5HZ9A

Human fabp3 in complex with 6-chloro-2-methyl-4-phenyl-quinoline-3-carboxylic acid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
135
structure length
135
Chain Sequence
SHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Fatty acid-binding protein, heart
publication title Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5hz9A00
5HBSA 4XMDA 1CBSA 5B29A 2HNXA 2DM5A 1CRBA 5B27A 2OVAA 3PEDA 2WEXA 5BVQA 2MJIA 4GE1A 3TGCA 1ADLA 3WVMA 1T0VA 1DZKA 1VYGA 3DTQA 1CBQA 3NP1A 1GX8A 3P6FA 2MO5A 1A57A 1R0UA 2BLGA 3AKMA 5HTDA 4TLJA 3MBTA 5F6BA 4NYQA 2HLVA 2R56A 4YBPA 3BS2A 4IBAA 2AL0X 5HWZA 1AELA 2PY1A 1PMPA 3WJBA 3Q6LA 4A1YA 1LFOA 3EBWA 4AZOA 1XCAA 2WQAE 1OBQA 3WBGA 3C78X 1S7DA 2Q2PA 4HPCA 1HBQA 1FTPA 5D47A 5L8IA 1QFTA 3P6CA 2O62A 5LJKA 1O1UA 4GNWA 4GETA 2JU7A 4OS0A 4Y0QA 3HWEA 2A13A 3BY0A 4IMNA 5HZQA 2WSJA 1JZUA 5HAEA 1S2PA 2AT0X 1KT3A 1B4MA 2ANSA 2CZUA 1TOWA 3CBCA 1DZMA 1L6MA 1BRPA 2X45A 2JU8A 3P6EA 2AT5X 1YIVA 5FFHA 1E5PA 4WFUA 1LPJA 3U0DA 4TKJA 1B0OA 4ZH6A 3APXA 1RBPA 3FEKA 1D3SA 1B8EA 4ORRA 1EIIA 3C77X 4DQ3A 1A2DA 2EU7X 2MM3A 1LIFA 4HPBA 4LKTA 5KHPA 4YMYA 5LJCA 3C76X 5EDBA 3CWKA 3TGBA 1CBRA 1TOUA 2AT3X 1DV9A 1S44A 1X71A 2QO5A 1X8PA 3F9DA 1LF7A 1QFVA 3WXQA 4ODDA 4NNSA 2FR3A 1GT3A 1BEBA 2NNEA 4ORYA 1GT5A 1TVQA 4YCEA 2Q4NA 1MDCA 2JOZA 1SA8A 1EPAA 1G7NA 4HPAA 3STKA 1OEEA 3APVA 4NYRA 1X8UA 1A18A 1FELA 3JS1A 3FA6A 2R74A 1MVGA 1GT1A 3MVFA 3F8AA 4XMCA 2HMBA 2L68A 4IB8A 5L8OA 3CQNA 1ALBA 3PP6A 1HN2A 5F7GA 5F1EA 1NP4A 4YKMA 4CK4A 3JSQA 4ORSA 4BQUA 4YKOA 4I3CA 4K19A 3SAOA 5LJEA 1OEKA 1ERXA 2HZRA 4NP1A 2ACPX 2OFRX 3BDRA 5D8JA 5H9LA 3UEXA 3STNA 2LKKA 4TKBA 1FDQA 1KQXA 1BSOA 4RUNA 2K23A 4QGXA 1T8VA 1O1VA 1E02A 5JR8A 5LKEA 5DPQA 4XMFA 5LJDA 5F6ZA 2Q9SA 1ACDA 5H9AA 1N0SA 5K06A 1VYFA 2GC9A 1ZNLA 2F73A 4AZRA 4YDAA 2CM9A 2CBRA 3NQ3A 4YFQA 1QY2A 4AZMA 4TJZA 1BRQA 2L9CA 4ZJ0A 2ALLX 5LJBA 3HWFA 3NR3A 2NNQA 3KFGA 5DG4A 2OVDA 1SXYA 3DSZA 3EYCA 3BU9A 4UU2A 3APUA 5AQ6A 1KT4A 1ERBA 4A8ZA 1ICMA 2G7BA 2KTDA 4YH0A 2OVEA 2G79A 2LFOA 5D45A 1RLBE 3PH5A 2AT8X 3VG6A 1I05A 2WEWA 3P6HA 2L67A 3QKGA 3T1DA 1XKIA 2A3FX 1X8NA 3WJFA 5HCEC 2G78A 1IIUA 3KQ0A 3UEUA 4ZHDA 1JV4A 5EZ2A 3FW5A 1G85A 3VG5A 2AH7X 1ZRYA 1E06A 1SXXA 4NNTA 3FLLA 4UU3A 1KXOA 2A0AA 4RUUA 2QOSC 1B56A 1OPBA 4I3BA 4BVMA 3L4RA 1DZPA 1QY1A 4IB7A 2W2BA 1PEEA 4LKPA 3BX8A 1QWDA 2YG2A 2RCTA 3IA8A 4AW8A 1AVGI 3CMPA 1JBHA 3PH6A 1FE3A 3FA7A 1OBPA 3VG7A 5D48A 5HCCC 1LNMA 3B2HA 4N7CA 2P8GA 4GH7A 3FENA 2A2UA 3TF6A 2W2AA 1IFCA 4IB9A 4WBKA 2R73A 2A2GA 3FR2A 1EQDA 5C0NA 4NLIA 4EFGA 1G74A 1QY0A 5BVSA 4ZHCA 4OMXA 4YCHA 3ELZA 5L8NA 2AMMX 1HBPA 1SY2A 2FLJA 1I06A 4DQ4A 4ZFXA 4QGWA 1YUPA 1YWDA 4MVLA 3STMX 4GNYA 2QM9A 1X8QA 3S26A 3O19A 2LBVA 2FS6A 4GKCA 3VG2A 4XMEA 2ACOA 1NP1A 1KQWA 5H8TA 3VG3A 5EEEA 2WR6A 4YGHA 1BJ7A 3CR6A 1BWYA 1IKEA 1DZJA 3KZAA 2E4JA 3CBSA 1KZXA 1GM6A 1IW2A 3D96A 1SXWA 1IFBA 1FEMA 2FTBA 4AZQA 1G5WA 5LKFA 4HPDA 5LJGA 4TNNA 4YGGA 1YP6A 3ZUOA 2RD7C 2HYSA 5IO6A 4ZH9A 4O9SA 2RCQA 3EBKA 1YWAA 1BSYA 3FMZA 1FENA 3HWDA 3PECA 4LZVA 3FEPA 3HWGA 4YDBA 1HMRA 1ZNKA 1UREA 1T68X 1D2UA 1EALA 1EUOA 3B2KA 3FA9A 3APWA 4YBUA 3BRNA 1LIDA 5EPQA 1GX9A 3B2IA 3BU1A 3ELXA 4ZHFA 1QQSA 4ZHGA 1GT4A 3OJYC 3FELA 2L5PA 1DC9A 1KT7A 1MX8A 4OS3A 4IB6A 1OPAA 2GTFX 2X46A 1GGLA 4Y0SA 4TQ2A 1HQPA 1JJJA 3NX2A 3ZQ3A 2FT9A 3GAQA 1QG5A 4WFVA 2N93A 3G7XA 5KICA 2FRSA 2NP1A 4HFOA 5HZ9A 5CE4A 1LKEA 3EMMA 1VPRA 2XKLA 4A60A 2JU3A 1BLRA 4A1HA 3IFBA 4EXZA 1U18A 2KT4B 1YWBA 4QYNA 3UEWA 4XMGA 1X89A 2XSTA 4EEJA 2CZTA 3FW4A 2QO4A 1SY0A 4D6AA 2WUTA 2LBAA 4QYPA 1EIOA 3BLGA 4I9RA 1UZ2X 2WQ9A 1IKJA 4YGZA 4ES7A 3EM0A 3ZUIA 2FWVA 4M6SA 1U17A 2AT6X 4QAEA 3D97A 3FA8A 3TGAA 5IO7A 4ARHA 1SY3A 2POAA 2RQ0A 3RZYA 1A3YA 3KFHA 1AB0A 1U0XA 3KFFA 1LIBA 2Q39A 4PSQA 3U9PC 4ZGUA 4OS8A 1ICNA 3WJDA 3B2JA 1GKAA 2FR2A 5HZ8A 4Y0PA 2CM4A 2K62A 1PM1X 3KFIA 4IAXA 1LIEA 1OEJA 3PPTA 2W2FA 3P6GA 1GKAB 3P6DA 3D95A 1YP7A 3WJGA 1ZNEA 4IAWA 3U03A 3FR4A 4Y0RA 1PBOA 5HTEA 1Z24A 1OBUA 3NADA 1CJ5A 3FR5A 1ZNDA 1P6PA 1ZNHA 1DFVA 3AKNA 1JYJA 4QZTA 1TW4A 3UEVA 4AZNA 5HCDC 4ORUA 4I9SA 4N7DA 1TXLA 1CBIA 5HA1A 1H91A 2HZQA 4LZUA 4MVIA 4XMHA 4ORXA 4YFPA 4ORWA 4BOEA 3I0AA 4ZHHA 3K3LA 5HA0A 1O8VA 4R0BA 5HZ6A 4YFRA 4M7MA 1BBPA 3FIQA 5D4AA 4ZCBA 1X8OA 2GJ5A 1SY1A 2OZQA 1EXSA 3WJCA 2NNDA 1EW3A 3I17A 4TKHA 5HZ5A 1BSQA 5BVTA 5KIDA 1AQBA 3NQ9A 4I3DA 4QZUA 5F58A 1LICA 1JYDA 4GRJA 1HMSA 1EPBA 4ZR2A 2LB6A 4D6BA 3VG4A 5H9KA 1KOIA 4OMWA 3WJEA 5EEDA 2OFMX 1MUPA 2Q2MA 3NPOA 2RA6A 1KT5A 3RSWA 4ALBA 3CQRA 1JJXA 3BSZE 1HMTA 1E00A 4ALOA 2WWPA 2ASNX 2CBSA 1KZWA 3O2YA 3NX1A 1ZNGA 1I04A 4MVKA 1MX7A 1ML7A 2FS7A 4NLJA 5LJHA 5FAZA 1SXUA 5EDCA 1GXAA 4EDEA 2QO6A 3B2LA 3O22A 2JN3A 5H9NA 1DF3A 4IMOA 4QGVA 1QABE 1BM5A 1KGLA 4AYHA 2IFBA 4AZPA 2AKQA 1I4UA 4KIIA 5FENA 3HK1A 1YWCA 5IO5A 1KT6A 3TZSA 1NGLA 3BX7A
chains in the Genus database with same CATH superfamily
