1VWGB

Streptavidin complexed with the head-to-tail disulfide-bonded peptide dimer of cyclo-ac-[chpqgppc]-nh2, ph 2.5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (biotin-binding protein/peptide)
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
source organism Streptomyces avidinii
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vwgB00
1RSUB 1NBXA 1VWLB 4GD9A 1I9HA 1MOYA 1NQMA 1RXJA 1SWOA 4JO6A 4BX5A 4BX6B 2IZFB 5K68A 1SRHA 2C1QA 2RTRB 3SZJA 3WYQA 2Y3EA 2RTAA 3MM0A 4GGZA 1VWOB 2A8GA 2IZAA 3EW2A 2RTIB 3RDUA 1KFFA 1VWBB 3WZQA 5B5GA 4JHQA 5IRWA 2RTDB 4Z2PA 1LCVA 1STPA 2MF6A 3RDMA 2OFAA 1LCZA 1VWIB 1STSB 1VWNB 2RTEB 5IRAA 3WZPA 1SWBA 2RTMA 2FHNX 1KL5A 4GDAA 1MM9A 1N9MA 1NQNA 2RTQB 4GJVA 1STRB 1PTSA 2A5CA 4Z6JA 1SWAA 5F2BA 4CPHB 4BX6A 2FHLA 1RSTB 3MG5A 2ZSCA 1SWCA 2RTJA 3VHMA 3X00A 1SRJA 4CPFA 5K67A 1SWKA 1RXHA 1NC9A 2RTNB 4CPEA 4BCSA 1SRFA 4U46A 3RDOA 1MEPA 1SWNA 1AVDA 1N7YA 3RY1A 4GGRA 4CPIA 1Y55X 1LDOA 1Y53X 4Z28A 1SWUA 1Y52X 1VWMB 2C4IA 1SLEB 3VHHA 3RDXA 1SRGA 5CHKA 1VWCB 3SZIA 5CSEA 1N43A 1VWKB 2RTGB 2RTHB 1SREA 5B5FA 4Y5DA 4CPHA 1SLDB 4Z2VA 1MK5A 1SWLA 1SLFB 1HXLA 1SWSA 1HY2A 4GJSA 3WZNA 3VHIA 1NDJA 2IZJA 2OF9A 3RDQA 2IZCB 4Y59A 3T2WA 2RTFB 1N4JA 2RTBB 3RY2A 2G5LA 2IZGB 4OKAA 4Z27A 4BBOA 4I60A 1VWAB 5L3YA 2F01A 3RDSA 4BX7B 3FDCA 2A5BA 1LUQA 4IRWA 2IZBA 1IJ8A 2IZDB 4YVBA 1SWPA 1KL3A 4DNEA 2RTKA 3PK2A 4GGTA 1VWGB 3SZHA 1RAVA 3RE5A 1VWPB 4Z2OA 1VWEB 2RTCB 1SLGB 1RXKA 2JGSA 2CAMA 1SWGA 2C1SA 1LDQA 1N9YA 2IZHB 1VYOA 2UYWA 1HXZA 2IZLB 5IRUA 4BX5B 3T2XA 1SWTA 2BC3A 1SWDA 2RTLA 3T6FA 3EW1A 1VWFB 1LCWA 2RTPB 2IZIA 2RTOB 1SWJA 1VWHB 1SWFA 2Y32A 1VWJB 5JD2A 2WPUA 3T6LA 1LELA 1SWHA 4BX7A 1DF8A 1VWRB 2AVIA 3WYPA 1KL4A 2OFBA 1SRIA 2QCBA 1SWQA 1AVEA 3RE6A 2OF8A 4EKVA 2IZKA 3WZOA 4JNJA 1SWRA 2GH7A 3VGWA 1VWQB 1VWDB 1HQQA 2IZEB 2UZ2A 1WBIA 2Y3FA 4BJ8A 1SWEA
chains in the Genus database with same CATH superfamily
1X8UA 1NBXA 4ALOA 3P02A 4HPAA 1MOYA 1NQMA 2AMMX 2MO5A 4BX5A 5HA1A 3QQ2A 2OL7A 2GTLM 4RUUA 5F6BA 3TGCA 1Y9TA 3D9WA 1CBQA 2JN3A 2C1QA 2BS6A 3BRNA 3EBWA 3FMZA 3MVFA 3K3LA 1BBPA 2FWVA 4CV7A 1VWOB 2RD7C 3RDUA 3WZQA 2W2BA 2OVSA 4GETA 1OEKA 1LCVA 4A1YA 1ML7A 4A1HA 3KFGA 1LIEA 2RTEB 1IFCA 2RA6A 3WZPA 4CDCA 3EM0A 1SWBA 2RTMA 3TGBA 1TOWA 4XMCA 3V8UA 3BU1A 3KFHA 2RTQB 4GJVA 3WJDA 5CE4A 1LF7A 2QOMA 4GH7A 5HCEC 1PTSA 4JGLA 1KT7A 4M7MA 5BYPA 5HCCC 2FT9A 1U0XA 4TJZA 3P6DA 1VPRA 1SWCA 2ZSCA 3P6EA 2G7BA 4QAEA 1NP1A 2YG2A 1SMPI 4XMGA 1SWKA 1EW3A 1B4MA 2RTNB 3APVA 4BCSA 1JJXA 1KT4A 4FQBB 2LBAA 1N7YA 2ALLX 4QZTA 3RKGA 4EXZA 5IO7A 3HK1A 4YCHA 3SLJA 1A18A 1ALBA 1Y55X 5H9KA 1CBIA 1CRBA 1G5WA 4NNTA 5AJCA 3NR3A 5F6ZA 1LNMA 2W2FA 4O4OA 2QO4A 1D3SA 2G8CO 2RCQA 1VWMB 1G74A 2X56A 4I3CA 3VHHA 1N0SA 3SZIA 5IO6A 2Z4HA 2A2UA 4ZGUA 1VWKB 2KD2A 2RTGB 2A13A 4TKHA 1KGLA 1FE3A 2OL8O 4Y5DA 1UYOX 4DQ4A 3WJGA 1RLBE 3JS1A 3CWKA 4Z2VA 2PI3O 2ANSA 2FS6A 1HXLA 4QGWA 3LV4A 5LJHA 2BHVA 3IFBA 3FR2A 4GJSA 3WZNA 4OS3A 1X89A 1JZUA 4I95A 2OF9A 3WJCA 4O3XB 1FEMA 1OPAA 2MJIA 4NLIA 3P6FA 3D96A 1T0VA 3PPTA 5L8NA 2JU8A 2X55A 2ASNX 3F6ZB 1YP7A 2OL6O 2GTLN 2IZGB 3CKGA 1DC9A 2JOZA 3OD9A 5JR8A 3NADA 1AVGI 1OBPA 2ZAIA 5K06A 1LICA 2F01A 4XMHA 4EEJA 4KT5A 1KQXA 3H3IA 3ZW0B 2A5BA 1IJ8A 5H9NA 1GT4A 2DJGA 2F73A 3BS2A 3ZWEA 4ES7A 4AZOA 1TW4A 5F1EA 2RTKA 4WHIA 1ADLA 1VWPB 