A;  2RN4 A;  3FR2 A;  2BS6 A;  1JYJ A;  3UEW A;  4FBO A;  1D3S A;  1FE3 A;  4FQB B;  4IAX A;  4YGH A;  1DF3 A;  1CBS A;  5H9L A;  4TQ2 A;  2R73 A;  1ZNK A;  4HFO A;  3RSW A;  4ALO A;  3VU1 A;  2E4J A;  4YDA A;  4TJZ A;  1IKE A;  3FEL A;  1QQS A;  3WJD A;  1EUO A;  1ML7 A;  1OBP A;  2HZR A;  3EYC A;  4D6B A;  5LKE A;  3APX A;  3WJC A;  4ID2 A;  4M6S A;  2Q9S A;  3VE2 A;  3ELZ A;  5AJB A;  3AKM A;  1PBO A;  3FR5 A;  1GT5 A;  3KFG A;  1DZK A;  3WOV A;  4YMY A;  1YWD A;  3D95 A;  2CZT A;  5D4A A;  2RD7 C;  4IB7 A;  4KT5 A;  1BSQ A;  4D6A A;  2HMB A;  1FEL A;  5FEN A;  2QO4 A;  4ORY A;  2LB6 A;  1T68 X;  4GK9 A;  1VYG A;  3B2K A;  3OJY C;  2HYS A;  2P8G A;  1GT4 A;  2L68 A;  2RA6 A;  2G7B A;  2YMS A;  4ZHH A;  1QFV A;  4IB6 A;  5HCE C;  5LJD A;  3KFF A;  2FWV A;  2IFB A;  1SY2 A;  5HA0 A;  1GKA A;  1RBP A;  1SY0 A;  1YWB A;  3O2Y A;  1YP7 A;  4I6S A;  4KII A;  4WFU A;  5LJK A;  3VPJ E;  4GU8 A;  1S44 A;  3EM0 A;  3GE2 A;  2W2B A;  1VPR A;  3AKN A;  2OVE A;  1ERX A;  4WFV A;  3ZW0 A;  2R56 A;  4LKT A;  4DQ3 A;  3BSZ E;  4I3B A;  1S7D A;  1XKI A;  3EMM A;  3LV4 A;  3APV A;  4U3Q A;  4EFG A;  4YFR A;  2EU7 X;  2AT5 X;  4GRJ A;  5LJB A;  3STK A;  1AQB A;  1TOW A;  2KW1 A;  3C77 X;  5FQ6 E;  4PSQ A;  3WJF A;  1BBP A;  5BYP A;  3TGC A;  1ACD A;  1S2P A;  1EIO A;  3CQR A;  5EEE A;  4NLI A;  1G85 A;  2AMM X;  2KT4 B;  1Z24 A;  1E5P A;  2DM5 A;  3L4R A;  2Z4H A;  1U0X A;  1PM1 X;  3P6H A;  4I95 A;  2POA A;  3F6Z B;  1Y9T A;  4YKO A;  1MX8 A;  3FA9 A;  3I0A A;  2LA7 A;  3U9P C;  2L67 A;  4OS3 A;  2NP1 A;  3FEN A;  3WJB A;  1D2U A;  3HTY A;  1YIV A;  3C76 X;  5D45 A;  3IA8 A;  2AKQ A;  4YGG A;  1HMR A;  3BY0 A;  1QY2 A;  1DZM A;  1BSY A;  4ALB A;  5HBS A;  4YKM A;  2FRS A;  5HZ5 A;  1DZP A;  4ZGF A;  2WQ9 A;  3CWK A;  2WEW A;  2YG2 A;  4TNN A;  5EED A;  5EPQ A;  3PEC A;  3IFB A;  3FA7 A;  4L3R A;  4GE1 A;  1SXU A;  3FA8 A;  3WJG A;  2A2U A;  3E3C A;  3RKG A;  1AB0 A;  5HTE A;  1QAB E;  3NQ9 A;  4MVI A;  4MVL A;  4ORS A;  1X8P A;  4O4O A;  2FR3 A;  4HPB A;  4A60 A;  1ERB A;  4QGX A;  2WWP A;  1KQW A;  4HPD A;  5F1E A;  2M4L A;  5BVQ A;  4GNY A;  4ES7 A;  2A13 A;  3OD9 A;  3U03 A;  1GX9 A;  3BS2 A;  4YFQ A;  5FFH A;  2ACO A;  3NX1 A;  4N7D A;  2CZU A;  4XME A;  2OFR X;  2HNX A;  4YH0 A;  1H91 A;  1SMP I;  3BX8 A;  4I3D A;  3BLG A;  5CYB A;  4IMN A;  3UAQ A;  1JZU A;  4ORW A;  1IIU A;  2Q2P A;  2N93 A;  1VYF A;  3CBC A;  3STN A;  1ZNL A;  4MVK A;  2A3F X;  3D97 A;  5L8O A;  4ON1 A;  3VG3 A;  4UU2 A;  4AZR A;  3P6C A;  1Y9L A;  2BS5 A;  2O62 A;  4IMO A;  4ZH6 A;  1DC9 A;  3PP6 A;  2GTL N;  3CBS A;  3BX7 A;  1ADL A;  1G5W A;  2WSJ A;  4O3Y A;  1YUP A;  1B0O A;  4TKJ A;  5FQ7 E;  2LBA A;  1OPB A;  3WVM A;  2BHV A;  4AZP A;  3F8A A;  1MVG A;  4OS0 A;  4GH7 A;  3S60 A;  3JSQ A;  2G79 A;  1BLR A;  5HTD A;  1B4M A;  3LHN A;  4LQZ A;  1IW2 A;  1MUP A;  4GZV A;  1PEE A;  5HWZ A;  1RLB E;  2R74 A;  4ZHG A;  4AZQ A;  5LJE A;  2CBR A;  3PH5 A;  1A2D A;  4U8U M;  1X8O A;  2FR2 A;  4MIS A;  2FTB A;  1FEN A;  1ZNG A;  2JU3 A;  5HZ6 A;  1BRQ A;  4ZFX A;  1NP1 A;  3B2I A;  4ZJ0 A;  4KH8 A;  2AT8 X;  4GDZ A;  4IBA A;  2MJI A;  3TGB A;  3MVF A;  1ICN A;  2A2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...