4GGRA 1PBYA 1SRHA 5HBSA 4CDDA 4BX7B 1VWKB 4XMDA 1CBSA 3RDOA 5B29A 3SOTA 2HNXA 2DM5A 1CRBA 1STRB 1UYOX 3RKGA 4I60A 5B27A 2OVAA 3PEDA 4ZGFA 2WEXA 4GD9A 2MJIA 5BVQA 4GE1A 3TGCA 1ADLA 4CDEA 3WVMA 1T0VA 1DZKA 1NDJA 3VHIA 1VYGA 4EQAC 2X34A 3DTQA 3RDXA 2GH7A 1CBQA 3NP1A 1GX8A 2IZCB 3P6FA 4GGZA 1SWCA 3ZW0A 2MO5A 1VWNB 1A57A 1SWLA 4U9CA 1R0UA 2BLGA 4U8UO 1SLGB 3AKMA 5HTDA 4TLJA 1RXKA 3MBTA 5F6BA 2RTPB 2HLVA 2R56A 4NYQA 4O3YA 4YBPA 1Y0GA 3BS2A 5CSEA 3ZW0B 4IBAA 2AL0X 4U3QA 5HWZA 1AELA 2OY8A 2PY1A 1PMPA 4FBVA 3WJBA 2RTCB 4GDAA 3VPJE 3Q6LA 4A1YA 1LFOA 3EBWA 4AZOA 1XCAA 2WQAE 1OBQA 2OF9A 4QQ1A 3WBGA 3C78X 1S7DA 2Q2PA 4HPCA 1HBQA 1FTPA 5AJCA 5D47A 5L8IA 1QFTA 3P6CA 2O62A 1EI5A 5LJKA 3EW1A 1O1UA 4GNWA 4GETA 1VWPB 2JU7A 1RXHA 1SWHA 2OL6O 4OS0A 4MEEA 3EW2A 4Y0QA 3HWEA 2AF5A 2A13A 4BX6A 4MVEA 2ZSCA 3BY0A 4IMNA 1SWDA 3PDFA 5HZQA 2WSJA 1JZUA 5HAEA 1S2PA 4L1NA 2AT0X 1KT3A 1B4MA 5B11O 1SWQA 4OELA 3V8UA 4BBOA 2ANSA 2CZUA 1TOWA 2ZAGA 4BX6B 1SLFB 5K67A 4NV8A 2F01A 3CBCA 1DZMA 1L6MA 1BRPA 2X45A 2JU8A 3P6EA 1VWOB 4ID2A 2AT5X 1YIVA 4YVBA 1AVEA 5FFHA 4O4OA 1E5PA 4WFUA 1LPJA 3SZIA 3U0DA 4TKJA 1B0OA 2FHLA 2OYBO 4O4SA 3X00A 2RTDB 4ZH6A 3APXA 1RBPA 3FEKA 1SWUA 1D3SA 1B8EA 4ORRA 1EIIA 3JQOA 3C77X 4DQ3A 1A2DA 2EU7X 3T2WA 3RWXA 2MM3A 2RN4A 1LIFA 4HPBA 3LHNA 4LKTA 5KHPA 1SRJA 2GTLN 4YMYA 2CAMA 5LJCA 3C76X 5EDBA 3CWKA 2IZLB 2OVSA 1CBRA 3WYQA 3TGBA 4Z27A 1N4JA 1TOUA 1Y55X 2AT3X 2OF8A 2A5BA 2RTBB 1K3BA 1DV9A 1S44A 4CPHA 1X71A 2QO5A 5AJBA 1X8PA 3F9DA 3RE5A 1LF7A 1QFVA 2M4LA 1VWEB 4NNSA 4ODDA 3WXQA 2FR3A 3E3CA 1GT3A 1BEBA 2NNEA 2YMSA 1GT5A 4ORYA 4CPHB 1TVQA 4Y5DA 2Q4NA 1MDCA 4YCEA 2JOZA 4GGTA 1SA8A 1EPAA 1G7NA 4HPAA 2JW1A 2ZAIA 3NQKA 3HPEA 3STKA 1JMZA 1OEEA 1RSTB 3APVA 1NQNA 2LA7A 4LQZA 1X8UA 1A18A 4NYRA 1SRFA 1W6FA 5FQ6E 1FELA 4O3XB 3JS1A 3FA6A 3VHMA 2R74A 4DCBA 1MVGA 4CPIA 1GT1A 2RTGB 3MVFA 3KVNA 3F8AA 2RTLA 2HMBA 2L68A 4XMCA 2IZDB 4GJVA 4IB8A 5L8OA 1VWLB 3CQNA 1ALBA 3PP6A 1HN2A 5F7GA 5F1EA 3SLTA 1NP4A 4YKMA 4CK4A 3JSQA 1SWBA 2MF6A 4ORSA 4BQUA 4YKOA 4FGIB 4I3CA 2G8CO 4K19A 3SAOA 5IRUA 5LJEA 4L3RA 1OEKA 3RE6A 1ERXA 2HZRA 4NP1A 2ACPX 2OFRX 2X8FA 3BDRA 5D8JA 2OFBA 5H9LA 3UEXA 1SWKA 3RY2A 2I5ZO 2LKKA 3STNA 3RY1A 1FDQA 4TKBA 1KQXA 5B5FA 1BSOA 1UYNX 3EC5A 3OD9A 4RUNA 2K23A 4QGXA 3FIDA 1T8VA 3ZW1A 1N7YA 1O1VA 1W5RA 1E02A 2DJFA 2Z4HA 5F2BA 5JR8A 5LKEA 1SWOA 2RTIB 1LUQA 4XMFA 5DPQA 5F6ZA 2Q9SA 5LJDA 1ACDA 1LCWA 3SLJA 5H9AA 1N0SA 4MISA 5K06A 1VYFA 4CPFA 2GC9A 1ZNLA 1LDQA 2F73A 4JGLA 4NV7A 4AZRA 4YDAA 2CM9A 4CDCA 2CBRA 3NQ3A 1SWNA 4BX5A 4YFQA 5L3YA 1QY2A 4KT5A 4TJZA 4AZMA 1VWDB 1BRQA 2L9CA 4B55A 2ALLX 4ZJ0A 4DNEA 5LJBA 3HWFA 3NR3A 3CKFA 4Z2OA 2NNQA 3KFGA 5DG4A 2OVDA 1SXYA 3DSZA 3EYCA 3BU9A 4UU2A 3APUA 5AQ6A 1KT4A 3ZW2A 1ERBA 4A8ZA 3MG5A 1ICMA 3D9WA 2G7BA 2KTDA 4YH0A 5JD2A 2OVEA 3HOLA 2G79A 2LFOA 4Z2PA 5D45A 1RLBE 4FBOA 3PH5A 2AT8X 3VG6A 1I05A 1STPA 2WEWA 3P6HA 2L67A 3QKGA 3T1DA 1XKIA 2A3FX 1X8NA 3WJFA 5HCEC 2G78A 1IIUA 1E2TA 1VYOA 3KQ0A 3UEUA 2Z4IA 4ZHDA 1JV4A 5EZ2A 3FW5A 1G85A 4GDZA 3RDSA 2RTKA 2AH7X 3VG5A 5B3MO 4O4XA 1ZRYA 1E06A 3NBXX 1SXXA 2HKDA 4NNTA 1KL5A 3FLLA 4UU3A 1KXOA 2A0AA 4PJ2A 4RUUA 2QOSC 1B56A 1OPBA 4I3BA 3RDMA 2AVIA 1HQQA 1DZPA 3L4RA 1QY1A 3P24A 4IB7A 2W2BA 2PI3O 3VE1A 1PEEA 4EKVA 1SMPI 3N91A 4LKPA 1Y9LA 3BX8A 3ZW1B 1QWDA 2YG2A 2RCTA 2JGSA 2F09A 3IA8A 4AW8A 1SWPA 3SZHA 1AVGI 2BC3A 1SREA 3SZJA 3CMPA 1JBHA 3PH6A 2A5CA 1FE3A 3FA7A 1OBPA 3VG7A 5D48A 5HCCC 1LNMA 3B2HA 4ML7B 4O4UA 4N7CA 1SWTA 2P8GA 3BX7A 1VWAB 3OE3A 4GH7A 3PQUA 3FENA 3ZI8A 2A2UA 3TF6A 2W2AA 1IFCA 2GTLM 4IB9A 4WBKA 3S60A 2R73A 2A2GA 3FR2A 1EQDA 2I5VO 3FYFA 4NLIA 5C0NA 4EFGA 1G74A 4U8UN 3P02A 1I78A 1QY0A 5BVSA 4ZHCA 4OMXA 4YCHA 3ELZA 5L8NA 1Y9TA 2AMMX 3RBYA 2IZHB 3WZNA 2MHDA 1LDOA 1HBPA 1SY2A 2FLJA 2KTSA 1I06A 3VGWA 3OBLA 2IZKA 4DQ4A 4ZFXA 2OL8O 4QGWA 1YUPA 1YWDA 4MVLA 3STMX 4GNYA 1WBIA 3VHHA 2QM9A 4I95A 5CYBA 1X8QA 5B10O 1LCVA 3S26A 3O19A 2LBVA 3WZPA 2FS6A 1WUBA 2KW1A 3CKGA 4GKCA 3VG2A 2QOMA 2ACOA 4XMEA 1MEPA 1KQWA 1NP1A 2WPUA 2BSZA 5H8TA 2A8GA 1JJUA 3VG3A 4KCAA 5EEEA 2WR6A 4YGHA 4CPEA 1JJXA 1BJ7A 3CR6A 1MM9A 1BWYA 4GJSA 1IKEA 1DZJA 3KZAA 2IZFB 2E4JA 4IABA 2VDFA 3CBSA 1KZXA 1GM6A 1IW2A 3VE2A 4QNIA 4BVMA 3D96A 1SXWA 1IFBA 5AEOA 1FEMA 2FTBA 1SWJA 4AZQA 1G5WA 5LKFA 3SLOA 4HPDA 1PTSA 5LJGA 3QQ2A 2X4MA 4TNNA 4YGGA 1YP6A 2BT9A 3Q34A 3ZUOA 2RD7C 2C1SA 5B2AO 4CV7A 2HYSA 5IO6A 4ZH9A 4O9SA 2QMIA 4Z6JA 1SLDB 2RCQA 3EBKA 1YWAA 1BSYA 3FMZA 1FENA 3HWDA 3PECA 4KH8A 4LZVA 3FEPA 3HWGA 4YDBA 1HMRA 1ZNKA 1UREA 1T68X 2IZIA 1D2UA 1VWQB 3RDQA 1EUOA 3B2KA 3FA9A 4KC7A 1EALA 3APWA 4YBUA 3BRNA 1LIDA 3RDUA 5EPQA 1GX9A 4CDFA 3B2IA 3BU1A 2KD2A 3ELXA 1SWFA 4ZHFA 1QQSA 4ZHGA 1GT4A 2Y32A 3OJYC 3HOEA 3FELA 2L5PA 1DC9A 1KT7A 1MX8A 4OS3A 2BHVA 4IB6A 1OPAA 4QRLA 2GTFX 2Y3FA 2X46A 4CSBA 3FDCA 1GGLA 4Y0SA 4TQ2A 1HQPA 4JNJA 1K24A 4WHIA 1Y52X 3NX2A 3ZQ3A 2FT9A 2DJGA 1JJJA 3GAQA 1VWBB 1QG5A 4WFVA 2N93A 3G7XA 5KICA 2FRSA 2IZEB 2NP1A 2OFAA 4HFOA 3T6LA 4I6SA 5HZ9A 2OY1O 5CE4A 1LKEA 3EMMA 1VPRA 4BCSA 2XKLA 4A60A 2JU3A 4BX5B 1BLRA 3HTYA 1JMXA 4A1HA 3IFBA 1GX3A 4EXZA 1U18A 2BS5A 1YWBA 2KT4B 2RTRB 4QYNA 3UEWA 4XMGA 1SLEB 1X89A 2XSTA 1AVDA 3F6ZB 4HWMA 4GU8A 3T2XA 4EEJA 4Z2VA 4O49A 2CZTA 3FW4A 1STSB 2QO4A 1SY0A 4D6AA 2WUTA 2LBAA 4QYPA 4BGFA 1Y53X 3BLGA 4I9RA 1EIOA 1UZ2X 2WQ9A 1IKJA 4YGZA 4ES7A 3LTWA 1N43A 2GTLO 3EM0A 3ZUIA 4FBRA 2FWVA 5CHKA 4M6SA 2OY5O 1U17A 2RTNB 2X8SA 2AT6X 4QAEA 3D97A 2UZ2A 3FA8A 4Z28A 3S5XA 3GE2A 3TGAA 3WZOA 4ARHA 5IO7A 5IXGA 1SY3A 2POAA 1SWSA 2RQ0A 2X56A 3RZYA 1A3YA 2RTMA 1KFFA 1KL4A 1AB0A 1KL3A 3KFHA 1U0XA 3KFFA 1LIBA 2Q39A 4PSQA 3S5VA 3H3IA 3U9PC 4ZGUA 2RTEB 1IJ8A 4OS8A 2IZBA 2RTHB 4OKAA 2G5LA 1HXZA 1ICNA 5K68A 3WJDA 3B2JA 1GKAA 2FR2A 5HZ8A 4Y0PA 2CM4A 2K62A 1PM1X 3KFIA 2JMBA 2X55A 4IAXA 1LIEA 4U46A 1VWJB 1VWIB 2X32A 1OEJA 3AEHA 2RTFB 2W2FA 3PPTA 4OEMA 1DF8A 3P6GA 1GKAB 3P6DA 3D95A 1YP7A 3WJGA 1ZNEA 4IAWA 2OY7A 1NBXA 4U8UM 3U03A 5IRAA 3FR4A 4Y0RA 1PBOA 1RAVA 4FQBB 5HTEA 1SRIA 1Z24A 1OBUA 1SWAA 3NADA 1CJ5A 3FR5A 1ZNDA 1P6PA 