4GETA

Crystal structure of biogenic amine binding protein from rhodnius prolixus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
SGCSTVDTVKDFNKDNFFTGSWYITHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYLYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Amine-binding protein
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
total genus 55
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4getA00
3VG2A 1HMTA 1OBQA 4EFGA 1MX8A 3WBGA 4D6AA 2NNEA 1TXLA 4YGHA 5HTDA 2RCQA 4ZFXA 1ZNGA 2R73A 2X45A 4YDBA 1AB0A 2ASNX 1MDCA 1TW4A 2OVEA 3KZAA 5EDCA 4ZJ0A 3WJBA 1LF7A 1S44A 1CBIA 1YWAA 3AKNA 2FR2A 4TJZA 3UEVA 2FS6A 4NYQA 2HZQA 3PH6A 1PMPA 3KFHA 2HZRA 3CMPA 3PH5A 1KT7A 5FAZA 5LJKA 5HZ5A 1AELA 1ZRYA 2ANSA 3PP6A 1OBPA 2G79A 3HK1A 4OS8A 1QY2A 1TVQA 4NNTA 4NYRA 1DZJA 3NQ3A 5HBSA 5LJDA 1KT4A 3B2KA 1SY0A 3BX7A 1LFOA 3NQ9A 2ACOA 1I04A 3FEKA 3Q6LA 4GE1A 3C77X 5D48A 2QO4A 4BOEA 2A2GA 2NNDA 1YP6A 3P6HA 1GGLA 3B2HA 1A57A 1ZNLA 3P6FA 1RLBE 4HPDA 3G7XA 5LJBA 1PBOA 1ICMA 1LNMA 1MVGA 2KT4B 4AZPA 2NP1A 1PM1X 2HNXA 3U0DA 4ZHCA 1GX8A 4OS3A 1NP1A 1QY1A 4WFUA 1DZKA 3EYCA 1EPBA 4YCHA 3FEPA 1KT6A 2DM5A 5B27A 3WJFA 5BVTA 3NPOA 4AZNA 3KQ0A 1LIDA 1DC9A 4I9RA 1X8QA 3FIQA 2FRSA 4ZHGA 3HWDA 3STKA 4MVLA 3BRNA 2HYSA 2AL0X 3JSQA 4AZOA 2WWPA 1BSYA 4PSQA 4XMHA 2AMMX 4YFQA 1A18A 3P6DA 5LKEA 4EEJA 3P6CA 2F73A 1QWDA 1GKAA 5EEEA 3D97A 4A1HA 2LB6A 2FR3A 1SXUA 3B2JA 1IKEA 1MX7A 3F9DA 5L8IA 1GXAA 1EW3A 1FDQA 2JU7A 2WEWA 2WQ9A 4EXZA 2K62A 3FW4A 3KFGA 4ZCBA 3MVFA 1YWCA 1KGLA 2A2UA 1KZXA 1CRBA 3JS1A 1LIFA 1SY3A 1O1UA 4YFPA 5D45A 4AZQA 1VYGA 2Q2PA 3D95A 2CBRA 2E4JA 3O2YA 5HZQA 1YWDA 5HAEA 3OJYC 5H9KA 1JYJA 1OEJA 2W2AA 2CZTA 4R0BA 4TKJA 1B56A 3BSZE 5LKFA 1FELA 3F8AA 3P6EA 3UEXA 3BDRA 4IMOA 5IO7A 4IB9A 3VG7A 1SA8A 5F1EA 1Z24A 4QGXA 1ALBA 2A13A 1KT3A 1ERXA 4N7DA 5EEDA 1B8EA 4N7CA 4ALBA 4TKBA 1OBUA 4GKCA 4ORSA 5AQ6A 4NNSA 1G74A 3T1DA 4A1YA 5B29A 2R56A 3BU9A 4CK4A 2ALLX 3PPTA 1EXSA 2OVAA 2XKLA 1KT5A 4KIIA 1E00A 1X89A 4QYNA 4YGGA 2AT6X 2Q39A 5LJHA 1SXWA 4GH7A 4YCEA 4O9SA 5H9LA 2X46A 1X8NA 1QG5A 3CBCA 1GT4A 2FTBA 1MUPA 1O1VA 1G85A 3C78X 4Y0RA 3EBWA 3WJDA 2Q2MA 4Y0PA 1U18A 4ORYA 1OEEA 1HMRA 2RA6A 4HPBA 4ZHDA 1LIEA 1XCAA 2N93A 2P8GA 5EZ2A 1EQDA 2QM9A 1YWBA 4TKHA 4IB6A 5HTEA 1BLRA 5HCDC 1DF3A 1X8PA 1CBRA 3FLLA 4AZRA 4LKPA 4YBPA 1DFVA 1I4UA 3NADA 1S7DA 2POAA 1GT5A 3P6GA 4ORRA 4ZGUA 2LKKA 1HMSA 1O8VA 3FR5A 5LJEA 1VPRA 1YP7A 2AT3X 3EM0A 3QKGA 1OPBA 3VG3A 1OPAA 1CJ5A 1KQXA 3TF6A 3RZYA 5F7GA 1ZNDA 4Y0QA 2RQ0A 3ELZA 3CQNA 1SXXA 3APVA 4Y0SA 3I17A 4YKMA 1G5WA 4ES7A 4EDEA 5HA1A 4AW8A 1AVGI 1LICA 3ZQ3A 3CQRA 1X8UA 2CZUA 4I3CA 5KIDA 3NR3A 3BX8A 4IB8A 2OVDA 1IW2A 2QO6A 1D3SA 1BRQA 4GETA 3FR4A 3HWFA 4A60A 1GX9A 5H8TA 4YGZA 3ZUOA 2ACPX 2RD7C 5FENA 4IAXA 1PEEA 2Q9SA 3CBSA 1LKEA 2L9CA 