2FLJA 5L8OA 4YH0A 2L67A 1ZNGA 3C78X 4FGIB 2AT0X 2HKDA 2I5VO 1LDQA 1N9YA 3P24A 1HN2A 4GU8A 2IZHB 3PDFA 4O3ZA 5D8JA 4A8ZA 1ZNKA 5EDCA 3CMPA 2RTLA 1VWFB 3CQRA 3FW5A 2X8TA 4U8UN 4MEEA 1MX7A 3WXQA 4KC8A 1KQWA 4D6AA 2RTOB 1X71A 3D95A 3PP6A 3NX2A 1TXLA 1X8PA 4HPBA 1ERXA 2AT8X 4WBKA 4YBUA 1SY3A 4ZHFA 5HZQA 3ZW1B 2N93A 1CJ5A 1LELA 3ELZA 1U18A 4O4UA 2LB6A 5B27A 2G79A 1UYNX 3ZW0A 3LTWA 4LZVA 1BRPA 2R74A 5EEDA 2O62A 2OF8A 3CBCA 4YKMA 1SWRA 4ORRA 3NQKA 4BQUA 2KW1A 1LKEA 3FW4A 1EPBA 5FQ8E 1QWDA 2UZ2A 1WBIA 2HLVA 4TKBA 1SWEA 3FENA 1DZJA 1RSUB 4FBRA 1VWLB 2QOSC 4JO6A 4TQ2A 4COTA 1GX3A 5H9AA 2X8FA 2RTRB 2HZRA 5AJBA 3WYQA 1JIWI 2Y3EA 4ZCBA 2OFMX 1BSOA 3U9PC 1MVGA 2A8GA 1XCAA 3P6GA 2RTIB 4EQAC 1KFFA 1VWBB 1YP6A 2Q2PA 4TNNA 1HBPA 4JHQA 2CM4A 3WJEA 1GXAA 3ZW1A 3B2JA 5IRWA 3HWDA 4XMFA 1STSB 1A3YA 3LHNA 5DPQA 3O2YA 5IXGA 4O49A 2FHNX 1KL5A 1Y0GA 5CYBA 3UEVA 2X45A 4ZH6A 3CR6A 1JJJA 1JV4A 1OBUA 1NQNA 2F09A 4C5PA 2JU7A 5B10O 1A2DA 4OMXA 3STKA 2CZTA 1SXXA 2A5CA 2WQ9A 5D45A 2GTLO 1U17A 2CBRA 2RTJA 1RBPA 5D4AA 3X00A 5FQ6E 4GK9A 1FENA 4CPFA 4QGXA 4QRLA 5HZ9A 1AB0A 1I4UA 3GAQA 1MDCA 2E4JA 1MEPA 3APXA 4GKCA 1AVDA 4U46A 4ZJ0A 4AZPA 4KH8A 4CPIA 4IAXA 1G7NA 4I6SA 4NYQA 1WUBA 3B2IA 1G85A 3JQOA 1YUPA 1ICMA 3OBLA 1T68X 4I9RA 2QM9A 1HBQA 4PJ2A 5HA0A 4Z28A 1X8OA 2X8SA 4LKTA 3S26A 4UU3A 1ZNDA 1SRGA 4O4XA 1VWCB 3F8AA 3RDXA 4B55A 5CSEA 5LJKA 2KT4B 3E3CA 3N91A 5BVSA 1E2TA 4HFOA 1SREA 4U8UO 2WR6A 4CK4A 1YWBA 3T1DA 4MIRA 2HZQA 1MK5A 4ORWA 3FA7A 1K3BA 4QYNA 1SWLA 4ORUA 5B3MO 4ML7B 3RZYA 3U03A 1DFVA 3RWXA 5D48A 2CZUA 1HY2A 2OVAA 4KIIA 2ACPX 1KZXA 2WUTA 5LKFA 1ICNA 1UZ2X 3BU9A 4K19A 2IZCB 4GE1A 1IFBA 2RTFB 1N4JA 5BVTA 2XSTA 3RY2A 2G5LA 5B11O 4YKOA 5LJCA 3NX1A 4Z27A 2RQ0A 3ZI8A 3UEUA 5L3YA 1DZKA 3WOVA 3I0AA 4U9CA 5EPQA 3AKNA 4O3WA 1LUQA 1JJUA 1FELA 3HWGA 3Q34A 3EC5A 3VG7A 2I5ZO 4AZQA 4YGGA 3IA8A 3RE5A 4ZHHA 4Z2OA 3APWA 1VWEB 2JGSA 1MX8A 3KFIA 4XMEA 5LJBA 2R56A 3O19A 4Y0SA 2A2GA 1PM1X 2X4MA 2UYWA 3FLLA 3VG3A 2VFCA 3ELXA 4NW4A 4DCBA 3T2XA 4KCAA 4TKJA 2OFRX 1KZWA 3EW1A 4UU2A 3VE2A 5HAEA 3MBTA 4RUNA 1W6FA 4IMOA 1ZNEA 4IABA 4KC7A 5LJGA 4ORSA 1SY2A 3HTYA 2WPUA 3T6LA 3VU1A 3NQ9A 3B2LA 4OS8A 2BS5A 1D2UA 4HPCA 4IB8A 3WYPA 1GT5A 3NPOA 2OFBA 3VG5A 4BOEA 4EKVA 2IZKA 1BJ7A 4OELA 1FDQA 3DSZA 4NYRA 3HWFA 3VGWA 1HQQA 1EXSA 2IZEB 1B56A 4FBVA 2A3FX 2ACOA 4QNIA 2PY1A 1KOIA 5AQ6A 4GD9A 1BRQA 3AEHA 1BWYA 1RXJA 4BX6B 2DM5A 4YBPA 1ERBA 2Q2MA 2IZFB 2EU7X 1ZRYA 5K68A 4OMWA 3ZW2A 3SZJA 3PECA 3SZHA 4GGZA 3UAQA 3EW2A 2WEXA 3QKGA 2L5PA 3UEXA 4IAWA 1BM5A 3KFFA 2GC9A 2RTDB 4Z2PA 1HQPA 1STPA 4LKPA 1NP4A 1LCZA 2OFAA 3RDMA 1VWNB 2YMSA 4ZHDA 4O9SA 1MUPA 1MM9A 2JU3A 2Q4NA 4YDAA 1DZMA 1BSQA 3C76X 2AT3X 3MX7A 1PBYA 3FEKA 5LJDA 5EDBA 5EZ2A 1S44A 4YCEA 3FIQA 2HNXA 1EIIA 2M4LA 1X8QA 3B2HA 5F2BA 2OYBO 2OY7A 3STMX 3I17A 4BX6A 3MG5A 1OEEA 4EDEA 2FKJA 1SRJA 4ORYA 1S2PA 5B2AO 4AZMA 1NC9A 1SRFA 1SWNA 1DF3A 3VG4A 1TOUA 5FQ7E 2AH7X 4L3RA 3EBKA 3PQSA 4O3YA 3F9DA 1I78A 4FBOA 2WEWA 4QQ1A 3STNA 3VE1A 1B8EA 1Y53X 2W2AA 1VYFA 1Z24A 3FELA 4Y0PA 1R0UA 4NP1A 3WJFA 2Q9SA 1SWUA 3EYCA 3U0DA 3HPEA 2C4IA 1SLEB 3AKMA 3KVNA 4INNA 1A57A 1QFTA 1LPJA 2P8GA 4ALBA 2FKGA 2CBSA 3BY0A 3P6HA 4Y0RA 2POAA 2VDFA 3S5VA 4MVIA 2KTSA 3KZAA 4GUZA 4YGZA 3ZQ3A 2BLGA 2FS7A 4HWMA 1NDJA 2HYSA 2FR3A 4N7DA 3T2WA 1B0OA 1ZNLA 2QMIA 4ZHGA 5KIDA 1EPAA 3CBSA 