1ZNHA 1DFVA 3AKNA 1JYJA 4QZTA 1TW4A 2FGSA 3PK2A 3UEVA 4COTA 4KC8A 4AZNA 4O3ZA 5HCDC 4ORUA 4I9SA 2VFBA 4N7DA 1TXLA 4O3WA 1CBIA 3WZQA 5HA1A 1H91A 2HZQA 3VU1A 4LZUA 4MVIA 4XMHA 4ORXA 4YFPA 2OL7A 1HY2A 4ORWA 5FQ8E 3I0AA 4BOEA 2QCBA 2RTJA 4ZHHA 3K3LA 1VWFB 4INNA 2RTQB 4IRWA 5HA0A 1RSUB 2IZGB 2Y3EA 3UAQA 1SWRA 1LELA 3T6FA 1LCZA 1O8VA 4JO6A 3ZWEA 4R0BA 5HZ6A 4YFRA 1VWHB 4M7MA 2VFCA 4NW4A 1BBPA 3FIQA 4GUZA 1N9YA 5D4AA 4Y59A 4ZCBA 1VWGB 1X8OA 2GJ5A 2C4IA 4GZVA 5FQ7E 3WYPA 4ON1A 1SY1A 2OZQA 2C1QA 1EXSA 3WJCA 2NNDA 1EW3A 1MOYA 3I17A 4TKHA 2IZAA 5HZ5A 1BSQA 5BVTA 5KIDA 1AQBA 1OSPO 1SWGA 3NQ9A 4I3DA 2FKGA 4QZUA 5F58A 1LICA 1NQMA 1JYDA 2IZJA 2UYWA 4GRJA 1HMSA 1EPBA 4ZR2A 2LB6A 4D6BA 3VG4A 1N9MA 5H9KA 1KOIA 1VWMB 4OMWA 3WJEA 1RXJA 2BS6A 5EEDA 2MWHA 2OFMX 1MUPA 2Q2MA 3NPOA 2RA6A 1KT5A 3RSWA 4ALBA 2RTOB 3CQRA 3BSZE 1HMTA 3LV4A 4GK9A 5BYPA 1E00A 3D4RA 4ALOA 2WWPA 2ASNX 2CBSA 1KZWA 2FKJA 3MM0A 1W4TA 5IRWA 3O2YA 1NC9A 1ZNGA 3NX1A 1I04A 2FHNX 3WOVA 4MVKA 3AUMO 1MX7A 1ML7A 2FS7A 4NLJA 5LJHA 1JQPA 2X8TA 1SXUA 5FAZA 5EDCA 1SRGA 1GXAA 4EDEA 2QO6A 1MK5A 3B2LA 3ZZVA 1FJ1E 3O22A 2JN3A 5H9NA 3PQSA 1DF3A 4IMOA 4QGVA 1QABE 1BM5A 1KGLA 4AYHA 2IFBA 1SWEA 1HXLA 4JHQA 5B5GA 2AKQA 1I4UA 4KIIA 4AZPA 5FENA 3HK1A 1JIWI 4C5PA 4BX7A 1YWCA 1VWCB 3MX7A 1KT6A 4MIRA 5IO5A 4BJ8A 1NGLA 1VWRB 3TZSA 1I9HA 2RTAA
chains in the Genus database with same CATH topology
5HBSA 4XMDA 1CBSA 5B29A 3SOTA 2HNXA 2DM5A 1CRBA 3RKGA 5B27A 2OVAA 3PEDA 4ZGFA 2WEXA 5BVQA 2MJIA 4GE1A 3TGCA 1ADLA 3WVMA 1T0VA 1DZKA 1VYGA 4EQAC 3DTQA 1CBQA 3NP1A 1GX8A 3P6FA 3ZW0A 2MO5A 1A57A 4U9CA 1R0UA 2BLGA 4U8UO 3AKMA 5HTDA 4TLJA 3MBTA 5F6BA 4NYQA 2HLVA 2R56A 4O3YA 4YBPA 3BS2A 3ZW0B 4IBAA 2AL0X 4U3QA 5HWZA 1AELA 2PY1A 1PMPA 4FBVA 3WJBA 3VPJE 3Q6LA 4A1YA 1LFOA 3EBWA 4AZOA 1XCAA 2WQAE 1OBQA 4QQ1A 3WBGA 3C78X 1S7DA 2Q2PA 4HPCA 1HBQA 1FTPA 5AJCA 5D47A 5L8IA 1QFTA 3P6CA 2O62A 1EI5A 5LJKA 1O1UA 4GNWA 4GETA 2JU7A 4OS0A 4Y0QA 3HWEA 2A13A 4MVEA 3BY0A 4IMNA 5HZQA 2WSJA 1JZUA 5HAEA 1S2PA 4L1NA 2AT0X 1KT3A 1B4MA 3V8UA 2ANSA 2CZUA 1TOWA 2ZAGA 3CBCA 1DZMA 1L6MA 1BRPA 2X45A 2JU8A 3P6EA 4ID2A 2AT5X 1YIVA 5FFHA 4O4OA 1E5PA 4WFUA 1LPJA 3U0DA 4TKJA 1B0OA 4O4SA 4ZH6A 3APXA 1RBPA 3FEKA 1D3SA 1B8EA 4ORRA 1EIIA 3JQOA 3C77X 4DQ3A 1A2DA 2EU7X 3RWXA 2MM3A 2RN4A 1LIFA 4HPBA 3LHNA 4LKTA 5KHPA 2GTLN 4YMYA 5LJCA 3C76X 5EDBA 3CWKA 2OVSA 3TGBA 1CBRA 1TOUA 2AT3X 1DV9A 1S44A 1X71A 2QO5A 5AJBA 1X8PA 3F9DA 1LF7A 1QFVA 2M4LA 4ODDA 4NNSA 3WXQA 2FR3A 3E3CA 1GT3A 1BEBA 2NNEA 2YMSA 1GT5A 4ORYA 1TVQA 4YCEA 2Q4NA 1MDCA 2JOZA 1SA8A 1EPAA 1G7NA 4HPAA 2JW1A 2ZAIA 3NQKA 3STKA 1OEEA 3APVA 4NYRA 2LA7A 4LQZA 1X8UA 1A18A 5FQ6E 1FELA 4O3XB 3JS1A 3FA6A 2R74A 1MVGA 1GT1A 3MVFA 3F8AA 4XMCA 2HMBA 2L68A 4IB8A 5L8OA 3CQNA 1ALBA 3PP6A 1HN2A 5F7GA 5F1EA 1NP4A 4YKMA 4CK4A 3JSQA 4ORSA 4BQUA 4YKOA 4FGIB 4I3CA 4K19A 3SAOA 5LJEA 4L3RA 1OEKA 1ERXA 2HZRA 4NP1A 2ACPX 2OFRX 2X8FA 3BDRA 5D8JA 5H9LA 3UEXA 3STNA 2LKKA 4TKBA 1FDQA 1KQXA 1BSOA 3OD9A 4RUNA 2K23A 4QGXA 1T8VA 1O1VA 1E02A 2Z4HA 5JR8A 5LKEA 5DPQA 4XMFA 5LJDA 5F6ZA 2Q9SA 1ACDA 5H9AA 1N0SA 4MISA 5K06A 1VYFA 2GC9A 1ZNLA 2F73A 4JGLA 4AZRA 4YDAA 2CM9A 2CBRA 3NQ3A 4YFQA 1QY2A 4KT5A 4TJZA 4AZMA 1BRQA 2L9CA 4ZJ0A 2ALLX 5LJBA 3HWFA 3NR3A 2NNQA 3KFGA 5DG4A 2OVDA 1SXYA 3DSZA 3EYCA 3BU9A 4UU2A 3APUA 5AQ6A 1KT4A 3ZW2A 1ERBA 4A8ZA 1ICMA 2G7BA 2KTDA 4YH0A 2OVEA 2G79A 2LFOA 5D45A 1RLBE 4FBOA 3PH5A 2AT8X 3VG6A 1I05A 2WEWA 3P6HA 2L67A 3QKGA 3T1DA 1XKIA 2A3FX 1X8NA 3WJFA 5HCEC 2G78A 1IIUA 3KQ0A 3UEUA 4ZHDA 2Z4IA 1JV4A 5EZ2A 3FW5A 1G85A 4GDZA 3VG5A 2AH7X 4O4XA 1ZRYA 1E06A 3NBXX 1SXXA 4NNTA 3FLLA 4UU3A 3ZW1A 1KXOA 2A0AA 4PJ2A 4RUUA 2QOSC 1B56A 1OPBA 4I3BA 4BVMA 3L4RA 1DZPA 1QY1A 3P24A 4IB7A 2W2BA 3VE1A 1PEEA 1SMPI 3N91A 4LKPA 1Y9LA 3BX8A 3ZW1B 1QWDA 2YG2A 2RCTA 2F09A 3IA8A 4AW8A 1AVGI 3CMPA 1JBHA 3PH6A 1FE3A 3FA7A 1OBPA 3VG7A 5D48A 5HCCC 1LNMA 3B2HA 4ML7B 4O4UA 4N7CA 2P8GA 3OE3A 4GH7A 3PQUA 3FENA 3ZI8A 2A2UA 3TF6A 2W2AA 1IFCA 2GTLM 4IB9A 4WBKA 3S60A 2R73A 2A2GA 3FR2A 1EQDA 3FYFA 4NLIA 5C0NA 4EFGA 1G74A 4U8UN 3P02A 1QY0A 5BVSA 4ZHCA 4OMXA 4YCHA 3ELZA 5L8NA 1Y9TA 2AMMX 3RBYA 2MHDA 1HBPA 1SY2A 2FLJA 2KTSA 1I06A 3OBLA 4DQ4A 4ZFXA 4QGWA 1YUPA 1YWDA 4MVLA 3STMX 4GNYA 2QM9A 4I95A 5CYBA 1X8QA 3S26A 3O19A 2LBVA 2FS6A 2KW1A 4GKCA 3VG2A 4XMEA 2ACOA 1NP1A 1KQWA 5H8TA 3VG3A 4KCAA 5EEEA 2WR6A 4YGHA 1BJ7A 3CR6A 1BWYA 1IKEA 1DZJA 3KZAA 2E4JA 4IABA 3CBSA 1KZXA 1GM6A 1IW2A 3VE2A 4QNIA 3D96A 1SXWA 1IFBA 5AEOA 1FEMA 2FTBA 4AZQA 1G5WA 5LKFA 4HPDA 5LJGA 4TNNA 4YGGA 1YP6A 2BT9A 3ZUOA 2RD7C 4CV7A 2HYSA 5IO6A 4ZH9A 4O9SA 2QMIA 2RCQA 3EBKA 1YWAA 1BSYA 3FMZA 1FENA 3HWDA 3PECA 4KH8A 4LZVA 3FEPA 3HWGA 4YDBA 1HMRA 1ZNKA 1UREA 1T68X 1D2UA 1EALA 1EUOA 3B2KA 3FA9A 4KC7A 3APWA 4YBUA 3BRNA 1LIDA 5EPQA 1GX9A 3B2IA 3BU1A 2KD2A 3ELXA 4ZHFA 1QQSA 4ZHGA 1GT4A 3OJYC 3HOEA 3FELA 2L5PA 1DC9A 1KT7A 1MX8A 4OS3A 2BHVA 4IB6A 1OPAA 4QRLA 2GTFX 2X46A 4CSBA 1GGLA 4Y0SA 4TQ2A 1HQPA 4WHIA 1JJJA 3NX2A 3ZQ3A 2FT9A 3GAQA 1QG5A 4WFVA 2N93A 3G7XA 5KICA 2FRSA 2NP1A 4HFOA 4I6SA 5HZ9A 5CE4A 1LKEA 3EMMA 1VPRA 2XKLA 4A60A 2JU3A 1BLRA 3HTYA 4A1HA 3IFBA 4EXZA 1U18A 2BS5A 1YWBA 2KT4B 4QYNA 3UEWA 4XMGA 1X89A 2XSTA 3F6ZB 4HWMA 4GU8A 4EEJA 4O49A 2CZTA 3FW4A 2QO4A 1SY0A 4D6AA 2WUTA 2LBAA 4QYPA 1EIOA 3BLGA 4I9RA 1UZ2X 2WQ9A 1IKJA 4YGZA 4ES7A 2GTLO 3EM0A 3ZUIA 4FBRA 2FWVA 4M6SA 1U17A 2X8SA 2AT6X 4QAEA 3D97A 3FA8A 3S5XA 3TGAA 5IO7A 3GE2A 4ARHA 1SY3A 2POAA 2RQ0A 3RZYA 1A3YA 3KFHA 