3FENA 4OS0A 1R0UA 1L6MA 1NP4A 5HZ8A 1JBHA 1IKJA 4XMCA 3MBTA 3BY0A 3EBKA 4I3DA 4I3BA 3KFIA 1FTPA 1SY2A 5LJCA 1HQPA 1DZPA 1ERBA 1RBPA 5HWZA 1BWYA 2A0AA 4IBAA 4XMFA 3TGAA 3CR6A 2YG2A 4WBKA 3O22A 1U17A 2L67A 4XMEA 4ALOA 1FE3A 1EIOA 1AQBA 1IFBA 4IB7A 1BSOA 5D47A 3WJCA 1JZUA 1B4MA 3IA8A 5DPQA 1A2DA 3UEUA 1DZMA 1EALA 1YUPA 4ORUA 4YDAA 3B2IA 5F6BA 4RUUA 1FENA 3VG4A 2WUTA 3STMX 2GC9A 5IO5A 4DQ4A 2K23A 4QGWA 5BVQA 1BJ7A 1JV4A 3GAQA 1SXYA 2JU8A 1GKAB 1GT1A 4OMWA 1HBPA 4UU2A 2Q4NA 3NX2A 4M6SA 2L5PA 1IFCA 4NLJA 1BBPA 2CBSA 4LZVA 4RUNA 1QY0A 3K3LA 3U03A 4HPCA 5HCEC 2R74A 2CM9A 1QQSA 4TLJA 2HMBA 2PY1A 4A8ZA 2MJIA 1XKIA 4YBUA 1ML7A 2JN3A 3AKMA 2O62A 1I05A 1CBQA 1JYDA 4XMGA 2BLGA 2WR6A 2A3FX 2QOSC 2G78A 2L68A 2HLVA 4K19A 3ZUIA 5HZ6A 2W2BA 3EMMA 4ORWA 4ARHA 2CM4A 4QZUA 4AZMA 3NX1A 1VYFA 2QO5A 1T8VA 5IO6A 3FR2A 2MM3A 4HFOA 4YKOA 1A3YA 2LBAA 5HA0A 1KQWA 1EPAA 1HN2A 2G7BA 2FS7A 3L4RA 2AH7X 1OEKA 2GTFX 5EDBA 1X71A 3B2LA 3STNA 3O19A 4ZR2A 3FA9A 3WJGA 4BQUA 4D6BA 1P6PA 3APWA 2LFOA 4ZHFA 3WVMA 4UU3A 5KHPA 1HBQA 1TOWA 1NGLA 2AT8X 3TZSA 1KXOA 3TGBA 1UZ2X 4QGVA 3FA6A 2AKQA 1ACDA 3APUA 3KFFA 3FA8A 1X8OA 2OZQA 4YMYA 1ICNA 1BSQA 3UEWA 1KOIA 4ZH6A 2W2FA 2XSTA 4YFRA 1BEBA 1B0OA 3VG5A 1GT3A 1I06A 4AYHA 3I0AA 3SAOA 3BS2A 3RSWA 5L8NA 4DQ3A 1H91A 4OMXA 4TNNA 1E5PA 3WXQA 5CE4A 1LPJA 4ORXA 3PECA 2FLJA 1E06A 1FEMA 5L8OA 1KZWA 3HWEA 4ZH9A 4ZHHA 3IFBA 1SY1A 4NLIA 1QABE 2IFBA 2GJ5A 4GRJA 4I9SA 4LZUA 5BVSA 3S26A 2AT5X 5HCCC 5K06A 1IIUA 1N0SA 3C76X 4QAEA 1UREA 1DV9A 2LBVA 4MVIA 4ODDA 3ELXA 2OFMX 2OFRX 3APXA 1EUOA 1ZNEA 3DSZA 4BVMA 5KICA 2WQAE 3FW5A 4LKTA 1S2PA 2EU7X 1E02A 5DG4A 1CBSA 2FWVA 2JU3A 3CWKA 4IAWA 3TGCA 5C0NA 3FELA 4M7MA 5EPQA 4MVKA 1ADLA 1ZNKA 3DTQA 3FA7A 2FT9A 2JOZA 4GNYA 3D96A 3U9PC 1JJXA 5HZ9A 3BU1A 4YH0A 1U0XA 3PEDA 1QFTA 3HWGA 1YIVA 5D8JA 1BM5A 3BLGA 3FMZA 1EIIA 4TQ2A 1QFVA 4NP1A 3WJEA 1LIBA 1BRPA 5F58A 1ZNHA 4IMNA 1GM6A 4HPAA 4GNWA 3NP1A 1D2UA 2WSJA 5JR8A 1T68X 5FFHA 2AT0X 1G7NA 2KTDA 5LJGA 4QYPA 2MO5A 2NNQA 4XMDA 5H9AA 1TOUA 4QZTA 3VG6A 2WEXA 5D4AA 5F6ZA 4WFVA 1T0VA 2RCTA 1JJJA 5H9NA
chains in the Genus database with same CATH superfamily
3TGCA 3VG2A 1VWNB 1HMTA 1OBQA 4CPEA 4EFGA 1MX8A 3WBGA 4D6AA 2NNEA 1TXLA 4YGHA 5IRWA 5HTDA 2RCQA 4ZFXA 1ZNGA 4BCSA 2R73A 2I5ZO 2X45A 2X8FA 2KTSA 4YDBA 1AB0A 1STPA 2ASNX 4KC8A 1MDCA 1TW4A 2OVEA 3KZAA 5EDCA 4L1NA 4WHIA 3WJBA 1SWCA 4ZJ0A 1LF7A 1S44A 1CBIA 1NQNA 1YWAA 3AKNA 3H3IA 2FR2A 4TJZA 3UEVA 2FS6A 4NYQA 2HZQA 4B55A 3PH6A 1PMPA 3KFHA 2HZRA 3CMPA 1RSUB 1KT7A 3PH5A 5FAZA 2OL8O 3RE6A 1VWQB 3VPJE 3ZZVA 5LJKA 5HZ5A 1AELA 1ZRYA 2ANSA 3PP6A 1AVEA 1OBPA 2G79A 3HK1A 4OS8A 5IRAA 3CKGA 1QY2A 1TVQA 1SRHA 4NNTA 1DZJA 3NQ3A 4NYRA 5HBSA 1KT4A 3B2KA 5LJDA 1SWQA 3T6LA 4CV7A 1SY0A 3BX7A 5B2AO 4Z6JA 2GTLO 1LFOA 3NQ9A 2ACOA 1I04A 3FEKA 