2RTBB 3RBYA 4GZVA 1QY2A 4BVMA 4QZUA 1GX9A 3AUMO 1GX8A 1QFVA 3BSZE 3FIDA 2LA7A 4OKAA 1GKAB 3APUA 5EEEA 4BBOA 4I9SA 1OEJA 1QQSA 3OJYC 4QYPA 1OBQA 3JSQA 1JYJA 3FA8A 4BX7B 4YFRA 3VG6A 2IZBA 2CM9A 2IZDB 3BLGA 4NV7A 4CDFA 1O1VA 2NNQA 1DZPA 1H91A 1KT6A 1IIUA 3CQNA 4ON1A 1QY1A 4DNEA 3NQ3A 1RAVA 3WJBA 5HCDC 5KICA 4MVKA 4HPDA 2ZAGA 4EFGA 3D97A 1SWGA 3TF6A 1HMTA 2L9CA 1BSYA 2IFBA 1I04A 3FYFA 3L4RA 1VYGA 1EIOA 5IRUA 1HXZA 2IZLB 2VFBA 4ZGFA 1SXWA 1TVQA 1YWDA 2BSZA 2WQAE 3PH5A 3S5XA 4AW8A 1LCWA 2RTPB 3T6FA 3D4RA 2IZIA 2RCTA 3DTQA 2L68A 4MISA 4D6BA 1GKAA 1VWHB 3HOEA 1SWFA 2Y32A 1VWJB 2G78A 4IB9A 2AT5X 5JD2A 3TZSA 4ID2A 1SWHA 4BX7A 1DF8A 1VWRB 1FTPA 2AVIA 1JYDA 2DJFA 2K23A 2K62A 3ZZVA 1KL4A 2QO5A 1YWAA 1PEEA 1SRIA 4NLJA 5HBSA 5BVQA 2NNDA 2NNEA 5FENA 3WZOA 3HWEA 4GDZA 4U8UM 2Q39A 2QO6A 3P6CA 3Q6LA 4L1NA 4O4SA 1I9HA 1SWOA 1LIBA 2XKLA 1SRHA 3GE2A 1O1UA 2LBVA 1BEBA 2MM3A 3FA6A 3WVMA 2AT6X 1IKJA 1HMRA 2RTAA 3MM0A 4GNYA 1FJ1E 2IZAA 4YMYA 4ZH9A 5L8IA 1EALA 5B5GA 3G7XA 1JQPA 2LFOA 1BLRA 2A0AA 2MF6A 4PSQA 2MWHA 1L6MA 1VWIB 5IRAA 1NGLA 1AQBA 4CDDA 4CSBA 4GDAA 3NBXX 1CBRA 1XKIA 3BX8A 2FRSA 4OEMA 5DG4A 3TGAA 1N9MA 3VG2A 1LIFA 1Y9LA 1P6PA 2X32A 5AEOA 1STRB 2FR2A 4XMDA 3FA9A 1SWAA 3HOLA 4CPHB 2FHLA 2LKKA 1RSTB 3KQ0A 3NP1A 3VHMA 4CDEA 1KT5A 2HMBA 3EMMA 5K67A 1EUOA 1RXHA 1CBSA 1JBHA 4MVLA 1EQDA 1X8NA 4CPEA 1I05A 2Z4IA 1QG5A 3C77X 3RDOA 3RY1A 4GGRA 4AZNA 4IB6A 2FGSA 5LKEA 4I3DA 5HZ6A 1SY0A 1LDOA 4ODDA 3S60A 3RSWA 4NV8A 1GM6A 4IMNA 1Y52X 2JW1A 1E06A 2OVDA 4A60A 5CHKA 4GRJA 2OY5O 5F7GA 4ZFXA 1QY0A 1N43A 1T8VA 2RTHB 1W4TA 2FTBA 2RN4A 3WBGA 2KTDA 4CPHA 2BT9A 1SLDB 5B5FA 5LJEA 2MHDA 5C0NA 1HMSA 1PBOA 1SLFB 2R73A 3FR4A 1SWSA 4R0BA 5HZ8A 1JMZA 1AELA 5FAZA 1EI5A 2WSJA 4TLJA 1GT1A 5HTEA 2IZJA 3RDQA 3VHIA 1SA8A 1K24A 3B2KA 3OE3A 3ZUIA 1S7DA 4Y59A 3BDRA 3O22A 5F58A 1I06A 1YIVA 2AL0X 2WWPA 2X46A 5FFHA 4DQ3A 5H9LA 3PQUA 1SY1A 4ORXA 4I60A 5HZ5A 1SXYA 1VWAB 3RDSA 4IB7A 4YFQA 4M6SA 4ZR2A 3FDCA 1O8VA 1OPBA 1OSPO 4IRWA 4YVBA 5H8TA 1SWPA 1E00A 1KL3A 3ZUOA 4AYHA 3PK2A 1ACDA 1VWGB 4GGTA 2RTCB 3BX7A 1SLGB 3FEPA 1RXKA 2JMBA 2CAMA 4MVEA 5KHPA 1GGLA 1ZNHA 4I3BA 2C1SA 4AZRA 3CKFA 3SOTA 3SAOA 5IO5A 1DV9A 4IBAA 1VYOA 1IKEA 2OY8A 4BX5B 4QGVA 4YGHA 1SWTA 2BC3A 2OZQA 1JMXA 1SWDA 4NNSA 3VPJE 1LFOA 2AF5A 3PH6A 4U3QA 4LQZA 2OY1O 4YDBA 4ARHA 4WFUA 5B29A 4OS0A 5HTDA 1SWJA 3PEDA 4N7CA 3UEWA 1KXOA 5D47A 1PMPA 1LIDA 4WFVA 5HWZA 3SLOA 1KT3A 2NP1A 1GT3A 4LZUA 4GNWA 2AKQA 2GTFX 1UREA 1E02A 2QCBA 1SWQA 3FR5A 1AVEA 1W5RA 3RE6A 4JNJA 4YFPA 1QABE 1E5PA 2GJ5A 1IW2A 2GH7A 1SXUA 1VWQB 1VWDB 2X34A 3SLTA 4BJ8A 2Y3FA 4BGFA 4ZHCA 1YWCA 4Y0QA 2OVEA 4Z6JA
chains in the Genus database with same CATH topology
1RSUB 1NBXA 1VWLB 4GD9A 1I9HA 1MOYA 1NQMA 1RXJA 1SWOA 4JO6A 4BX5A 4BX6B 2IZFB 5K68A 1SRHA 2C1QA 2RTRB 3SZJA 3WYQA 2Y3EA 2RTAA 3MM0A 4GGZA 1VWOB 2A8GA 2IZAA 3EW2A 2RTIB 3RDUA 1KFFA 1VWBB 3WZQA 5B5GA 4JHQA 5IRWA 2RTDB 4Z2PA 1LCVA 1STPA 2MF6A 3RDMA 2OFAA 1LCZA 1VWIB 1STSB 1VWNB 2RTEB 5IRAA 3WZPA 1SWBA 2RTMA 2FHNX 1KL5A 4GDAA 1MM9A 1N9MA 1NQNA 2RTQB 4GJVA 1STRB 1PTSA 2A5CA 4Z6JA 1SWAA 5F2BA 4CPHB 4BX6A 2FHLA 1RSTB 3MG5A 2ZSCA 1SWCA 2RTJA 3VHMA 3X00A 1SRJA 4CPFA 5K67A 1SWKA 1RXHA 1NC9A 2RTNB 4CPEA 4BCSA 1SRFA 4U46A 3RDOA 1MEPA 1SWNA 1AVDA 1N7YA 3RY1A 4GGRA 4CPIA 1Y55X 1LDOA 1Y53X 4Z28A 1SWUA 1Y52X 1VWMB 