1AB0A 1U0XA 3KFFA 1LIBA 2Q39A 4PSQA 3S5VA 3H3IA 3U9PC 4ZGUA 4OS8A 1ICNA 3WJDA 3B2JA 1GKAA 2FR2A 5HZ8A 4Y0PA 2CM4A 2K62A 1PM1X 3KFIA 2JMBA 4IAXA 1LIEA 1OEJA 3PPTA 2W2FA 3P6GA 1GKAB 3P6DA 3D95A 1YP7A 3WJGA 1ZNEA 4IAWA 3U03A 4U8UM 3FR4A 4Y0RA 1PBOA 4FQBB 5HTEA 1Z24A 1OBUA 3NADA 1CJ5A 3FR5A 1ZNDA 1P6PA 1ZNHA 1DFVA 3AKNA 1JYJA 4QZTA 1TW4A 3UEVA 4COTA 4KC8A 4AZNA 4O3ZA 5HCDC 4ORUA 4I9SA 4N7DA 1TXLA 4O3WA 1CBIA 5HA1A 1H91A 2HZQA 3VU1A 4LZUA 4MVIA 4XMHA 4ORXA 4YFPA 4ORWA 5FQ8E 4BOEA 3I0AA 4ZHHA 3K3LA 4INNA 5HA0A 3UAQA 1O8VA 3ZWEA 4R0BA 5HZ6A 4YFRA 4M7MA 4NW4A 1BBPA 3FIQA 5D4AA 4ZCBA 1X8OA 2GJ5A 4GZVA 5FQ7E 4ON1A 1SY1A 2OZQA 1EXSA 3WJCA 2NNDA 1EW3A 3I17A 4TKHA 5HZ5A 1BSQA 5BVTA 5KIDA 1AQBA 3NQ9A 4I3DA 4QZUA 5F58A 1LICA 1JYDA 4GRJA 1HMSA 1EPBA 4ZR2A 2LB6A 4D6BA 3VG4A 5H9KA 1KOIA 4OMWA 3WJEA 2BS6A 5EEDA 2MWHA 2OFMX 1MUPA 2Q2MA 3NPOA 2RA6A 1KT5A 3RSWA 4ALBA 3CQRA 1JJXA 3BSZE 1HMTA 3LV4A 4GK9A 5BYPA 1E00A 3D4RA 4ALOA 2WWPA 2ASNX 2CBSA 1KZWA 3O2YA 3NX1A 1ZNGA 1I04A 3WOVA 4MVKA 1MX7A 1ML7A 2FS7A 4NLJA 5LJHA 5FAZA 2X8TA 1SXUA 5EDCA 1GXAA 4EDEA 2QO6A 3B2LA 3ZZVA 3O22A 2JN3A 5H9NA 3PQSA 1DF3A 4IMOA 4QGVA 1QABE 1BM5A 1KGLA 4AYHA 2IFBA 4AZPA 2AKQA 1I4UA 4KIIA 5FENA 3HK1A 1JIWI 1YWCA 3MX7A 5IO5A 1KT6A 4MIRA 3TZSA 1NGLA 3HOLA 3BX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBS A;  4XMD A;  1CBS A;  5B29 A;  2HNX A;  2DM5 A;  1CRB A;  5B27 A;  2OVA A;  3PED A;  2WEX A;  5BVQ A;  2MJI A;  4GE1 A;  3TGC A;  1ADL A;  3WVM A;  1T0V A;  1DZK A;  1VYG A;  3DTQ A;  1CBQ A;  3NP1 A;  1GX8 A;  3P6F A;  2MO5 A;  1A57 A;  1R0U A;  2BLG A;  3AKM A;  5HTD A;  4TLJ A;  3MBT A;  5F6B A;  4NYQ A;  2HLV A;  2R56 A;  4YBP A;  3BS2 A;  4IBA A;  2AL0 X;  5HWZ A;  1AEL A;  2PY1 A;  1PMP A;  3WJB A;  3Q6L A;  4A1Y A;  1LFO A;  3EBW A;  4AZO A;  1XCA A;  2WQA E;  1OBQ A;  3WBG A;  3C78 X;  1S7D A;  2Q2P A;  4HPC A;  1HBQ A;  1FTP A;  5D47 A;  5L8I A;  1QFT A;  3P6C A;  2O62 A;  5LJK A;  1O1U A;  4GNW A;  4GET A;  2JU7 A;  4OS0 A;  4Y0Q A;  3HWE A;  2A13 A;  3BY0 A;  4IMN A;  5HZQ A;  2WSJ A;  1JZU A;  5HAE A;  1S2P A;  2AT0 X;  1KT3 A;  1B4M A;  2ANS A;  2CZU A;  1TOW A;  3CBC A;  1DZM A;  1L6M A;  1BRP A;  2X45 A;  2JU8 A;  3P6E A;  2AT5 X;  1YIV A;  5FFH A;  1E5P A;  4WFU A;  1LPJ A;  3U0D A;  4TKJ A;  1B0O A;  4ZH6 A;  3APX A;  1RBP A;  3FEK A;  1D3S A;  1B8E A;  4ORR A;  1EII A;  3C77 X;  4DQ3 A;  1A2D A;  2EU7 X;  2MM3 A;  1LIF A;  4HPB A;  4LKT A;  5KHP A;  4YMY A;  5LJC A;  3C76 X;  5EDB A;  3CWK A;  3TGB A;  1CBR A;  1TOU A;  2AT3 X;  1DV9 A;  1S44 A;  1X71 A;  2QO5 A;  1X8P A;  3F9D A;  1LF7 A;  1QFV A;  3WXQ A;  4ODD A;  4NNS A;  2FR3 A;  1GT3 A;  1BEB A;  2NNE A;  4ORY A;  1GT5 A;  1TVQ A;  4YCE A;  2Q4N A;  1MDC A;  2JOZ A;  1SA8 A;  1EPA A;  1G7N A;  4HPA A;  3STK A;  1OEE A;  3APV A;  4NYR A;  1X8U A;  1A18 A;  1FEL A;  3JS1 A;  3FA6 A;  2R74 A;  1MVG A;  1GT1 A;  3MVF A;  3F8A A;  4XMC A;  2HMB A;  2L68 A;  4IB8 A;  5L8O A;  3CQN A;  1ALB A;  3PP6 A;  1HN2 A;  5F7G A;  5F1E A;  1NP4 A;  4YKM A;  4CK4 A;  3JSQ A;  4ORS A;  4BQU A;  4YKO A;  4I3C A;  4K19 A;  3SAO A;  5LJE A;  1OEK A;  1ERX A;  2HZR A;  4NP1 A;  2ACP X;  2OFR X;  3BDR A;  5D8J A;  5H9L A;  3UEX A;  3STN A;  2LKK A;  4TKB A;  1FDQ A;  1KQX A;  1BSO A;  4RUN A;  2K23 A;  4QGX A;  1T8V A;  1O1V A;  1E02 A;  5JR8 A;  5LKE A;  5DPQ A;  4XMF A;  5LJD A;  5F6Z A;  2Q9S A;  1ACD A;  5H9A A;  1N0S A;  5K06 A;  1VYF A;  2GC9 A;  1ZNL A;  2F73 A;  4AZR A;  4YDA A;  2CM9 A;  2CBR A;  3NQ3 A;  4YFQ A;  1QY2 A;  4AZM A;  4TJZ A;  1BRQ A;  2L9C A;  4ZJ0 A;  2ALL X;  5LJB A;  3HWF A;  3NR3 A;  2NNQ A;  3KFG A;  5DG4 A;  2OVD A;  1SXY A;  3DSZ A;  3EYC A;  3BU9 A;  4UU2 A;  3APU A;  5AQ6 A;  1KT4 A;  1ERB A;  4A8Z A;  1ICM A;  2G7B A;  2KTD A;  4YH0 A;  2OVE A;  2G79 A;  2LFO A;  5D45 A;  1RLB E;  3PH5 A;  2AT8 X;  3VG6 A;  1I05 A;  2WEW A;  3P6H A;  2L67 A;  3QKG A;  3T1D A;  1XKI A;  2A3F X;  1X8N A;  3WJF A;  5HCE C;  2G78 A;  1IIU A;  3KQ0 A;  3UEU A;  4ZHD A;  1JV4 A;  5EZ2 A;  3FW5 A;  1G85 A;  3VG5 A;  2AH7 X;  1ZRY A;  1E06 A;  1SXX A;  4NNT A;  3FLL A;  4UU3 A;  1KXO A;  2A0A A;  4RUU A;  2QOS C;  1B56 A;  1OPB A;  4I3B A;  4BVM A;  3L4R A;  1DZP A;  1QY1 A;  4IB7 A;  2W2B A;  1PEE A;  4LKP A;  3BX8 A;  1QWD A;  2YG2 A;  2RCT A;  3IA8 A;  4AW8 A;  1AVG I;  3CMP A;  1JBH A;  3PH6 A;  1FE3 A;  3FA7 A;  1OBP A;  3VG7 A;  5D48 A;  5HCC C;  1LNM A;  3B2H A;  4N7C A;  2P8G A;  4GH7 A;  3FEN A;  2A2U A;  3TF6 A;  2W2A A;  1IFC A;  4IB9 A;  4WBK A;  2R73 A;  2A2G A;  3FR2 A;  1EQD A;  5C0N A;  4NLI A;  4EFG A;  1G74 A;  1QY0 A;  5BVS A;  4ZHC A;  4OMX A;  4YCH A;  3ELZ A;  5L8N A;  2AMM X;  1HBP A;  1SY2 A;  2FLJ A;  1I06 A;  4DQ4 A;  4ZFX A;  4QGW A;  1YUP A;  1YWD A;  4MVL A;  3STM X;  4GNY A;  2QM9 A;  1X8Q A;  3S26 A;  3O19 A;  2LBV A;  2FS6 A;  4GKC A;  3VG2 A;  4XME A;  2ACO A;  1NP1 A;  1KQW A;  5H8T A;  3VG3 A;  5EEE A;  2WR6 A;  4YGH A;  1BJ7 A;  3CR6 A;  1BWY A;  1IKE A;  1DZJ A;  3KZA A;  2E4J A;  3CBS A;  1KZX A;  1GM6 A;  1IW2 A;  3D96 A;  1SXW A;  1IFB A;  1FEM A;  2FTB A;  4AZQ A;  1G5W A;  5LKF A;  4HPD A;  5LJG A;  4TNN A;  4YGG A;  1YP6 A;  3ZUO A;  2RD7 C;  2HYS A;  5IO6 A;  4ZH9 A;  4O9S A;  2RCQ A;  3EBK A;  1YWA A;  1BSY A;  3FMZ A;  1FEN A;  3HWD A;  3PEC A;  4LZV A;  3FEP A;  3HWG A;  4YDB A;  1HMR A;  1ZNK A;  1URE A;  1T68 X;  1D2U A;  1EAL