3Q6LA 4CSBA 2X55A 4NLIA 4GE1A 1WUBA 4O4OA 3C77X 5D48A 2QO4A 4BOEA 2A2GA 2NNDA 1YP6A 3P6HA 1GGLA 2X56A 3B2HA 1A57A 1ZNLA 3P6FA 1RLBE 2PI3O 3ZW0B 2RN4A 4HPDA 3G7XA 5LJBA 2FKGA 5IXGA 4GDAA 1PBOA 1ICMA 1LNMA 2BS5A 4NW4A 4GDZA 1MVGA 2KT4B 4AZPA 4Z2PA 3SZIA 5CYBA 2NP1A 1PM1X 2HNXA 3U0DA 4CPFA 2BHVA 4ZHCA 1GX8A 4OS3A 1SWBA 1NP1A 1VWFB 1QY1A 4WFUA 1DZKA 3EYCA 1EPBA 3RWXA 4YCHA 4BBOA 3FEPA 1KT6A 2DM5A 5B27A 3WJFA 5BVTA 3NPOA 4AZNA 3KQ0A 1LIDA 4GGZA 1DC9A 2IZFB 4GGRA 1X8QA 4I9RA 1Y52X 3FIQA 4L3RA 2FRSA 3EW1A 4ZHGA 3HWDA 4OELA 3STKA 1MOYA 4MVLA 3BRNA 1DF8A 1NDJA 3PK2A 2HYSA 2AL0X 3JSQA 4AZOA 2WWPA 4MVEA 1BSYA 4PSQA 4XMHA 2AMMX 1SREA 4MIRA 4YFQA 3MM0A 1A18A 3SZHA 3P6DA 5LKEA 1SLDB 4EEJA 3P6CA 2F73A 1QWDA 1GKAA 1RXKA 1HY2A 3D97A 5EEEA 3T2WA 4A1HA 4OEMA 2LB6A 4QQ1A 2FR3A 2X8TA 1SXUA 1SWEA 3B2JA 3ZWEA 1RXJA 1IKEA 1MX7A 3F9DA 5L8IA 1UYOX 2G5LA 1GXAA 1EW3A 1FDQA 2JU7A 1SWPA 1N9YA 2WEWA 2WQ9A 4EXZA 2K62A 3FW4A 3KFGA 4CPHB 1N9MA 4ZCBA 2FHNX 3MVFA 1OSPO 1YWCA 3VHMA 1KGLA 1KL3A 2A2UA 1KZXA 1CRBA 4INNA 3JS1A 1LIFA 1SY3A 1O1UA 4YFPA 5D45A 4FBOA 4AZQA 1VYGA 2Q2PA 3D95A 2CBRA 2VFCA 3LHNA 1SRGA 1FJ1E 1VWAB 2E4JA 2RTGB 3O2YA 5HZQA 4KH8A 2HKDA 1I78A 1YWDA 5HAEA 2JW1A 1JIWI 3OJYC 5H9KA 1JYJA 4BX5B 1OEJA 2W2AA 2CZTA 3F6ZB 4R0BA 4TKJA 1GX3A 1B56A 3BSZE 2QOMA 4HWMA 1FELA 2X4MA 5LKFA 3RKGA 3F8AA 3P6EA 3RDOA 4EKVA 3UEXA 3BDRA 3HOLA 4IMOA 5IO7A 4IB9A 4LQZA 3VG7A 1SA8A 5F1EA 1Z24A 2MHDA 1ALBA 2A13A 4QGXA 1KT3A 1ERXA 4N7DA 3S5XA 1EI5A 4JNJA 1E2TA 1B8EA 5EEDA 4N7CA 3ZW0A 4ALBA 5K67A 4TKBA 1OBUA 4O3WA 4GKCA 4ORSA 1SWNA 5AQ6A 4NNSA 1G74A 4Z28A 1SWGA 2RTHB 3T1DA 4A1YA 5B29A 1VWRB 1PBYA 2UYWA 2Y32A 2R56A 3CKFA 4GZVA 3BU9A 4CK4A 4Z27A 2ALLX 3PPTA 1EXSA 2AVIA 3WOVA 1MM9A 2OVAA 3LV4A 2XKLA 4KT5A 1KT5A 4KIIA 1E00A 1X89A 3E3CA 4QYNA 4YGGA 2AT6X 2Q39A 5LJHA 2RTFB 1SXWA 2IZBA 4GH7A 4YCEA 4O9SA 5H9LA 4O49A 3RDMA 2X46A 1X8NA 1QG5A 2KW1A 1SWRA 3Q34A 3CBCA 1GT4A 2X8SA 4GJSA 2FTBA 3VGWA 1MUPA 1O1VA 1G85A 1STSB 3C78X 3SLOA 4Y0RA 1VWDB 1SRJA 3EBWA 3WJDA 2Q2MA 1NC9A 1UYNX 2IZHB 4Y0PA 1U18A 1KFFA 2IZAA 2OVSA 4ORYA 3VU1A 1VWLB 1OEEA 2C1SA 4U46A 1MK5A 1HQQA 1HMRA 2RA6A 3P02A 4HPBA 1VWBB 3RDXA 4ZHDA 1LIEA 1XCAA 2BC3A 2N93A 2P8GA 1EQDA 5EZ2A 3ZI8A 2QM9A 1YWBA 4TKHA 4IB6A 5HTEA 1BLRA 5HCDC 1DF3A 2Y3EA 1X8PA 4CDCA 1CBRA 3FLLA 1VWHB 1SMPI 4AZRA 2A5BA 2IZKA 4LKPA 4YBPA 1VWOB 1DFVA 3UAQA 2ZSCA 1I4UA 3NADA 1K24A 1S7DA 2POAA 4O3YA 1GT5A 3SLTA 1KL4A 3P6GA 4ORRA 2IZDB 3WYPA 4ZGUA 2LKKA 4O4SA 4CPHA 4CDEA 1HMSA 1O8VA 3FR5A 1SLFB 5LJEA 1JMXA 1VPRA 1YP7A 2AT3X 3EM0A 3QKGA 1OPBA 4JGLA 1LUQA 3VG3A 1LDOA 1OPAA 1KQXA 1CJ5A 3TF6A 1Y9LA 3RZYA 5F7GA 1RSTB 1ZNDA 4Y0QA 2RQ0A 4GD9A 1JQPA 3ELZA 3CQNA 4BJ8A 4BX5A 4DCBA 1VWEB 1SLGB 1SXXA 3APVA 2RTOB 3I17A 4Y0SA 3VE1A 2RTJA 4YKMA 1G5WA 4ES7A 4EDEA 5HA1A 4AW8A 