2C4IA 1SLEB 3VHHA 3RDXA 1SRGA 5CHKA 1VWCB 3SZIA 5CSEA 1N43A 1VWKB 2RTGB 2RTHB 1SREA 5B5FA 4Y5DA 4CPHA 1SLDB 4Z2VA 1MK5A 1SWLA 1SLFB 1HXLA 1SWSA 1HY2A 4GJSA 3WZNA 3VHIA 1NDJA 2IZJA 2OF9A 3RDQA 2IZCB 4Y59A 3T2WA 2RTFB 1N4JA 2RTBB 3RY2A 2G5LA 2IZGB 4OKAA 4Z27A 4BBOA 4I60A 1VWAB 5L3YA 2F01A 3RDSA 4BX7B 3FDCA 2A5BA 1LUQA 4IRWA 2IZBA 1IJ8A 2IZDB 4YVBA 1SWPA 1KL3A 4DNEA 2RTKA 3PK2A 4GGTA 1VWGB 3SZHA 1RAVA 3RE5A 1VWPB 4Z2OA 1VWEB 2RTCB 1SLGB 1RXKA 2JGSA 2CAMA 1SWGA 2C1SA 1LDQA 1N9YA 2IZHB 1VYOA 2UYWA 1HXZA 2IZLB 5IRUA 4BX5B 3T2XA 1SWTA 2BC3A 1SWDA 2RTLA 3T6FA 3EW1A 1VWFB 1LCWA 2RTPB 2IZIA 2RTOB 1SWJA 1VWHB 1SWFA 2Y32A 1VWJB 5JD2A 2WPUA 3T6LA 1LELA 1SWHA 4BX7A 1DF8A 1VWRB 2AVIA 3WYPA 1KL4A 2OFBA 1SRIA 2QCBA 1SWQA 1AVEA 3RE6A 2OF8A 4EKVA 2IZKA 3WZOA 4JNJA 1SWRA 2GH7A 3VGWA 1VWQB 1VWDB 1HQQA 2IZEB 2UZ2A 1WBIA 2Y3FA 4BJ8A 1SWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RSU B;  1NBX A;  1VWL B;  4GD9 A;  1I9H A;  1MOY A;  1NQM A;  1RXJ A;  1SWO A;  4JO6 A;  4BX5 A;  4BX6 B;  2IZF B;  5K68 A;  1SRH A;  2C1Q A;  2RTR B;  3SZJ A;  3WYQ A;  2Y3E A;  2RTA A;  3MM0 A;  4GGZ A;  1VWO B;  2A8G A;  2IZA A;  3EW2 A;  2RTI B;  3RDU A;  1KFF A;  1VWB B;  3WZQ A;  5B5G A;  4JHQ A;  5IRW A;  2RTD B;  4Z2P A;  1LCV A;  1STP A;  2MF6 A;  3RDM A;  2OFA A;  1LCZ A;  1VWI B;  1STS B;  1VWN B;  2RTE B;  5IRA A;  3WZP A;  1SWB A;  2RTM A;  2FHN X;  1KL5 A;  4GDA A;  1MM9 A;  1N9M A;  1NQN A;  2RTQ B;  4GJV A;  1STR B;  1PTS A;  2A5C A;  4Z6J A;  1SWA A;  5F2B A;  4CPH B;  4BX6 A;  2FHL A;  1RST B;  3MG5 A;  2ZSC A;  1SWC A;  2RTJ A;  3VHM A;  3X00 A;  1SRJ A;  4CPF A;  5K67 A;  1SWK A;  1RXH A;  1NC9 A;  2RTN B;  4CPE A;  4BCS A;  1SRF A;  4U46 A;  3RDO A;  1MEP A;  1SWN A;  1AVD A;  1N7Y A;  3RY1 A;  4GGR A;  4CPI A;  1Y55 X;  1LDO A;  1Y53 X;  4Z28 A;  1SWU A;  1Y52 X;  1VWM B;  2C4I A;  1SLE B;  3VHH A;  3RDX A;  1SRG A;  5CHK A;  1VWC B;  3SZI A;  5CSE A;  1N43 A;  1VWK B;  2RTG B;  2RTH B;  1SRE A;  5B5F A;  4Y5D A;  4CPH A;  1SLD B;  4Z2V A;  1MK5 A;  1SWL A;  1SLF B;  1HXL A;  1SWS A;  1HY2 A;  4GJS A;  3WZN A;  3VHI A;  1NDJ A;  2IZJ A;  2OF9 A;  3RDQ A;  2IZC B;  4Y59 A;  3T2W A;  2RTF B;  1N4J A;  2RTB B;  3RY2 A;  2G5L A;  2IZG B;  4OKA A;  4Z27 A;  4BBO A;  4I60 A;  1VWA B;  5L3Y A;  2F01 A;  3RDS A;  4BX7 B;  3FDC A;  2A5B A;  1LUQ A;  4IRW A;  2IZB A;  1IJ8 A;  2IZD B;  4YVB A;  1SWP A;  1KL3 A;  4DNE A;  2RTK A;  3PK2 A;  4GGT A;  1VWG B;  3SZH A;  1RAV A;  3RE5 A;  1VWP B;  4Z2O A;  1VWE B;  2RTC B;  1SLG B;  1RXK A;  2JGS A;  2CAM A;  1SWG A;  2C1S A;  1LDQ A;  1N9Y A;  2IZH B;  1VYO A;  2UYW A;  1HXZ A;  2IZL B;  5IRU A;  4BX5 B;  3T2X A;  1SWT A;  2BC3 A;  1SWD A;  2RTL A;  3T6F A;  3EW1 A;  1VWF B;  1LCW A;  2RTP B;  2IZI A;  2RTO B;  1SWJ A;  1VWH B;  1SWF A;  2Y32 A;  1VWJ B;  5JD2 A;  2WPU A;  3T6L A;  1LEL A;  1SWH A;  4BX7 A;  1DF8 A;  1VWR B;  2AVI A;  3WYP A;  1KL4 A;  2OFB A;  1SRI A;  2QCB A;  1SWQ A;  1AVE A;  3RE6 A;  2OF8 A;  4EKV A;  2IZK A;  3WZO A;  4JNJ A;  1SWR A;  2GH7 A;  3VGW A;  1VWQ B;  1VWD B;  1HQQ A;  2IZE B;  2UZ2 A;  1WBI A;  2Y3F A;  4BJ8 A;  1SWE A; 
#chains in the Genus database with same CATH topology