A;  1EUO A;  3B2K A;  3FA9 A;  3APW A;  4YBU A;  3BRN A;  1LID A;  5EPQ A;  1GX9 A;  3B2I A;  3BU1 A;  3ELX A;  4ZHF A;  1QQS A;  4ZHG A;  1GT4 A;  3OJY C;  3FEL A;  2L5P A;  1DC9 A;  1KT7 A;  1MX8 A;  4OS3 A;  4IB6 A;  1OPA A;  2GTF X;  2X46 A;  1GGL A;  4Y0S A;  4TQ2 A;  1HQP A;  1JJJ A;  3NX2 A;  3ZQ3 A;  2FT9 A;  3GAQ A;  1QG5 A;  4WFV A;  2N93 A;  3G7X A;  5KIC A;  2FRS A;  2NP1 A;  4HFO A;  5HZ9 A;  5CE4 A;  1LKE A;  3EMM A;  1VPR A;  2XKL A;  4A60 A;  2JU3 A;  1BLR A;  4A1H A;  3IFB A;  4EXZ A;  1U18 A;  2KT4 B;  1YWB A;  4QYN A;  3UEW A;  4XMG A;  1X89 A;  2XST A;  4EEJ A;  2CZT A;  3FW4 A;  2QO4 A;  1SY0 A;  4D6A A;  2WUT A;  2LBA A;  4QYP A;  1EIO A;  3BLG A;  4I9R A;  1UZ2 X;  2WQ9 A;  1IKJ A;  4YGZ A;  4ES7 A;  3EM0 A;  3ZUI A;  2FWV A;  4M6S A;  1U17 A;  2AT6 X;  4QAE A;  3D97 A;  3FA8 A;  3TGA A;  5IO7 A;  4ARH A;  1SY3 A;  2POA A;  2RQ0 A;  3RZY A;  1A3Y A;  3KFH A;  1AB0 A;  1U0X A;  3KFF A;  1LIB A;  2Q39 A;  4PSQ A;  3U9P C;  4ZGU A;  4OS8 A;  1ICN A;  3WJD A;  3B2J A;  1GKA A;  2FR2 A;  5HZ8 A;  4Y0P A;  2CM4 A;  2K62 A;  1PM1 X;  3KFI A;  4IAX A;  1LIE A;  1OEJ A;  3PPT A;  2W2F A;  3P6G A;  1GKA B;  3P6D A;  3D95 A;  1YP7 A;  3WJG A;  1ZNE A;  4IAW A;  3U03 A;  3FR4 A;  4Y0R A;  1PBO A;  5HTE A;  1Z24 A;  1OBU A;  3NAD A;  1CJ5 A;  3FR5 A;  1ZND A;  1P6P A;  1ZNH A;  1DFV A;  3AKN A;  1JYJ A;  4QZT A;  1TW4 A;  3UEV A;  4AZN A;  5HCD C;  4ORU A;  4I9S A;  4N7D A;  1TXL A;  1CBI A;  5HA1 A;  1H91 A;  2HZQ A;  4LZU A;  4MVI A;  4XMH A;  4ORX A;  4YFP A;  4ORW A;  4BOE A;  3I0A A;  4ZHH A;  3K3L A;  5HA0 A;  1O8V A;  4R0B A;  5HZ6 A;  4YFR A;  4M7M A;  1BBP A;  3FIQ A;  5D4A A;  4ZCB A;  1X8O A;  2GJ5 A;  1SY1 A;  2OZQ A;  1EXS A;  3WJC A;  2NND A;  1EW3 A;  3I17 A;  4TKH A;  5HZ5 A;  1BSQ A;  5BVT A;  5KID A;  1AQB A;  3NQ9 A;  4I3D A;  4QZU A;  5F58 A;  1LIC A;  1JYD A;  4GRJ A;  1HMS A;  1EPB A;  4ZR2 A;  2LB6 A;  4D6B A;  3VG4 A;  5H9K A;  1KOI A;  4OMW A;  3WJE A;  5EED A;  2OFM X;  1MUP A;  2Q2M A;  3NPO A;  2RA6 A;  1KT5 A;  3RSW A;  4ALB A;  3CQR A;  1JJX A;  3BSZ E;  1HMT A;  1E00 A;  4ALO A;  2WWP A;  2ASN X;  2CBS A;  1KZW A;  3O2Y A;  3NX1 A;  1ZNG A;  1I04 A;  4MVK A;  1MX7 A;  1ML7 A;  2FS7 A;  4NLJ A;  5LJH A;  5FAZ A;  1SXU A;  5EDC A;  1GXA A;  4EDE A;  2QO6 A;  3B2L A;  3O22 A;  2JN3 A;  5H9N A;  1DF3 A;  4IMO A;  4QGV A;  1QAB E;  1BM5 A;  1KGL A;  4AYH A;  2IFB A;  4AZP A;  2AKQ A;  1I4U A;  4KII A;  5FEN A;  3HK1 A;  1YWC A;  5IO5 A;  1KT6 A;  3TZS A;  1NGL A;  3BX7 A; 
#chains in the Genus database with same CATH topology
 4GGR A;  1PBY A;  1SRH A;  5HBS A;  4CDD A;  4BX7 B;  1VWK B;  4XMD A;  1CBS A;  3RDO A;  5B29 A;  3SOT A;  2HNX A;  2DM5 A;  1CRB A;  1STR B;  1UYO X;  3RKG A;  4I60 A;  5B27 A;  2OVA A;  3PED A;  4ZGF A;  2WEX A;  4GD9 A;  2MJI A;  5BVQ A;  4GE1 A;  3TGC A;  1ADL A;  4CDE A;  3WVM A;  1T0V A;  1DZK A;  1NDJ A;  3VHI A;  1VYG A;  4EQA C;  2X34 A;  3DTQ A;  3RDX A;  2GH7 A;  1CBQ A;  3NP1 A;  1GX8 A;  2IZC B;  3P6F A;  4GGZ A;  1SWC A;  3ZW0 A;  2MO5 A;  1VWN B;  1A57 A;  1SWL A;  4U9C A;  1R0U A;  2BLG A;  4U8U O;  1SLG B;  3AKM A;  5HTD A;  4TLJ A;  1RXK A;  3MBT A;  5F6B A;  2RTP B;  2HLV A;  2R56 A;  4NYQ A;  4O3Y A;  4YBP A;  1Y0G A;  3BS2 A;  5CSE A;  3ZW0 B;  4IBA A;  2AL0 X;  4U3Q A;  5HWZ A;  1AEL A;  2OY8 A;  2PY1 A;  1PMP A;  4FBV A;  3WJB A;  2RTC B;  4GDA A;  3VPJ E;  3Q6L A;  4A1Y A;  1LFO A;  3EBW A;  4AZO A;  1XCA A;  2WQA E;  1OBQ A;  2OF9 A;  4QQ1 A;  3WBG A;  3C78 X;  1S7D A;  2Q2P A;  4HPC A;  1HBQ A;  1FTP A;  5AJC A;  5D47 A;  5L8I A;  1QFT A;  3P6C A;  2O62 A;  1EI5 A;  5LJK A;  3EW1 A;  1O1U A;  4GNW A;  4GET A;  1VWP B;  2JU7 A;  1RXH A;  1SWH A;  2OL6 O;  4OS0 A;  4MEE A;  3EW2 A;  4Y0Q A;  3HWE A;  2AF5 A;  2A13 A;  4BX6 A;  4MVE A;  2ZSC A;  3BY0 A;  4IMN A;  1SWD A;  3PDF A;  5HZQ A;  2WSJ A;  1JZU A;  5HAE A;  1S2P A;  4L1N A;  2AT0 X;  1KT3 A;  1B4M A;  5B11 O;  1SWQ A;  4OEL A;  3V8U A;  4BBO A;  2ANS A;  2CZU A;  1TOW A;  2ZAG A;  4BX6 B;  1SLF B;  5K67 A;  4NV8 A;  2F01 A;  3CBC A;  1DZM A;  1L6M A;  1BRP A;  2X45 A;  2JU8 A;  3P6E A;  1VWO B;  4ID2 A;  2AT5 X;  1YIV A;  4YVB A;  1AVE A;  5FFH A;  4O4O A;  1E5P A;  4WFU A;  1LPJ A;  3SZI A;  3U0D A;  4TKJ A;  1B0O A;  2FHL A;  2OYB O;  4O4S A;  3X00 A;  2RTD B;  4ZH6 A;  3APX A;  1RBP A;  3FEK A;  1SWU A;  1D3S A;  1B8E A;  4ORR A;  1EII A;  3JQO A;  3C77 X;  4DQ3 A;  1A2D A;  2EU7 X;  3T2W A;  3RWX A;  2MM3 A;  2RN4 A;  1LIF A;  4HPB A;  3LHN A;  4LKT A;  5KHP A;  1SRJ A;  2GTL N;  4YMY A;  2CAM A;  5LJC A;  3C76 X;  5EDB A;  3CWK A;  2IZL B;  2OVS A;  1CBR A;  3WYQ A;  3TGB A;  4Z27 A;  1N4J A;  1TOU A;  1Y55 X;  2AT3 X;  2OF8 A;  2A5B A;  2RTB B;  1K3B A;  1DV9 A;  1S44 A;  4CPH A;  1X71 A;  2QO5 A;  5AJB A;  1X8P A;  3F9D A;  3RE5 A;  1LF7 A;  1QFV A;  2M4L A;  1VWE B;  4NNS A;  4ODD A;  3WXQ A;  2FR3 A;  3E3C A;  1GT3 A;  1BEB A;  2NNE A;  2YMS A;  1GT5 A;  4ORY A;  4CPH B;  1TVQ A;  4Y5D A;  2Q4N A;  1MDC A;  4YCE A;  2JOZ A;  4GGT A;  1SA8 A;  1EPA A;  1G7N A;  4HPA A;  2JW1 A;  2ZAI A;  3NQK A;  3HPE A;  3STK A;  1JMZ A;  1OEE A;  1RST B;  3APV A;  1NQN A;  2LA7 A;  4LQZ A;  1X8U A;  1A18 A;  4NYR A;  1SRF A;  1W6F A;  5FQ6 E;  1FEL A;  4O3X B;  3JS1 A;  3FA6 A;  3VHM A;  2R74 A;  4DCB A;  1MVG A;  4CPI A;  1GT1 A;  2RTG B;  3MVF A;  3KVN A;  