1W6FA 5AJCA 1AVGI 2F09A 1LICA 3ZQ3A 3CQRA 1X8UA 2CZUA 4I3CA 4ZGFA 5KIDA 3NR3A 3BX8A 4IB8A 2OVDA 4U8UM 1IW2A 2QO6A 1D3SA 1BRQA 1AVDA 4GETA 3FR4A 1RAVA 3HWFA 1GX9A 5H8TA 3ZW1B 4YGZA 3ZUOA 4A60A 2VFBA 2ACPX 3T6FA 4IABA 2RD7C 5FENA 1JMZA 4IAXA 1PEEA 2QCBA 1HXZA 2Q9SA 3AEHA 5FQ6E 3CBSA 1LKEA 2L9CA 3FENA 4OS0A 4U8UN 3LTWA 1R0UA 1L6MA 1NP4A 2CAMA 5IRUA 3X00A 1IKJA 1N7YA 4XMCA 5HZ8A 1JBHA 3RDSA 4KC7A 3MBTA 4I6SA 3BY0A 3EBKA 4I3DA 4I3BA 3KFIA 1FTPA 1SY2A 5LJCA 1HQPA 1DZPA 1ERBA 1I9HA 1RBPA 5HWZA 1BWYA 2A0AA 2OFBA 4IBAA 1VWMB 4XMFA 4ID2A 3TGAA 2RTMA 1PTSA 2RTEB 2RTKA 2RTQB 2YG2A 3CR6A 1U17A 3O22A 4WBKA 2A8GA 2L67A 2OF9A 4XMEA 4ALOA 1FE3A 2MF6A 2RTBB 1EIOA 1AQBA 1IFBA 4MEEA 1Y0GA 3HPEA 2RTRB 4IB7A 1BSOA 5AJBA 2DJGA 5D47A 3S5VA 1SRIA 3WJCA 3FIDA 1LELA 1JZUA 3HTYA 3WZPA 1B4MA 3IA8A 5DPQA 1A2DA 3UEUA 5AEOA 1DZMA 1EALA 1YUPA 4ORUA 3VHIA 4YDAA 3FYFA 4CDDA 4FBRA 4GGTA 3B2IA 3OE3A 5F6BA 4RUUA 1LCVA 3VHHA 3WZNA 3D4RA 1FENA 3VG4A 2WUTA 1SWTA 3STMX 2GTLN 2GC9A 3EW2A 4BX7B 5IO5A 4DQ4A 2K23A 4QGWA 2I5VO 5BVQA 2OYBO 4OKAA 1BJ7A 1JV4A 2ZAIA 1SWDA 3GAQA 1SXYA 5F2BA 2JU8A 2JMBA 1GT1A 2FKJA 4OMWA 1HBPA 3MG5A 4UU2A 4FQBB 2Q4NA 3NX2A 4M6SA 2L5PA 1IFCA 4NLJA 2MWHA 4GJVA 1BBPA 2CBSA 4LZVA 1SWKA 2IZGB 3RDQA 4RUNA 1W5RA 1QY0A 3K3LA 3VE2A 2ZAGA 3U03A 4HPCA 5HCEC 2CM9A 2R74A 1QQSA 2Z4HA 2HMBA 1VWKB 2A5CA 4TLJA 1VWCB 4BX6B 2PY1A 2OY5O 3V8UA 4A8ZA 2MJIA 1XKIA 4YBUA 1ML7A 4U8UO 2RTCB 2JN3A 3AKMA 2O62A 1I05A 4GUZA 2RTNB 1CBQA 3D9WA 1JYDA 5CHKA 1SWUA 4XMGA 2BLGA 4O4XA 2WR6A 2A3FX 3RY1A 2F01A 2VDFA 4BGFA 2QOSC 2G78A 2L68A 2HLVA 4K19A 3ZUIA 5HZ6A 2RCTA 1Y55X 2W2BA 3EMMA 2AF5A 4IRWA 4ORWA 4ARHA 2CM4A 4QZUA 4AZMA 4NV7A 2GH7A 1LDQA 3NX1A 1VYFA 2QO5A 3MX7A 1JJUA 2M4LA 3FDCA 4JO6A 1T8VA 1VYOA 2G8CO 3FR2A 3ZW1A 5IO6A 2OY8A 3RBYA 2MM3A 4HFOA 4COTA 3S60A 1SWFA 4YKOA 2C1QA 1A3YA 2LBAA 2RTLA 5FQ8E 5HA0A 3WYQA 1KQWA 1EPAA 1HN2A 2G7BA 2FS7A 3L4RA 4GU8A 2AH7X 1OEKA 2GTFX 2DJFA 4C5PA 5EDBA 1STRB 1X71A 3B2LA 1SWJA 3STNA 3O19A 4U9CA 4GK9A 4QRLA 3HOEA 4ZR2A 1W4TA 3FA9A 3WJGA 4BQUA 1P6PA 2RTPB 3GE2A 2RTAA 4CPIA 2Y3FA 1HXLA 4FBVA 4D6BA 3RE5A 3OBLA 2KD2A 2RTIB 3KVNA 2X34A 3APWA 3T2XA 5B10O 2BSZA 3NBXX 3PQUA 2LFOA 3ZW2A 2IZJA 4ZHFA 3WVMA 4UU3A 5KHPA 1NQMA 1HBQA 1TOWA 3NQKA 1NGLA 2AT8X 2OL6O 3QQ2A 4QNIA 3RY2A 3SLJA 3TZSA 2X32A 1KXOA 4NV8A 3TGBA 1UZ2X 2JGSA 4QGVA 2OL7A 3FA6A 3WZOA 1VWGB 2AKQA 1ACDA 2Z4IA 3APUA 3KFFA 4DNEA 3FA8A 1X8OA 2OZQA 4Z2OA 4YMYA 1ICNA 1BSQA 3SZJA 3UEWA 1KOIA 4ZH6A 2W2FA 2XSTA 4ML7B 2IZEB 5CSEA 1BEBA 2OFAA 4YFRA 1B0OA 3VG5A 5B5FA 1GT3A 1IJ8A 2BT9A 1I06A 5FQ7E 5JD2A 4AYHA 3I0AA 2WPUA 4CDFA 3SAOA 1N4JA 3BS2A 3RSWA 3N91A 4BX7A 5L8NA 1LCZA 4DQ3A 1H91A 4OMXA 4TNNA 1E5PA 3WXQA 5CE4A 1LPJA 4ORXA 4Y5DA 1SWSA 1Y53X 3PECA 2FLJA 1E06A 1FEMA 2OY1O 5L8OA 2IZCB 4EQAC 2QMIA 1KZWA 3HWEA 