 1X8U A;  1NBX A;  4ALO A;  3P02 A;  4HPA A;  1MOY A;  1NQM A;  2AMM X;  2MO5 A;  4BX5 A;  5HA1 A;  3QQ2 A;  2OL7 A;  2GTL M;  4RUU A;  5F6B A;  3TGC A;  1Y9T A;  3D9W A;  1CBQ A;  2JN3 A;  2C1Q A;  2BS6 A;  3BRN A;  3EBW A;  3FMZ A;  3MVF A;  3K3L A;  1BBP A;  2FWV A;  4CV7 A;  1VWO B;  2RD7 C;  3RDU A;  3WZQ A;  2W2B A;  2OVS A;  4GET A;  1OEK A;  1LCV A;  4A1Y A;  1ML7 A;  4A1H A;  3KFG A;  1LIE A;  2RTE B;  1IFC A;  2RA6 A;  3WZP A;  4CDC A;  3EM0 A;  1SWB A;  2RTM A;  3TGB A;  1TOW A;  4XMC A;  3V8U A;  3BU1 A;  3KFH A;  2RTQ B;  4GJV A;  3WJD A;  5CE4 A;  1LF7 A;  2QOM A;  4GH7 A;  5HCE C;  1PTS A;  4JGL A;  1KT7 A;  4M7M A;  5BYP A;  5HCC C;  2FT9 A;  1U0X A;  4TJZ A;  3P6D A;  1VPR A;  1SWC A;  2ZSC A;  3P6E A;  2G7B A;  4QAE A;  1NP1 A;  2YG2 A;  1SMP I;  4XMG A;  1SWK A;  1EW3 A;  1B4M A;  2RTN B;  3APV A;  4BCS A;  1JJX A;  1KT4 A;  4FQB B;  2LBA A;  1N7Y A;  2ALL X;  4QZT A;  3RKG A;  4EXZ A;  5IO7 A;  3HK1 A;  4YCH A;  3SLJ A;  1A18 A;  1ALB A;  1Y55 X;  5H9K A;  1CBI A;  1CRB A;  1G5W A;  4NNT A;  5AJC A;  3NR3 A;  5F6Z A;  1LNM A;  2W2F A;  4O4O A;  2QO4 A;  1D3S A;  2G8C O;  2RCQ A;  1VWM B;  1G74 A;  2X56 A;  4I3C A;  3VHH A;  1N0S A;  3SZI A;  5IO6 A;  2Z4H A;  2A2U A;  4ZGU A;  1VWK B;  2KD2 A;  2RTG B;  2A13 A;  4TKH A;  1KGL A;  1FE3 A;  2OL8 O;  4Y5D A;  1UYO X;  4DQ4 A;  3WJG A;  1RLB E;  3JS1 A;  3CWK A;  4Z2V A;  2PI3 O;  2ANS A;  2FS6 A;  1HXL A;  4QGW A;  3LV4 A;  5LJH A;  2BHV A;  3IFB A;  3FR2 A;  4GJS A;  3WZN A;  4OS3 A;  1X89 A;  1JZU A;  4I95 A;  2OF9 A;  3WJC A;  4O3X B;  1FEM A;  1OPA A;  2MJI A;  4NLI A;  3P6F A;  3D96 A;  1T0V A;  3PPT A;  5L8N A;  2JU8 A;  2X55 A;  2ASN X;  3F6Z B;  1YP7 A;  2OL6 O;  2GTL N;  2IZG B;  3CKG A;  1DC9 A;  2JOZ A;  3OD9 A;  5JR8 A;  3NAD A;  1AVG I;  1OBP A;  2ZAI A;  5K06 A;  1LIC A;  2F01 A;  4XMH A;  4EEJ A;  4KT5 A;  1KQX A;  3H3I A;  3ZW0 B;  2A5B A;  1IJ8 A;  5H9N A;  1GT4 A;  2DJG A;  2F73 A;  3BS2 A;  3ZWE A;  4ES7 A;  4AZO A;  1TW4 A;  5F1E A;  2RTK A;  4WHI A;  1ADL A;  1VWP B;  2FLJ A;  5L8O A;  4YH0 A;  2L67 A;  1ZNG A;  3C78 X;  4FGI B;  2AT0 X;  2HKD A;  2I5V O;  1LDQ A;  1N9Y A;  3P24 A;  1HN2 A;  4GU8 A;  2IZH B;  3PDF A;  4O3Z A;  5D8J A;  4A8Z A;  1ZNK A;  5EDC A;  3CMP A;  2RTL A;  1VWF B;  3CQR A;  3FW5 A;  2X8T A;  4U8U N;  4MEE A;  1MX7 A;  3WXQ A;  4KC8 A;  1KQW A;  4D6A A;  2RTO B;  1X71 A;  3D95 A;  3PP6 A;  3NX2 A;  1TXL A;  1X8P A;  4HPB A;  1ERX A;  2AT8 X;  4WBK A;  4YBU A;  1SY3 A;  4ZHF A;  5HZQ A;  3ZW1 B;  2N93 A;  1CJ5 A;  1LEL A;  3ELZ A;  1U18 A;  4O4U A;  2LB6 A;  5B27 A;  2G79 A;  1UYN X;  3ZW0 A;  3LTW A;  4LZV A;  1BRP A;  2R74 A;  5EED A;  2O62 A;  2OF8 A;  3CBC A;  4YKM A;  1SWR A;  4ORR A;  3NQK A;  4BQU A;  2KW1 A;  1LKE A;  3FW4 A;  1EPB A;  5FQ8 E;  1QWD A;  2UZ2 A;  1WBI A;  2HLV A;  4TKB A;  1SWE A;  3FEN A;  1DZJ A;  1RSU B;  4FBR A;  1VWL B;  2QOS C;  4JO6 A;  4TQ2 A;  4COT A;  1GX3 A;  5H9A A;  2X8F A;  2RTR B;  2HZR A;  5AJB A;  3WYQ A;  1JIW I;  2Y3E A;  4ZCB A;  2OFM X;  1BSO A;  3U9P C;  1MVG A;  2A8G A;  1XCA A;  3P6G A;  2RTI B;  4EQA C;  1KFF A;  1VWB B;  1YP6 A;  2Q2P A;  4TNN A;  1HBP A;  4JHQ A;  2CM4 A;  3WJE A;  1GXA A;  3ZW1 A;  3B2J A;  5IRW A;  3HWD A;  4XMF A;  1STS B;  1A3Y A;  3LHN A;  5DPQ A;  3O2Y A;  5IXG A;  4O49 A;  2FHN X;  1KL5 A;  1Y0G A;  5CYB A;  3UEV A;  