3F8A A;  2RTL A;  2HMB A;  2L68 A;  4XMC A;  2IZD B;  4GJV A;  4IB8 A;  5L8O A;  1VWL B;  3CQN A;  1ALB A;  3PP6 A;  1HN2 A;  5F7G A;  5F1E A;  3SLT A;  1NP4 A;  4YKM A;  4CK4 A;  3JSQ A;  1SWB A;  2MF6 A;  4ORS A;  4BQU A;  4YKO A;  4FGI B;  4I3C A;  2G8C O;  4K19 A;  3SAO A;  5IRU A;  5LJE A;  4L3R A;  1OEK A;  3RE6 A;  1ERX A;  2HZR A;  4NP1 A;  2ACP X;  2OFR X;  2X8F A;  3BDR A;  5D8J A;  2OFB A;  5H9L A;  3UEX A;  1SWK A;  3RY2 A;  2I5Z O;  2LKK A;  3STN A;  3RY1 A;  1FDQ A;  4TKB A;  1KQX A;  5B5F A;  1BSO A;  1UYN X;  3EC5 A;  3OD9 A;  4RUN A;  2K23 A;  4QGX A;  3FID A;  1T8V A;  3ZW1 A;  1N7Y A;  1O1V A;  1W5R A;  1E02 A;  2DJF A;  2Z4H A;  5F2B A;  5JR8 A;  5LKE A;  1SWO A;  2RTI B;  1LUQ A;  4XMF A;  5DPQ A;  5F6Z A;  2Q9S A;  5LJD A;  1ACD A;  1LCW A;  3SLJ A;  5H9A A;  1N0S A;  4MIS A;  5K06 A;  1VYF A;  4CPF A;  2GC9 A;  1ZNL A;  1LDQ A;  2F73 A;  4JGL A;  4NV7 A;  4AZR A;  4YDA A;  2CM9 A;  4CDC A;  2CBR A;  3NQ3 A;  1SWN A;  4BX5 A;  4YFQ A;  5L3Y A;  1QY2 A;  4KT5 A;  4TJZ A;  4AZM A;  1VWD B;  1BRQ A;  2L9C A;  4B55 A;  2ALL X;  4ZJ0 A;  4DNE A;  5LJB A;  3HWF A;  3NR3 A;  3CKF A;  4Z2O A;  2NNQ A;  3KFG A;  5DG4 A;  2OVD A;  1SXY A;  3DSZ A;  3EYC A;  3BU9 A;  4UU2 A;  3APU A;  5AQ6 A;  1KT4 A;  3ZW2 A;  1ERB A;  4A8Z A;  3MG5 A;  1ICM A;  3D9W A;  2G7B A;  2KTD A;  4YH0 A;  5JD2 A;  2OVE A;  3HOL A;  2G79 A;  2LFO A;  4Z2P A;  5D45 A;  1RLB E;  4FBO A;  3PH5 A;  2AT8 X;  3VG6 A;  1I05 A;  1STP A;  2WEW A;  3P6H A;  2L67 A;  3QKG A;  3T1D A;  1XKI A;  2A3F X;  1X8N A;  3WJF A;  5HCE C;  2G78 A;  1IIU A;  1E2T A;  1VYO A;  3KQ0 A;  3UEU A;  2Z4I A;  4ZHD A;  1JV4 A;  5EZ2 A;  3FW5 A;  1G85 A;  4GDZ A;  3RDS A;  2RTK A;  2AH7 X;  3VG5 A;  5B3M O;  4O4X A;  1ZRY A;  1E06 A;  3NBX X;  1SXX A;  2HKD A;  4NNT A;  1KL5 A;  3FLL A;  4UU3 A;  1KXO A;  2A0A A;  4PJ2 A;  4RUU A;  2QOS C;  1B56 A;  1OPB A;  4I3B A;  3RDM A;  2AVI A;  1HQQ A;  1DZP A;  3L4R A;  1QY1 A;  3P24 A;  4IB7 A;  2W2B A;  2PI3 O;  3VE1 A;  1PEE A;  4EKV A;  1SMP I;  3N91 A;  4LKP A;  1Y9L A;  3BX8 A;  3ZW1 B;  1QWD A;  2YG2 A;  2RCT A;  2JGS A;  2F09 A;  3IA8 A;  4AW8 A;  1SWP A;  3SZH A;  1AVG I;  2BC3 A;  1SRE A;  3SZJ A;  3CMP A;  1JBH A;  3PH6 A;  2A5C A;  1FE3 A;  3FA7 A;  1OBP A;  3VG7 A;  5D48 A;  5HCC C;  1LNM A;  3B2H A;  4ML7 B;  4O4U A;  4N7C A;  1SWT A;  2P8G A;  3BX7 A;  1VWA B;  3OE3 A;  4GH7 A;  3PQU A;  3FEN A;  3ZI8 A;  2A2U A;  3TF6 A;  2W2A A;  1IFC A;  2GTL M;  4IB9 A;  4WBK A;  3S60 A;  2R73 A;  2A2G A;  3FR2 A;  1EQD A;  2I5V O;  3FYF A;  4NLI A;  5C0N A;  4EFG A;  1G74 A;  4U8U N;  3P02 A;  1I78 A;  1QY0 A;  5BVS A;  4ZHC A;  4OMX A;  4YCH A;  3ELZ A;  5L8N A;  1Y9T A;  2AMM X;  3RBY A;  2IZH B;  3WZN A;  2MHD A;  1LDO A;  1HBP A;  1SY2 A;  2FLJ A;  2KTS A;  1I06 A;  3VGW A;  3OBL A;  2IZK A;  4DQ4 A;  4ZFX A;  2OL8 O;  4QGW A;  1YUP A;  1YWD A;  4MVL A;  3STM X;  4GNY A;  1WBI A;  3VHH A;  2QM9 A;  4I95 A;  5CYB A;  1X8Q A;  5B10 O;  1LCV A;  3S26 A;  3O19 A;  2LBV A;  3WZP A;  2FS6 A;  1WUB A;  2KW1 A;  3CKG A;  4GKC A;  3VG2 A;  2QOM A;  2ACO A;  4XME A;  1MEP A;  1KQW A;  1NP1 A;  2WPU A;  2BSZ A;  5H8T A;  2A8G A;  1JJU A;  3VG3 A;  4KCA A;  5EEE A;  2WR6 A;  4YGH A;  4CPE A;  1JJX A;  1BJ7 A;  3CR6 A;  1MM9 A;  1BWY A;  4GJS A;  1IKE A;  1DZJ A;  3KZA A;  2IZF B;  2E4J A;  4IAB A;  2VDF A;  3CBS A;  1KZX A;  1GM6 A;  1IW2 A;  3VE2 A;  4QNI A;  4BVM A;  3D96 A;  1SXW A;  1IFB A;  5AEO A;  1FEM A;  2FTB A;  1SWJ A;  4AZQ A;  1G5W A;  5LKF A;  3SLO A;  4HPD A;  1PTS A;  5LJG A;  3QQ2 A;  2X4M A;  4TNN A;  4YGG A;  1YP6 A;  2BT9 A;  3Q34 A;  3ZUO A;  2RD7 C;  2C1S A;  5B2A O;  4CV7 A;  2HYS A;  5IO6 A;  4ZH9 A;  4O9S A;  2QMI A;  4Z6J A;  1SLD B;  2RCQ A;  3EBK A;  1YWA A;  1BSY A;  3FMZ A;  1FEN A;  3HWD A;  3PEC A;  4KH8 A;  4LZV A;  3FEP A;  3HWG A;  4YDB A;  1HMR A;  1ZNK A;  1URE A;  1T68 X;  2IZI A;  1D2U A;  1VWQ B;  3RDQ A;  1EUO A;  3B2K A;  3FA9 A;  4KC7 A;  1EAL A;  3APW A;  4YBU A;  3BRN A;  1LID A;  3RDU A;  5EPQ A;  1GX9 A;  4CDF A;  3B2I A;  3BU1 A;  2KD2 A;  3ELX A;  1SWF A;  4ZHF A;  1QQS A;  4ZHG A;  1GT4 A;  2Y32 A;  3OJY C;  3HOE A;  3FEL A;  2L5P A;  1DC9 A;  1KT7 A;  1MX8 A;  4OS3 A;  2BHV A;  4IB6 A;  1OPA A;  4QRL A;  2GTF X;  2Y3F A;  2X46 A;  4CSB A;  3FDC A;  1GGL A;  4Y0S A;  4TQ2 A;  1HQP A;  4JNJ A;  1K24 A;  4WHI A;  1Y52 X;  3NX2 A;  3ZQ3 A;  2FT9 A;  2DJG A;  1JJJ A;  3GAQ A;  1VWB B;  1QG5 A;  4WFV A;  2N93 A;  3G7X A;  5KIC A;  2FRS A;  2IZE B;  2NP1 A;  2OFA A;  4HFO A;  3T6L A;  4I6S A;  5HZ9 A;  2OY1 O;  5CE4 A;  1LKE A;  3EMM A;  1VPR A;  4BCS A;  2XKL A;  4A60 A;  2JU3 A;  4BX5 B;  1BLR A;  3HTY A;  1JMX A;  4A1H A;  3IFB A;  1GX3 A;  4EXZ A;  1U18 A;  2BS5 A;  1YWB A;  2KT4 B;  2RTR B;  4QYN A;  3UEW A;  4XMG A;  1SLE B;  1X89 A;  2XST A;  1AVD A;  3F6Z B;  4HWM A;  4GU8 A;  3T2X A;  4EEJ A;  4Z2V A;  4O49 A;  2CZT A;  3FW4 A;  1STS B;  2QO4 A;  1SY0 A;  4D6A A;  2WUT A;  2LBA A;  4QYP A;  4BGF A;  1Y53 X;  3BLG A;  4I9R A;  1EIO A;  1UZ2 X;  2WQ9 A;  1IKJ A;  4YGZ A;  4ES7 A;  3LTW A;  1N43 A;  2GTL O;  3EM0 A;  3ZUI A;  4FBR A;  2FWV A;  5CHK A;  4M6S A;  2OY5 O;  1U17 A;  2RTN B;  2X8S A;  2AT6 X;  4QAE A;  3D97 A;  2UZ2 A;  3FA8 A;  4Z28 A;  3S5X A;  3GE2 A;  3TGA A;  3WZO A;  4ARH A;  5IO7 A;  5IXG A;  1SY3 A;  2POA A;  1SWS A;  2RQ0 A;  2X56 