5B11O 5B3MO 4ZH9A 4ZHHA 3IFBA 1SY1A 3AUMO 1QABE 2IFBA 2GJ5A 4GRJA 4I9SA 1SLEB 1LCWA 4LZUA 2AT5X 5BVSA 3S26A 5HCCC 4Y59A 4Z2VA 5K06A 1IIUA 1NBXA 1N0SA 4KCAA 1K3BA 3C76X 4QAEA 4U3QA 4BX6A 1UREA 2UZ2A 2BS6A 1DV9A 2LBVA 4MVIA 4ODDA 3ELXA 3P24A 2FHLA 2OFMX 2FGSA 2OFRX 1EUOA 1ZNEA 3APXA 3DSZA 4FGIB 2WQAE 4I95A 4BVMA 5KICA 3FW5A 4LKTA 4O4UA 1S2PA 2EU7X 1E02A 5DG4A 5L3YA 1SWOA 1WBIA 1CBSA 2FWVA 2JU3A 3CWKA 4IAWA 1KL5A 5C0NA 1RXHA 3FELA 1VWPB 4I60A 4M7MA 2OF8A 3EC5A 5EPQA 4MVKA 5BYPA 2GTLM 1ADLA 1VWIB 1ZNKA 3DTQA 3FA7A 2FT9A 2JOZA 3PQSA 4O3ZA 3SOTA 4GNYA 2OY7A 3PDFA 1N43A 3D96A 3U9PC 1JJJA 1MEPA 5HZ9A 3BU1A 2YMSA 4YH0A 1JJXA 1U0XA 3PEDA 1SRFA 4JHQA 1SWHA 1QFTA 2IZIA 3HWGA 1YIVA 4ON1A 3JQOA 5D8JA 2RTDB 1BM5A 3BLGA 3FMZA 1EIIA 4TQ2A 1VWJB 1QFVA 4NP1A 3WJEA 1LIBA 1BRPA 5F58A 1ZNHA 4IMNA 4PJ2A 4YVBA 4MISA 1GM6A 2C4IA 2IZLB 4GNWA 4HPAA 3NP1A 1D2UA 2WSJA 5JR8A 1T68X 5FFHA 2AT0X 1G7NA 2KTDA 5K68A 5LJGA 1SWAA 3WZQA 4QYPA 2MO5A 1Y9TA 3OD9A 2NNQA 4XMDA 5B5GA 5H9AA 1TOUA 4QZTA 3VG6A 2WEXA 3RDUA 5D4AA 2LA7A 1SWLA 5F6ZA 4WFVA 1T0VA 1GKAB 4O3XB 5H9NA
chains in the Genus database with same CATH topology
3VG2A 1HMTA 1OBQA 4EFGA 1MX8A 3WBGA 4D6AA 2NNEA 1TXLA 4YGHA 5HTDA 2RCQA 4ZFXA 1ZNGA 2R73A 2X45A 2X8FA 2KTSA 4YDBA 1AB0A 2ASNX 4KC8A 1MDCA 1TW4A 2OVEA 3KZAA 5EDCA 4L1NA 4WHIA 3WJBA 4ZJ0A 1LF7A 1S44A 1CBIA 1YWAA 3AKNA 3H3IA 2FR2A 4TJZA 3UEVA 2FS6A 4NYQA 2HZQA 3PH6A 1PMPA 3KFHA 2HZRA 3CMPA 3PH5A 1KT7A 5FAZA 3VPJE 3ZZVA 5LJKA 5HZ5A 1AELA 1ZRYA 2ANSA 3PP6A 1OBPA 2G79A 3HK1A 4OS8A 1QY2A 1TVQA 4NNTA 4NYRA 1DZJA 3NQ3A 5HBSA 5LJDA 1KT4A 3B2KA 4CV7A 1SY0A 3BX7A 2GTLO 1LFOA 3NQ9A 2ACOA 1I04A 3FEKA 3Q6LA 4CSBA 4GE1A 4O4OA 3C77X 5D48A 2QO4A 4BOEA 2A2GA 2NNDA 1YP6A 3P6HA 1GGLA 3B2HA 1A57A 1ZNLA 3P6FA 1RLBE 3ZW0B 2RN4A 4HPDA 3G7XA 5LJBA 1PBOA 1ICMA 1LNMA 2BS5A 4NW4A 4GDZA 1MVGA 2KT4B 4AZPA 5CYBA 2NP1A 1PM1X 2HNXA 3U0DA 2BHVA 4ZHCA 1GX8A 4OS3A 1NP1A 1QY1A 4WFUA 1DZKA 3EYCA 1EPBA 3RWXA 4YCHA 3FEPA 1KT6A 2DM5A 5B27A 3WJFA 5BVTA 3NPOA 4AZNA 3KQ0A 1LIDA 1DC9A 4I9RA 1X8QA 3FIQA 4L3RA 2FRSA 4ZHGA 3HWDA 3STKA 4MVLA 3BRNA 2HYSA 2AL0X 3JSQA 4AZOA 2WWPA 4MVEA 1BSYA 4PSQA 4XMHA 2AMMX 4MIRA 4YFQA 1A18A 3P6DA 5LKEA 4EEJA 3P6CA 2F73A 1QWDA 1GKAA 5EEEA 3D97A 4A1HA 2LB6A 4QQ1A 2FR3A 2X8TA 1SXUA 3B2JA 3ZWEA 1IKEA 1MX7A 3F9DA 5L8IA 1GXAA 1EW3A 1FDQA 2JU7A 2WEWA 2WQ9A 4EXZA 2K62A 3FW4A 3KFGA 4ZCBA 3MVFA 1YWCA 1KGLA 2A2UA 1KZXA 1CRBA 4INNA 3JS1A 1LIFA 1SY3A 1O1UA 4YFPA 5D45A 4FBOA 4AZQA 1VYGA 2Q2PA 3D95A 2CBRA 3LHNA 2E4JA 3O2YA 5HZQA 4KH8A 1YWDA 5HAEA 2JW1A 1JIWI 3OJYC 5H9KA 1JYJA 1OEJA 2W2AA 2CZTA 3F6ZB 4R0BA 4TKJA 1B56A 3BSZE 4HWMA 5LKFA 1FELA 3RKGA 3F8AA 3P6EA 3UEXA 3BDRA 3HOLA 4IMOA 5IO7A 4IB9A 4LQZA 3VG7A 1SA8A 5F1EA 1Z24A 2MHDA 1ALBA 2A13A 4QGXA 1KT3A 1ERXA 4N7DA 3S5XA 1EI5A 