2X45 A;  4ZH6 A;  3CR6 A;  1JJJ A;  1JV4 A;  1OBU A;  1NQN A;  2F09 A;  4C5P A;  2JU7 A;  5B10 O;  1A2D A;  4OMX A;  3STK A;  2CZT A;  1SXX A;  2A5C A;  2WQ9 A;  5D45 A;  2GTL O;  1U17 A;  2CBR A;  2RTJ A;  1RBP A;  5D4A A;  3X00 A;  5FQ6 E;  4GK9 A;  1FEN A;  4CPF A;  4QGX A;  4QRL A;  5HZ9 A;  1AB0 A;  1I4U A;  3GAQ A;  1MDC A;  2E4J A;  1MEP A;  3APX A;  4GKC A;  1AVD A;  4U46 A;  4ZJ0 A;  4AZP A;  4KH8 A;  4CPI A;  4IAX A;  1G7N A;  4I6S A;  4NYQ A;  1WUB A;  3B2I A;  1G85 A;  3JQO A;  1YUP A;  1ICM A;  3OBL A;  1T68 X;  4I9R A;  2QM9 A;  1HBQ A;  4PJ2 A;  5HA0 A;  4Z28 A;  1X8O A;  2X8S A;  4LKT A;  3S26 A;  4UU3 A;  1ZND A;  1SRG A;  4O4X A;  1VWC B;  3F8A A;  3RDX A;  4B55 A;  5CSE A;  5LJK A;  2KT4 B;  3E3C A;  3N91 A;  5BVS A;  1E2T A;  4HFO A;  1SRE A;  4U8U O;  2WR6 A;  4CK4 A;  1YWB A;  3T1D A;  4MIR A;  2HZQ A;  1MK5 A;  4ORW A;  3FA7 A;  1K3B A;  4QYN A;  1SWL A;  4ORU A;  5B3M O;  4ML7 B;  3RZY A;  3U03 A;  1DFV A;  3RWX A;  5D48 A;  2CZU A;  1HY2 A;  2OVA A;  4KII A;  2ACP X;  1KZX A;  2WUT A;  5LKF A;  1ICN A;  1UZ2 X;  3BU9 A;  4K19 A;  2IZC B;  4GE1 A;  1IFB A;  2RTF B;  1N4J A;  5BVT A;  2XST A;  3RY2 A;  2G5L A;  5B11 O;  4YKO A;  5LJC A;  3NX1 A;  4Z27 A;  2RQ0 A;  3ZI8 A;  3UEU A;  5L3Y A;  1DZK A;  3WOV A;  3I0A A;  4U9C A;  5EPQ A;  3AKN A;  4O3W A;  1LUQ A;  1JJU A;  1FEL A;  3HWG A;  3Q34 A;  3EC5 A;  3VG7 A;  2I5Z O;  4AZQ A;  4YGG A;  3IA8 A;  3RE5 A;  4ZHH A;  4Z2O A;  3APW A;  1VWE B;  2JGS A;  1MX8 A;  3KFI A;  4XME A;  5LJB A;  2R56 A;  3O19 A;  4Y0S A;  2A2G A;  1PM1 X;  2X4M A;  2UYW A;  3FLL A;  3VG3 A;  2VFC A;  3ELX A;  4NW4 A;  4DCB A;  3T2X A;  4KCA A;  4TKJ A;  2OFR X;  1KZW A;  3EW1 A;  4UU2 A;  3VE2 A;  5HAE A;  3MBT A;  4RUN A;  1W6F A;  4IMO A;  1ZNE A;  4IAB A;  4KC7 A;  5LJG A;  4ORS A;  1SY2 A;  3HTY A;  2WPU A;  3T6L A;  3VU1 A;  3NQ9 A;  3B2L A;  4OS8 A;  2BS5 A;  1D2U A;  4HPC A;  4IB8 A;  3WYP A;  1GT5 A;  3NPO A;  2OFB A;  3VG5 A;  4BOE A;  4EKV A;  2IZK A;  1BJ7 A;  4OEL A;  1FDQ A;  3DSZ A;  4NYR A;  3HWF A;  3VGW A;  1HQQ A;  1EXS A;  2IZE B;  1B56 A;  4FBV A;  2A3F X;  2ACO A;  4QNI A;  2PY1 A;  1KOI A;  5AQ6 A;  4GD9 A;  1BRQ A;  3AEH A;  1BWY A;  1RXJ A;  4BX6 B;  2DM5 A;  4YBP A;  1ERB A;  2Q2M A;  2IZF B;  2EU7 X;  1ZRY A;  5K68 A;  4OMW A;  3ZW2 A;  3SZJ A;  3PEC A;  3SZH A;  4GGZ A;  3UAQ A;  3EW2 A;  2WEX A;  3QKG A;  2L5P A;  3UEX A;  4IAW A;  1BM5 A;  3KFF A;  2GC9 A;  2RTD B;  4Z2P A;  1HQP A;  1STP A;  4LKP A;  1NP4 A;  1LCZ A;  2OFA A;  3RDM A;  1VWN B;  2YMS A;  4ZHD A;  4O9S A;  1MUP A;  1MM9 A;  2JU3 A;  2Q4N A;  4YDA A;  1DZM A;  1BSQ A;  3C76 X;  2AT3 X;  3MX7 A;  1PBY A;  3FEK A;  5LJD A;  5EDB A;  5EZ2 A;  1S44 A;  4YCE A;  3FIQ A;  2HNX A;  1EII A;  2M4L A;  1X8Q A;  3B2H A;  5F2B A;  2OYB O;  2OY7 A;  3STM X;  3I17 A;  4BX6 A;  3MG5 A;  1OEE A;  4EDE A;  2FKJ A;  1SRJ A;  4ORY A;  1S2P A;  5B2A O;  4AZM A;  1NC9 A;  1SRF A;  1SWN A;  1DF3 A;  3VG4 A;  1TOU A;  5FQ7 E;  2AH7 X;  4L3R A;  3EBK A;  3PQS A;  4O3Y A;  3F9D A;  1I78 A;  4FBO A;  2WEW A;  4QQ1 A;  3STN A;  3VE1 A;  1B8E A;  1Y53 X;  2W2A A;  1VYF A;  1Z24 A;  3FEL A;  4Y0P A;  1R0U A;  4NP1 A;  3WJF A;  2Q9S A;  1SWU A;  3EYC A;  3U0D A;  3HPE A;  2C4I A;  1SLE B;  3AKM A;  3KVN