A;  3RZY A;  1A3Y A;  2RTM A;  1KFF A;  1KL4 A;  1AB0 A;  1KL3 A;  3KFH A;  1U0X A;  3KFF A;  1LIB A;  2Q39 A;  4PSQ A;  3S5V A;  3H3I A;  3U9P C;  4ZGU A;  2RTE B;  1IJ8 A;  4OS8 A;  2IZB A;  2RTH B;  4OKA A;  2G5L A;  1HXZ A;  1ICN A;  5K68 A;  3WJD A;  3B2J A;  1GKA A;  2FR2 A;  5HZ8 A;  4Y0P A;  2CM4 A;  2K62 A;  1PM1 X;  3KFI A;  2JMB A;  2X55 A;  4IAX A;  1LIE A;  4U46 A;  1VWJ B;  1VWI B;  2X32 A;  1OEJ A;  3AEH A;  2RTF B;  2W2F A;  3PPT A;  4OEM A;  1DF8 A;  3P6G A;  1GKA B;  3P6D A;  3D95 A;  1YP7 A;  3WJG A;  1ZNE A;  4IAW A;  2OY7 A;  1NBX A;  4U8U M;  3U03 A;  5IRA A;  3FR4 A;  4Y0R A;  1PBO A;  1RAV A;  4FQB B;  5HTE A;  1SRI A;  1Z24 A;  1OBU A;  1SWA A;  3NAD A;  1CJ5 A;  3FR5 A;  1ZND A;  1P6P A;  1ZNH A;  1DFV A;  3AKN A;  1JYJ A;  4QZT A;  1TW4 A;  2FGS A;  3PK2 A;  3UEV A;  4COT A;  4KC8 A;  4AZN A;  4O3Z A;  5HCD C;  4ORU A;  4I9S A;  2VFB A;  4N7D A;  1TXL A;  4O3W A;  1CBI A;  3WZQ A;  5HA1 A;  1H91 A;  2HZQ A;  3VU1 A;  4LZU A;  4MVI A;  4XMH A;  4ORX A;  4YFP A;  2OL7 A;  1HY2 A;  4ORW A;  5FQ8 E;  3I0A A;  4BOE A;  2QCB A;  2RTJ A;  4ZHH A;  3K3L A;  1VWF B;  4INN A;  2RTQ B;  4IRW A;  5HA0 A;  1RSU B;  2IZG B;  2Y3E A;  3UAQ A;  1SWR A;  1LEL A;  3T6F A;  1LCZ A;  1O8V A;  4JO6 A;  3ZWE A;  4R0B A;  5HZ6 A;  4YFR A;  1VWH B;  4M7M A;  2VFC A;  4NW4 A;  1BBP A;  3FIQ A;  4GUZ A;  1N9Y A;  5D4A A;  4Y59 A;  4ZCB A;  1VWG B;  1X8O A;  2GJ5 A;  2C4I A;  4GZV A;  5FQ7 E;  3WYP A;  4ON1 A;  1SY1 A;  2OZQ A;  2C1Q A;  1EXS A;  3WJC A;  2NND A;  1EW3 A;  1MOY A;  3I17 A;  4TKH A;  2IZA A;  5HZ5 A;  1BSQ A;  5BVT A;  5KID A;  1AQB A;  1OSP O;  1SWG A;  3NQ9 A;  4I3D A;  2FKG A;  4QZU A;  5F58 A;  1LIC A;  1NQM A;  1JYD A;  2IZJ A;  2UYW A;  4GRJ A;  1HMS A;  1EPB A;  4ZR2 A;  2LB6 A;  4D6B A;  3VG4 A;  1N9M A;  5H9K A;  1KOI A;  1VWM B;  4OMW A;  3WJE A;  1RXJ A;  2BS6 A;  5EED A;  2MWH A;  2OFM X;  1MUP A;  2Q2M A;  3NPO A;  2RA6 A;  1KT5 A;  3RSW A;  4ALB A;  2RTO B;  3CQR A;  3BSZ E;  1HMT A;  3LV4 A;  4GK9 A;  5BYP A;  1E00 A;  3D4R A;  4ALO A;  2WWP A;  2ASN X;  2CBS A;  1KZW A;  2FKJ A;  3MM0 A;  1W4T A;  5IRW A;  3O2Y A;  1NC9 A;  1ZNG A;  3NX1 A;  1I04 A;  2FHN X;  3WOV A;  4MVK A;  3AUM O;  1MX7 A;  1ML7 A;  2FS7 A;  4NLJ A;  5LJH A;  1JQP A;  2X8T A;  1SXU A;  5FAZ A;  5EDC A;  1SRG A;  1GXA A;  4EDE A;  2QO6 A;  1MK5 A;  3B2L A;  3ZZV A;  1FJ1 E;  3O22 A;  2JN3 A;  5H9N A;  3PQS A;  1DF3 A;  4IMO A;  4QGV A;  1QAB E;  1BM5 A;  1KGL A;  4AYH A;  2IFB A;  1SWE A;  1HXL A;  4JHQ A;  5B5G A;  2AKQ A;  1I4U A;  4KII A;  4AZP A;  5FEN A;  3HK1 A;  1JIW I;  4C5P A;  4BX7 A;  1YWC A;  1VWC B;  3MX7 A;  1KT6 A;  4MIR A;  5IO5 A;  4BJ8 A;  1NGL A;  1VWR B;  3TZS A;  1I9H A;  2RTA A; 
#chains in the Genus database with same CATH homology
 5HBS A;  4XMD A;  1CBS A;  5B29 A;  3SOT A;  2HNX A;  2DM5 A;  1CRB A;  3RKG A;  5B27 A;  2OVA A;  3PED A;  4ZGF A;  2WEX A;  5BVQ A;  2MJI A;  4GE1 A;  3TGC A;  1ADL A;  3WVM A;  1T0V A;  1DZK A;  1VYG A;  4EQA C;  3DTQ A;  1CBQ A;  3NP1 A;  1GX8 A;  3P6F A;  3ZW0 A;  2MO5 A;  1A57 A;  4U9C A;  1R0U A;  2BLG A;  4U8U O;  3AKM A;  5HTD A;  4TLJ A;  3MBT A;  5F6B A;  4NYQ A;  2HLV A;  2R56 A;  4O3Y A;  4YBP A;  3BS2 A;  3ZW0 B;  4IBA A;  2AL0 X;  4U3Q A;  5HWZ A;  1AEL A;  2PY1 A;  1PMP A;  4FBV A;  3WJB A;  3VPJ E;  3Q6L A;  4A1Y A;  1LFO A;  3EBW A;  4AZO A;  1XCA A;  2WQA E;  1OBQ A;  4QQ1 A;  3WBG A;  3C78 X;  1S7D A;  2Q2P A;  4HPC A;  1HBQ A;  1FTP A;  5AJC A;  5D47 A;  5L8I A;  1QFT A;  3P6C A;  2O62 A;  1EI5 A;  5LJK A;  1O1U A;  4GNW A;  4GET A;  2JU7 A;  4OS0 A;  4Y0Q A;  3HWE A;  2A13 A;  4MVE A;  3BY0 A;  4IMN A;  5HZQ A;  2WSJ A;  1JZU A;  5HAE A;  1S2P A;  4L1N A;  2AT0 X;  1KT3 A;  1B4M A;  3V8U A;  2ANS A;  2CZU A;  1TOW A;  2ZAG A;  3CBC A;  1DZM A;  1L6M A;  1BRP A;  2X45 A;  2JU8 A;  3P6E A;  4ID2 A;  2AT5 X;  1YIV A;  5FFH A;  4O4O A;  1E5P A;  4WFU A;  1LPJ A;  3U0D A;  4TKJ A;  1B0O A;  4O4S A;  4ZH6 A;  3APX A;  1RBP A;  3FEK A;  1D3S A;  1B8E A;  4ORR A;  1EII A;  3JQO A;  3C77 X;  4DQ3 A;  1A2D A;  2EU7 X;  3RWX A;  2MM3 A;  2RN4 A;  1LIF A;  4HPB A;  3LHN A;  4LKT A;  5KHP A;  2GTL N;  4YMY A;  5LJC A;  3C76 X;  5EDB A;  3CWK A;  2OVS A;  3TGB A;  1CBR A;  1TOU A;  2AT3 X;  1DV9 A;  1S44 A;  1X71 A;  2QO5 A;  5AJB A;  1X8P A;  3F9D A;  1LF7 A;  1QFV A;  2M4L A;  4ODD A;  4NNS A;  3WXQ A;  2FR3 A;  3E3C A;  1GT3 A;  1BEB A;  2NNE A;  2YMS A;  1GT5 A;  4ORY A;  1TVQ A;  4YCE A;  2Q4N A;  1MDC A;  2JOZ A;  1SA8 A;  1EPA A;  1G7N A;  4HPA A;  2JW1 A;  2ZAI A;  3NQK A;  3STK A;  1OEE A;  3APV A;  4NYR A;  2LA7 A;  4LQZ A;  1X8U A;  1A18 A;  5FQ6 E;  1FEL A;  4O3X B;  3JS1 A;  3FA6 A;  2R74 A;  1MVG A;  1GT1 A;  3MVF A;  3F8A A;  4XMC A;  2HMB A;  2L68 A;  4IB8 A;  5L8O A;  3CQN A;  1ALB A;  3PP6 A;  1HN2 A;  5F7G A;  5F1E A;  1NP4 A;  4YKM A;  4CK4 A;  3JSQ A;  4ORS A;  4BQU A;  4YKO A;  4FGI B;  4I3C A;  4K19 A;  3SAO A;  5LJE A;  4L3R A;  1OEK A;  1ERX A;  2HZR A;  4NP1 A;  2ACP X;  2OFR X;  2X8F A;  3BDR A;  5D8J A;  5H9L A;  3UEX A;  3STN A;  2LKK A;  4TKB A;  1FDQ A;  1KQX A;  1BSO A;  3OD9 A;  4RUN A;  2K23 A;  4QGX A;  1T8V A;  1O1V A;  1E02 A;  2Z4H A;  5JR8 A;  5LKE A;  5DPQ A;  4XMF A;  5LJD A;  5F6Z A;  2Q9S A;  1ACD A;  5H9A A;  1N0S A;  4MIS A;  5K06 A;  1VYF A;  2GC9 A;  1ZNL A;  2F73 A;  4JGL A;  4AZR A;  