5EEDA 1B8EA 4N7CA 3ZW0A 4ALBA 4TKBA 1OBUA 4O3WA 4GKCA 4ORSA 5AQ6A 4NNSA 1G74A 3T1DA 4A1YA 5B29A 2R56A 4GZVA 3BU9A 4CK4A 2ALLX 3PPTA 1EXSA 3WOVA 2OVAA 3LV4A 2XKLA 4KT5A 1KT5A 4KIIA 1E00A 1X89A 3E3CA 4QYNA 4YGGA 2AT6X 2Q39A 5LJHA 1SXWA 4GH7A 4YCEA 4O9SA 5H9LA 4O49A 2X46A 1X8NA 1QG5A 2KW1A 3CBCA 1GT4A 2X8SA 2FTBA 1MUPA 1O1VA 1G85A 3C78X 4Y0RA 3EBWA 3WJDA 2Q2MA 4Y0PA 1U18A 2OVSA 3VU1A 4ORYA 1OEEA 1HMRA 2RA6A 3P02A 4HPBA 4ZHDA 1LIEA 1XCAA 2N93A 2P8GA 5EZ2A 1EQDA 3ZI8A 2QM9A 1YWBA 4TKHA 4IB6A 5HTEA 1BLRA 5HCDC 1DF3A 1X8PA 1CBRA 3FLLA 1SMPI 4AZRA 4LKPA 4YBPA 1DFVA 3UAQA 1I4UA 3NADA 1S7DA 2POAA 4O3YA 1GT5A 3P6GA 4ORRA 4ZGUA 2LKKA 4O4SA 1HMSA 1O8VA 3FR5A 5LJEA 1VPRA 1YP7A 2AT3X 3EM0A 3QKGA 1OPBA 4JGLA 3VG3A 1OPAA 1CJ5A 1KQXA 3TF6A 1Y9LA 3RZYA 5F7GA 1ZNDA 4Y0QA 2RQ0A 3ELZA 3CQNA 1SXXA 3APVA 4Y0SA 3I17A 3VE1A 4YKMA 1G5WA 4ES7A 4EDEA 5HA1A 4AW8A 5AJCA 1AVGI 2F09A 1LICA 3ZQ3A 3CQRA 1X8UA 2CZUA 4I3CA 4ZGFA 5KIDA 3NR3A 3BX8A 4IB8A 2OVDA 4U8UM 1IW2A 2QO6A 1D3SA 1BRQA 4GETA 3FR4A 3HWFA 3ZW1B 1GX9A 5H8TA 4A60A 4YGZA 3ZUOA 2ACPX 4IABA 2RD7C 5FENA 4IAXA 1PEEA 2Q9SA 5FQ6E 3CBSA 1LKEA 2L9CA 3FENA 4OS0A 4U8UN 1R0UA 1L6MA 1NP4A 5HZ8A 1JBHA 1IKJA 4XMCA 4KC7A 3MBTA 4I6SA 3BY0A 3EBKA 4I3DA 4I3BA 3KFIA 1FTPA 1SY2A 5LJCA 1HQPA 1DZPA 1ERBA 1RBPA 5HWZA 1BWYA 2A0AA 4IBAA 4XMFA 4ID2A 3TGAA 3CR6A 2YG2A 4WBKA 3O22A 1U17A 2L67A 4XMEA 4ALOA 1FE3A 1EIOA 1AQBA 1IFBA 4IB7A 1BSOA 5AJBA 3S5VA 5D47A 3WJCA 1JZUA 3HTYA 1B4MA 3IA8A 5DPQA 1A2DA 3UEUA 5AEOA 1DZMA 1EALA 1YUPA 4ORUA 4FBRA 4YDAA 3FYFA 3B2IA 3OE3A 5F6BA 4RUUA 3D4RA 1FENA 3VG4A 2WUTA 3STMX 2GTLN 2GC9A 5IO5A 4DQ4A 2K23A 4QGWA 5BVQA 1BJ7A 1JV4A 2ZAIA 3GAQA 1SXYA 2JU8A 2JMBA 1GT1A 4OMWA 1HBPA 4UU2A 4FQBB 2Q4NA 3NX2A 4M6SA 2L5PA 1IFCA 4NLJA 2MWHA 1BBPA 2CBSA 4LZVA 4RUNA 1QY0A 3K3LA 3VE2A 2ZAGA 3U03A 4HPCA 5HCEC 2CM9A 2R74A 1QQSA 2Z4HA 2HMBA 4TLJA 2PY1A 3V8UA 4A8ZA 2MJIA 1XKIA 4YBUA 1ML7A 4U8UO 2JN3A 3AKMA 2O62A 1I05A 1CBQA 1JYDA 4XMGA 2BLGA 4O4XA 2WR6A 2A3FX 2QOSC 2G78A 2L68A 2HLVA 4K19A 3ZUIA 5HZ6A 2RCTA 2W2BA 3EMMA 4ORWA 4ARHA 2CM4A 4QZUA 4AZMA 3NX1A 1VYFA 2QO5A 3MX7A 2M4LA 1T8VA 3ZW1A 5IO6A 3FR2A 3RBYA 2MM3A 4HFOA 4COTA 3S60A 4YKOA 1A3YA 2LBAA 5FQ8E 5HA0A 1KQWA 1EPAA 1HN2A 2G7BA 2FS7A 3L4RA 4GU8A 2AH7X 1OEKA 2GTFX 5EDBA 1X71A 3B2LA 3STNA 3O19A 4U9CA 4GK9A 4QRLA 3HOEA 4ZR2A 3FA9A 3WJGA 4BQUA 4D6BA 1P6PA 3GE2A 4FBVA 3OBLA 2KD2A 3APWA 3NBXX 3PQUA 3ZW2A 2LFOA 4ZHFA 3WVMA 4UU3A 5KHPA 1HBQA 1TOWA 3NQKA 1NGLA 2AT8X 4QNIA 3TZSA 1KXOA 3TGBA 1UZ2X 4QGVA 3FA6A 2AKQA 1ACDA 2Z4IA 3APUA 3KFFA 3FA8A 1X8OA 2OZQA 4YMYA 1ICNA 1BSQA 3UEWA 1KOIA 4ZH6A 2W2FA 2XSTA 4ML7B 4YFRA 1BEBA 1B0OA 3VG5A 1GT3A 2BT9A 1I06A 5FQ7E 4AYHA 3I0AA 3SAOA 3BS2A 3RSWA 3N91A 5L8NA 4DQ3A 1H91A 4OMXA 4TNNA 1E5PA 3WXQA 5CE4A 1LPJA 4ORXA 3PECA 2FLJA 1E06A 