A;  4INN A;  1A57 A;  1QFT A;  1LPJ A;  2P8G A;  4ALB A;  2FKG A;  2CBS A;  3BY0 A;  3P6H A;  4Y0R A;  2POA A;  2VDF A;  3S5V A;  4MVI A;  2KTS A;  3KZA A;  4GUZ A;  4YGZ A;  3ZQ3 A;  2BLG A;  2FS7 A;  4HWM A;  1NDJ A;  2HYS A;  2FR3 A;  4N7D A;  3T2W A;  1B0O A;  1ZNL A;  2QMI A;  4ZHG A;  5KID A;  1EPA A;  3CBS A;  2RTB B;  3RBY A;  4GZV A;  1QY2 A;  4BVM A;  4QZU A;  1GX9 A;  3AUM O;  1GX8 A;  1QFV A;  3BSZ E;  3FID A;  2LA7 A;  4OKA A;  1GKA B;  3APU A;  5EEE A;  4BBO A;  4I9S A;  1OEJ A;  1QQS A;  3OJY C;  4QYP A;  1OBQ A;  3JSQ A;  1JYJ A;  3FA8 A;  4BX7 B;  4YFR A;  3VG6 A;  2IZB A;  2CM9 A;  2IZD B;  3BLG A;  4NV7 A;  4CDF A;  1O1V A;  2NNQ A;  1DZP A;  1H91 A;  1KT6 A;  1IIU A;  3CQN A;  4ON1 A;  1QY1 A;  4DNE A;  3NQ3 A;  1RAV A;  3WJB A;  5HCD C;  5KIC A;  4MVK A;  4HPD A;  2ZAG A;  4EFG A;  3D97 A;  1SWG A;  3TF6 A;  1HMT A;  2L9C A;  1BSY A;  2IFB A;  1I04 A;  3FYF A;  3L4R A;  1VYG A;  1EIO A;  5IRU A;  1HXZ A;  2IZL B;  2VFB A;  4ZGF A;  1SXW A;  1TVQ A;  1YWD A;  2BSZ A;  2WQA E;  3PH5 A;  3S5X A;  4AW8 A;  1LCW A;  2RTP B;  3T6F A;  3D4R A;  2IZI A;  2RCT A;  3DTQ A;  2L68 A;  4MIS A;  4D6B A;  1GKA A;  1VWH B;  3HOE A;  1SWF A;  2Y32 A;  1VWJ B;  2G78 A;  4IB9 A;  2AT5 X;  5JD2 A;  3TZS A;  4ID2 A;  1SWH A;  4BX7 A;  1DF8 A;  1VWR B;  1FTP A;  2AVI A;  1JYD A;  2DJF A;  2K23 A;  2K62 A;  3ZZV A;  1KL4 A;  2QO5 A;  1YWA A;  1PEE A;  1SRI A;  4NLJ A;  5HBS A;  5BVQ A;  2NND A;  2NNE A;  5FEN A;  3WZO A;  3HWE A;  4GDZ A;  4U8U M;  2Q39 A;  2QO6 A;  3P6C A;  3Q6L A;  4L1N A;  4O4S A;  1I9H A;  1SWO A;  1LIB A;  2XKL A;  1SRH A;  3GE2 A;  1O1U A;  2LBV A;  1BEB A;  2MM3 A;  3FA6 A;  3WVM A;  2AT6 X;  1IKJ A;  1HMR A;  2RTA A;  3MM0 A;  4GNY A;  1FJ1 E;  2IZA A;  4YMY A;  4ZH9 A;  5L8I A;  1EAL A;  5B5G A;  3G7X A;  1JQP A;  2LFO A;  1BLR A;  2A0A A;  2MF6 A;  4PSQ A;  2MWH A;  1L6M A;  1VWI B;  5IRA A;  1NGL A;  1AQB A;  4CDD A;  4CSB A;  4GDA A;  3NBX X;  1CBR A;  1XKI A;  3BX8 A;  2FRS A;  4OEM A;  5DG4 A;  3TGA A;  1N9M A;  3VG2 A;  1LIF A;  1Y9L A;  1P6P A;  2X32 A;  5AEO A;  1STR B;  2FR2 A;  4XMD A;  3FA9 A;  1SWA A;  3HOL A;  4CPH B;  2FHL A;  2LKK A;  1RST B;  3KQ0 A;  3NP1 A;  3VHM A;  4CDE A;  1KT5 A;  2HMB A;  3EMM A;  5K67 A;  1EUO A;  1RXH A;  1CBS A;  1JBH A;  4MVL A;  1EQD A;  1X8N A;  4CPE A;  1I05 A;  2Z4I A;  1QG5 A;  3C77 X;  3RDO A;  3RY1 A;  4GGR A;  4AZN A;  4IB6 A;  2FGS A;  5LKE A;  4I3D A;  5HZ6 A;  1SY0 A;  1LDO A;  4ODD A;  3S60 A;  3RSW A;  4NV8 A;  1GM6 A;  4IMN A;  1Y52 X;  2JW1 A;  1E06 A;  2OVD A;  4A60 A;  5CHK A;  4GRJ A;  2OY5 O;  5F7G A;  4ZFX A;  1QY0 A;  1N43 A;  1T8V A;  2RTH B;  1W4T A;  2FTB A;  2RN4 A;  3WBG A;  2KTD A;  4CPH A;  2BT9 A;  1SLD B;  5B5F A;  5LJE A;  2MHD A;  5C0N A;  1HMS A;  1PBO A;  1SLF B;  2R73 A;  3FR4 A;  1SWS A;  4R0B A;  5HZ8 A;  1JMZ A;  1AEL A;  5FAZ A;  1EI5 A;  2WSJ A;  4TLJ A;  1GT1 A;  5HTE A;  2IZJ A;  3RDQ A;  3VHI A;  1SA8 A;  1K24 A;  3B2K A;  3OE3 A;  3ZUI A;  1S7D A;  4Y59 A;  3BDR A;  3O22 A;  5F58 A;  1I06 A;  1YIV A;  2AL0 X;  2WWP A;  2X46 A;  5FFH A;  4DQ3 A;  5H9L A;  3PQU A;  1SY1 A;  4ORX A;  4I60 A;  5HZ5 A;  1SXY A;  1VWA B;  3RDS A;  4IB7 A;  4YFQ A;  4M6S A;  4ZR2 A;  3FDC A;  1O8V A;  1OPB A;  1OSP O;  4IRW A;  