4YDA A;  2CM9 A;  2CBR A;  3NQ3 A;  4YFQ A;  1QY2 A;  4KT5 A;  4TJZ A;  4AZM A;  1BRQ A;  2L9C A;  4ZJ0 A;  2ALL X;  5LJB A;  3HWF A;  3NR3 A;  2NNQ A;  3KFG A;  5DG4 A;  2OVD A;  1SXY A;  3DSZ A;  3EYC A;  3BU9 A;  4UU2 A;  3APU A;  5AQ6 A;  1KT4 A;  3ZW2 A;  1ERB A;  4A8Z A;  1ICM A;  2G7B A;  2KTD A;  4YH0 A;  2OVE A;  2G79 A;  2LFO A;  5D45 A;  1RLB E;  4FBO A;  3PH5 A;  2AT8 X;  3VG6 A;  1I05 A;  2WEW A;  3P6H A;  2L67 A;  3QKG A;  3T1D A;  1XKI A;  2A3F X;  1X8N A;  3WJF A;  5HCE C;  2G78 A;  1IIU A;  3KQ0 A;  3UEU A;  4ZHD A;  2Z4I A;  1JV4 A;  5EZ2 A;  3FW5 A;  1G85 A;  4GDZ A;  3VG5 A;  2AH7 X;  4O4X A;  1ZRY A;  1E06 A;  3NBX X;  1SXX A;  4NNT A;  3FLL A;  4UU3 A;  3ZW1 A;  1KXO A;  2A0A A;  4PJ2 A;  4RUU A;  2QOS C;  1B56 A;  1OPB A;  4I3B A;  4BVM A;  3L4R A;  1DZP A;  1QY1 A;  3P24 A;  4IB7 A;  2W2B A;  3VE1 A;  1PEE A;  1SMP I;  3N91 A;  4LKP A;  1Y9L A;  3BX8 A;  3ZW1 B;  1QWD A;  2YG2 A;  2RCT A;  2F09 A;  3IA8 A;  4AW8 A;  1AVG I;  3CMP A;  1JBH A;  3PH6 A;  1FE3 A;  3FA7 A;  1OBP A;  3VG7 A;  5D48 A;  5HCC C;  1LNM A;  3B2H A;  4ML7 B;  4O4U A;  4N7C A;  2P8G A;  3OE3 A;  4GH7 A;  3PQU A;  3FEN A;  3ZI8 A;  2A2U A;  3TF6 A;  2W2A A;  1IFC A;  2GTL M;  4IB9 A;  4WBK A;  3S60 A;  2R73 A;  2A2G A;  3FR2 A;  1EQD A;  3FYF A;  4NLI A;  5C0N A;  4EFG A;  1G74 A;  4U8U N;  3P02 A;  1QY0 A;  5BVS A;  4ZHC A;  4OMX A;  4YCH A;  3ELZ A;  5L8N A;  1Y9T A;  2AMM X;  3RBY A;  2MHD A;  1HBP A;  1SY2 A;  2FLJ A;  2KTS A;  1I06 A;  3OBL A;  4DQ4 A;  4ZFX A;  4QGW A;  1YUP A;  1YWD A;  4MVL A;  3STM X;  4GNY A;  2QM9 A;  4I95 A;  5CYB A;  1X8Q A;  3S26 A;  3O19 A;  2LBV A;  2FS6 A;  2KW1 A;  4GKC A;  3VG2 A;  4XME A;  2ACO A;  1NP1 A;  1KQW A;  5H8T A;  3VG3 A;  4KCA A;  5EEE A;  2WR6 A;  4YGH A;  1BJ7 A;  3CR6 A;  1BWY A;  1IKE A;  1DZJ A;  3KZA A;  2E4J A;  4IAB A;  3CBS A;  1KZX A;  1GM6 A;  1IW2 A;  3VE2 A;  4QNI A;  3D96 A;  1SXW A;  1IFB A;  5AEO A;  1FEM A;  2FTB A;  4AZQ A;  1G5W A;  5LKF A;  4HPD A;  5LJG A;  4TNN A;  4YGG A;  1YP6 A;  2BT9 A;  3ZUO A;  2RD7 C;  4CV7 A;  2HYS A;  5IO6 A;  4ZH9 A;  4O9S A;  2QMI A;  2RCQ A;  3EBK A;  1YWA A;  1BSY A;  3FMZ A;  1FEN A;  3HWD A;  3PEC A;  4KH8 A;  4LZV A;  3FEP A;  3HWG A;  4YDB A;  1HMR A;  1ZNK A;  1URE A;  1T68 X;  1D2U A;  1EAL A;  1EUO A;  3B2K A;  3FA9 A;  4KC7 A;  3APW A;  4YBU A;  3BRN A;  1LID A;  5EPQ A;  1GX9 A;  3B2I A;  3BU1 A;  2KD2 A;  3ELX A;  4ZHF A;  1QQS A;  4ZHG A;  1GT4 A;  3OJY C;  3HOE A;  3FEL A;  2L5P A;  1DC9 A;  1KT7 A;  1MX8 A;  4OS3 A;  2BHV A;  4IB6 A;  1OPA A;  4QRL A;  2GTF X;  2X46 A;  4CSB A;  1GGL A;  4Y0S A;  4TQ2 A;  1HQP A;  4WHI A;  1JJJ A;  3NX2 A;  3ZQ3 A;  2FT9 A;  3GAQ A;  1QG5 A;  4WFV A;  2N93 A;  3G7X A;  5KIC A;  2FRS A;  2NP1 A;  4HFO A;  4I6S A;  5HZ9 A;  5CE4 A;  1LKE A;  3EMM A;  1VPR A;  2XKL A;  4A60 A;  2JU3 A;  1BLR A;  3HTY A;  4A1H A;  3IFB A;  4EXZ A;  1U18 A;  2BS5 A;  1YWB A;  2KT4 B;  4QYN A;  3UEW A;  4XMG A;  1X89 A;  2XST A;  3F6Z B;  4HWM A;  4GU8 A;  4EEJ A;  4O49 A;  2CZT A;  3FW4 A;  2QO4 A;  1SY0 A;  4D6A A;  2WUT A;  2LBA A;  4QYP A;  1EIO A;  3BLG A;  4I9R A;  1UZ2 X;  2WQ9 A;  1IKJ A;  4YGZ A;  4ES7 A;  2GTL O;  3EM0 A;  3ZUI A;  4FBR A;  2FWV A;  4M6S A;  1U17 A;  2X8S A;  2AT6 X;  4QAE A;  3D97 A;  3FA8 A;  3S5X A;  3TGA A;  5IO7 A;  3GE2 A;  4ARH A;  1SY3 A;  2POA A;  2RQ0 A;  3RZY A;  1A3Y A;  3KFH A;  1AB0 A;  1U0X A;  3KFF A;  1LIB A;  2Q39 A;  4PSQ A;  3S5V A;  3H3I A;  3U9P C;  4ZGU A;  4OS8 A;  1ICN A;  3WJD A;  3B2J A;  1GKA A;  2FR2 A;  5HZ8 A;  4Y0P A;  2CM4 A;  2K62 A;  1PM1 X;  3KFI A;  2JMB A;  4IAX A;  1LIE A;  1OEJ A;  3PPT A;  2W2F A;  3P6G A;  1GKA B;  3P6D A;  3D95 A;  1YP7 A;  3WJG A;  1ZNE A;  4IAW A;  3U03 A;  4U8U M;  3FR4 A;  4Y0R A;  1PBO A;  4FQB B;  5HTE A;  1Z24 A;  1OBU A;  3NAD A;  1CJ5 A;  3FR5 A;  1ZND A;  1P6P A;  1ZNH A;  1DFV A;  3AKN A;  1JYJ A;  4QZT A;  1TW4 A;  3UEV A;  4COT A;  4KC8 A;  4AZN A;  4O3Z A;  5HCD C;  4ORU A;  4I9S A;  4N7D A;  1TXL A;  4O3W A;  1CBI A;  5HA1 A;  1H91 A;  2HZQ A;  3VU1 A;  4LZU A;  4MVI A;  4XMH A;  4ORX A;  4YFP A;  4ORW A;  5FQ8 E;  4BOE A;  3I0A A;  4ZHH A;  3K3L A;  4INN A;  5HA0 A;  3UAQ A;  1O8V A;  3ZWE A;  4R0B A;  5HZ6 A;  4YFR A;  4M7M A;  4NW4 A;  1BBP A;  3FIQ A;  5D4A A;  4ZCB A;  1X8O A;  2GJ5 A;  4GZV A;  5FQ7 E;  4ON1 A;  1SY1 A;  2OZQ A;  1EXS A;  3WJC A;  2NND A;  1EW3 A;  3I17 A;  4TKH A;  5HZ5 A;  1BSQ A;  5BVT A;  5KID A;  1AQB A;  3NQ9 A;  4I3D A;  4QZU A;  5F58 A;  1LIC A;  1JYD A;  4GRJ A;  1HMS A;  1EPB A;  4ZR2 A;  2LB6 A;  4D6B A;  3VG4 A;  5H9K A;  1KOI A;  4OMW A;  3WJE A;  2BS6 A;  5EED A;  2MWH A;  2OFM X;  1MUP A;  2Q2M A;  3NPO A;  2RA6 A;  1KT5 A;  3RSW A;  4ALB A;  3CQR A;  1JJX A;  3BSZ E;  1HMT A;  3LV4 A;  4GK9 A;  5BYP A;  1E00 A;  3D4R A;  4ALO A;  2WWP A;  2ASN X;  2CBS A;  1KZW A;  3O2Y A;  3NX1 A;  1ZNG A;  1I04 A;  3WOV A;  4MVK A;  1MX7 A;  1ML7 A;  2FS7 A;  4NLJ A;  5LJH A;  5FAZ A;  2X8T A;  1SXU A;  5EDC A;  1GXA A;  4EDE A;  2QO6 A;  3B2L A;  3ZZV A;  3O22 A;  2JN3 A;  5H9N A;  3PQS A;  1DF3 A;  4IMO A;  4QGV A;  1QAB E;  1BM5 A;  1KGL A;  4AYH A;  2IFB A;  4AZP A;  2AKQ A;  1I4U A;  4KII A;  5FEN A;  3HK1 A;  1JIW I;  1YWC A;  3MX7 A;  5IO5 A;  1KT6 A;  4MIR A;  3TZS A;  1NGL A;  3HOL A;  3BX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...