1FEMA 5L8OA 4EQAC 2QMIA 1KZWA 3HWEA 4ZH9A 4ZHHA 3IFBA 1SY1A 4NLIA 1QABE 2IFBA 2GJ5A 4GRJA 4I9SA 4LZUA 5BVSA 3S26A 2AT5X 5HCCC 5K06A 1IIUA 1N0SA 4KCAA 4U3QA 3C76X 4QAEA 1UREA 2BS6A 1DV9A 2LBVA 4MVIA 4ODDA 3ELXA 3P24A 2OFMX 2OFRX 3APXA 1EUOA 1ZNEA 3DSZA 4FGIB 4I95A 2WQAE 4BVMA 5KICA 3FW5A 4LKTA 4O4UA 1S2PA 2EU7X 1E02A 5DG4A 1CBSA 2FWVA 2JU3A 3CWKA 4IAWA 3TGCA 5C0NA 3FELA 4M7MA 5EPQA 4MVKA 5BYPA 2GTLM 1ADLA 1ZNKA 3DTQA 3FA7A 2FT9A 2JOZA 3PQSA 4O3ZA 3SOTA 4GNYA 3D96A 3U9PC 1JJJA 1JJXA 5HZ9A 3BU1A 2YMSA 4YH0A 1U0XA 3PEDA 4ON1A 1QFTA 3HWGA 1YIVA 3JQOA 5D8JA 1BM5A 3BLGA 3FMZA 1EIIA 4TQ2A 1QFVA 4NP1A 3WJEA 1LIBA 1BRPA 5F58A 1ZNHA 4IMNA 4PJ2A 4MISA 1GM6A 4HPAA 4GNWA 3NP1A 1D2UA 2WSJA 5JR8A 1T68X 5FFHA 2AT0X 1G7NA 2KTDA 5LJGA 4QYPA 2MO5A 1Y9TA 3OD9A 2NNQA 4XMDA 5H9AA 1TOUA 4QZTA 3VG6A 2WEXA 5D4AA 2LA7A 5F6ZA 4WFVA 1T0VA 1GKAB 4O3XB 5H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VG2 A;  1HMT A;  1OBQ A;  4EFG A;  1MX8 A;  3WBG A;  4D6A A;  2NNE A;  1TXL A;  4YGH A;  5HTD A;  2RCQ A;  4ZFX A;  1ZNG A;  2R73 A;  2X45 A;  4YDB A;  1AB0 A;  2ASN X;  1MDC A;  1TW4 A;  2OVE A;  3KZA A;  5EDC A;  4ZJ0 A;  3WJB A;  1LF7 A;  1S44 A;  1CBI A;  1YWA A;  3AKN A;  2FR2 A;  4TJZ A;  3UEV A;  2FS6 A;  4NYQ A;  2HZQ A;  3PH6 A;  1PMP A;  3KFH A;  2HZR A;  3CMP A;  3PH5 A;  1KT7 A;  5FAZ A;  5LJK A;  5HZ5 A;  1AEL A;  1ZRY A;  2ANS A;  3PP6 A;  1OBP A;  2G79 A;  3HK1 A;  4OS8 A;  1QY2 A;  1TVQ A;  4NNT A;  4NYR A;  1DZJ A;  3NQ3 A;  5HBS A;  5LJD A;  1KT4 A;  3B2K A;  1SY0 A;  3BX7 A;  1LFO A;  3NQ9 A;  2ACO A;  1I04 A;  3FEK A;  3Q6L A;  4GE1 A;  3C77 X;  5D48 A;  2QO4 A;  4BOE A;  2A2G A;  2NND A;  1YP6 A;  3P6H A;  1GGL A;  3B2H A;  1A57 A;  1ZNL A;  3P6F A;  1RLB E;  4HPD A;  3G7X A;  5LJB A;  1PBO A;  1ICM A;  1LNM A;  1MVG A;  2KT4 B;  4AZP A;  2NP1 A;  1PM1 X;  2HNX A;  3U0D A;  4ZHC A;  1GX8 A;  4OS3 A;  1NP1 A;  1QY1 A;  4WFU A;  1DZK A;  3EYC A;  1EPB A;  4YCH A;  3FEP A;  1KT6 A;  2DM5 A;  5B27 A;  3WJF A;  5BVT A;  3NPO A;  4AZN A;  3KQ0 A;  1LID A;  1DC9 A;  4I9R A;  1X8Q A;  3FIQ A;  2FRS A;  4ZHG A;  3HWD A;  3STK A;  4MVL A;  3BRN A;  2HYS A;  2AL0 X;  3JSQ A;  4AZO A;  2WWP A;  1BSY A;  4PSQ A;  4XMH A;  2AMM X;  4YFQ A;  1A18 A;  3P6D A;  5LKE A;  4EEJ A;  3P6C A;  2F73 A;  1QWD A;  1GKA A;  5EEE A;  3D97 A;  4A1H A;  2LB6 A;  2FR3 A;  1SXU A;  3B2J A;  1IKE A;  1MX7 A;  3F9D A;  5L8I A;  1GXA A;  1EW3 A;  1FDQ A;  2JU7 A;  2WEW A;  2WQ9 A;  4EXZ A;  2K62 A;  3FW4 A;  3KFG A;  4ZCB A;  3MVF A;  1YWC A;  1KGL A;  2A2U A;  1KZX A;  1CRB A;  3JS1 A;  1LIF A;  1SY3 A;  1O1U A;  4YFP A;  5D45 A;  4AZQ A;  1VYG A;  2Q2P A;  3D95 A;  2CBR A;  2E4J A;  3O2Y A;  5HZQ A;  1YWD A;  5HAE A;  3OJY C;  5H9K A;  1JYJ A;  1OEJ A;  2W2A A;  2CZT