4YVB A;  5H8T A;  1SWP A;  1E00 A;  1KL3 A;  3ZUO A;  4AYH A;  3PK2 A;  1ACD A;  1VWG B;  4GGT A;  2RTC B;  3BX7 A;  1SLG B;  3FEP A;  1RXK A;  2JMB A;  2CAM A;  4MVE A;  5KHP A;  1GGL A;  1ZNH A;  4I3B A;  2C1S A;  4AZR A;  3CKF A;  3SOT A;  3SAO A;  5IO5 A;  1DV9 A;  4IBA A;  1VYO A;  1IKE A;  2OY8 A;  4BX5 B;  4QGV A;  4YGH A;  1SWT A;  2BC3 A;  2OZQ A;  1JMX A;  1SWD A;  4NNS A;  3VPJ E;  1LFO A;  2AF5 A;  3PH6 A;  4U3Q A;  4LQZ A;  2OY1 O;  4YDB A;  4ARH A;  4WFU A;  5B29 A;  4OS0 A;  5HTD A;  1SWJ A;  3PED A;  4N7C A;  3UEW A;  1KXO A;  5D47 A;  1PMP A;  1LID A;  4WFV A;  5HWZ A;  3SLO A;  1KT3 A;  2NP1 A;  1GT3 A;  4LZU A;  4GNW A;  2AKQ A;  2GTF X;  1URE A;  1E02 A;  2QCB A;  1SWQ A;  3FR5 A;  1AVE A;  1W5R A;  3RE6 A;  4JNJ A;  4YFP A;  1QAB E;  1E5P A;  2GJ5 A;  1IW2 A;  2GH7 A;  1SXU A;  1VWQ B;  1VWD B;  2X34 A;  3SLT A;  4BJ8 A;  2Y3F A;  4BGF A;  4ZHC A;  1YWC A;  4Y0Q A;  2OVE A;  4Z6J A; 
#chains in the Genus database with same CATH homology
 1RSU B;  1NBX A;  1VWL B;  4GD9 A;  1I9H A;  1MOY A;  1NQM A;  1RXJ A;  1SWO A;  4JO6 A;  4BX5 A;  4BX6 B;  2IZF B;  5K68 A;  1SRH A;  2C1Q A;  2RTR B;  3SZJ A;  3WYQ A;  2Y3E A;  2RTA A;  3MM0 A;  4GGZ A;  1VWO B;  2A8G A;  2IZA A;  3EW2 A;  2RTI B;  3RDU A;  1KFF A;  1VWB B;  3WZQ A;  5B5G A;  4JHQ A;  5IRW A;  2RTD B;  4Z2P A;  1LCV A;  1STP A;  2MF6 A;  3RDM A;  2OFA A;  1LCZ A;  1VWI B;  1STS B;  1VWN B;  2RTE B;  5IRA A;  3WZP A;  1SWB A;  2RTM A;  2FHN X;  1KL5 A;  4GDA A;  1MM9 A;  1N9M A;  1NQN A;  2RTQ B;  4GJV A;  1STR B;  1PTS A;  2A5C A;  4Z6J A;  1SWA A;  5F2B A;  4CPH B;  4BX6 A;  2FHL A;  1RST B;  3MG5 A;  2ZSC A;  1SWC A;  2RTJ A;  3VHM A;  3X00 A;  1SRJ A;  4CPF A;  5K67 A;  1SWK A;  1RXH A;  1NC9 A;  2RTN B;  4CPE A;  4BCS A;  1SRF A;  4U46 A;  3RDO A;  1MEP A;  1SWN A;  1AVD A;  1N7Y A;  3RY1 A;  4GGR A;  4CPI A;  1Y55 X;  1LDO A;  1Y53 X;  4Z28 A;  1SWU A;  1Y52 X;  1VWM B;  2C4I A;  1SLE B;  3VHH A;  3RDX A;  1SRG A;  5CHK A;  1VWC B;  3SZI A;  5CSE A;  1N43 A;  1VWK B;  2RTG B;  2RTH B;  1SRE A;  5B5F A;  4Y5D A;  4CPH A;  1SLD B;  4Z2V A;  1MK5 A;  1SWL A;  1SLF B;  1HXL A;  1SWS A;  1HY2 A;  4GJS A;  3WZN A;  3VHI A;  1NDJ A;  2IZJ A;  2OF9 A;  3RDQ A;  2IZC B;  4Y59 A;  3T2W A;  2RTF B;  1N4J A;  2RTB B;  3RY2 A;  2G5L A;  2IZG B;  4OKA A;  4Z27 A;  4BBO A;  4I60 A;  1VWA B;  5L3Y A;  2F01 A;  3RDS A;  4BX7 B;  3FDC A;  2A5B A;  1LUQ A;  4IRW A;  2IZB A;  1IJ8 A;  2IZD B;  4YVB A;  1SWP A;  1KL3 A;  4DNE A;  2RTK A;  3PK2 A;  4GGT A;  1VWG B;  3SZH A;  1RAV A;  3RE5 A;  1VWP B;  4Z2O A;  1VWE B;  2RTC B;  1SLG B;  1RXK A;  2JGS A;  2CAM A;  1SWG A;  2C1S A;  1LDQ A;  1N9Y A;  2IZH B;  1VYO A;  2UYW A;  1HXZ A;  2IZL B;  5IRU A;  4BX5 B;  3T2X A;  1SWT A;  2BC3 A;  1SWD A;  2RTL A;  3T6F A;  3EW1 A;  1VWF B;  1LCW A;  2RTP B;  2IZI A;  2RTO B;  1SWJ A;  1VWH B;  1SWF A;  2Y32 A;  1VWJ B;  5JD2 A;  2WPU A;  3T6L A;  1LEL A;  1SWH A;  4BX7 A;  1DF8 A;  1VWR B;  2AVI A;  3WYP A;  1KL4 A;  2OFB A;  1SRI A;  2QCB A;  1SWQ A;  1AVE A;  3RE6 A;  2OF8 A;  4EKV A;  2IZK A;  3WZO A;  4JNJ A;  1SWR A;  2GH7 A;  3VGW A;  1VWQ B;  1VWD B;  1HQQ A;  2IZE B;  2UZ2 A;  1WBI A;  2Y3F A;  4BJ8 A;  1SWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...