A;  4R0B A;  4TKJ A;  1B56 A;  3BSZ E;  5LKF A;  1FEL A;  3F8A A;  3P6E A;  3UEX A;  3BDR A;  4IMO A;  5IO7 A;  4IB9 A;  3VG7 A;  1SA8 A;  5F1E A;  1Z24 A;  4QGX A;  1ALB A;  2A13 A;  1KT3 A;  1ERX A;  4N7D A;  5EED A;  1B8E A;  4N7C A;  4ALB A;  4TKB A;  1OBU A;  4GKC A;  4ORS A;  5AQ6 A;  4NNS A;  1G74 A;  3T1D A;  4A1Y A;  5B29 A;  2R56 A;  3BU9 A;  4CK4 A;  2ALL X;  3PPT A;  1EXS A;  2OVA A;  2XKL A;  1KT5 A;  4KII A;  1E00 A;  1X89 A;  4QYN A;  4YGG A;  2AT6 X;  2Q39 A;  5LJH A;  1SXW A;  4GH7 A;  4YCE A;  4O9S A;  5H9L A;  2X46 A;  1X8N A;  1QG5 A;  3CBC A;  1GT4 A;  2FTB A;  1MUP A;  1O1V A;  1G85 A;  3C78 X;  4Y0R A;  3EBW A;  3WJD A;  2Q2M A;  4Y0P A;  1U18 A;  4ORY A;  1OEE A;  1HMR A;  2RA6 A;  4HPB A;  4ZHD A;  1LIE A;  1XCA A;  2N93 A;  2P8G A;  5EZ2 A;  1EQD A;  2QM9 A;  1YWB A;  4TKH A;  4IB6 A;  5HTE A;  1BLR A;  5HCD C;  1DF3 A;  1X8P A;  1CBR A;  3FLL A;  4AZR A;  4LKP A;  4YBP A;  1DFV A;  1I4U A;  3NAD A;  1S7D A;  2POA A;  1GT5 A;  3P6G A;  4ORR A;  4ZGU A;  2LKK A;  1HMS A;  1O8V A;  3FR5 A;  5LJE A;  1VPR A;  1YP7 A;  2AT3 X;  3EM0 A;  3QKG A;  1OPB A;  3VG3 A;  1OPA A;  1CJ5 A;  1KQX A;  3TF6 A;  3RZY A;  5F7G A;  1ZND A;  4Y0Q A;  2RQ0 A;  3ELZ A;  3CQN A;  1SXX A;  3APV A;  4Y0S A;  3I17 A;  4YKM A;  1G5W A;  4ES7 A;  4EDE A;  5HA1 A;  4AW8 A;  1AVG I;  1LIC A;  3ZQ3 A;  3CQR A;  1X8U A;  2CZU A;  4I3C A;  5KID A;  3NR3 A;  3BX8 A;  4IB8 A;  2OVD A;  1IW2 A;  2QO6 A;  1D3S A;  1BRQ A;  4GET A;  3FR4 A;  3HWF A;  4A60 A;  1GX9 A;  5H8T A;  4YGZ A;  3ZUO A;  2ACP X;  2RD7 C;  5FEN A;  4IAX A;  1PEE A;  2Q9S A;  3CBS A;  1LKE A;  2L9C A;  3FEN A;  4OS0 A;  1R0U A;  1L6M A;  1NP4 A;  5HZ8 A;  1JBH A;  1IKJ A;  4XMC A;  3MBT A;  3BY0 A;  3EBK A;  4I3D A;  4I3B A;  3KFI A;  1FTP A;  1SY2 A;  5LJC A;  1HQP A;  1DZP A;  1ERB A;  1RBP A;  5HWZ A;  1BWY A;  2A0A A;  4IBA A;  4XMF A;  3TGA A;  3CR6 A;  2YG2 A;  4WBK A;  3O22 A;  1U17 A;  2L67 A;  4XME A;  4ALO A;  1FE3 A;  1EIO A;  1AQB A;  1IFB A;  4IB7 A;  1BSO A;  5D47 A;  3WJC A;  1JZU A;  1B4M A;  3IA8 A;  5DPQ A;  1A2D A;  3UEU A;  1DZM A;  1EAL A;  1YUP A;  4ORU A;  4YDA A;  3B2I A;  5F6B A;  4RUU A;  1FEN A;  3VG4 A;  2WUT A;  3STM X;  2GC9 A;  5IO5 A;  4DQ4 A;  2K23 A;  4QGW A;  5BVQ A;  1BJ7 A;  1JV4 A;  3GAQ A;  1SXY A;  2JU8 A;  1GKA B;  1GT1 A;  4OMW A;  1HBP A;  4UU2 A;  2Q4N A;  3NX2 A;  4M6S A;  2L5P A;  1IFC A;  4NLJ A;  1BBP A;  2CBS A;  4LZV A;  4RUN A;  1QY0 A;  3K3L A;  3U03 A;  4HPC A;  5HCE C;  2R74 A;  2CM9 A;  1QQS A;  4TLJ A;  2HMB A;  2PY1 A;  4A8Z A;  2MJI A;  1XKI A;  4YBU A;  1ML7 A;  2JN3 A;  3AKM A;  2O62 A;  1I05 A;  1CBQ A;  1JYD A;  4XMG A;  2BLG A;  2WR6 A;  2A3F X;  2QOS C;  2G78 A;  2L68 A;  2HLV A;  4K19 A;  3ZUI A;  5HZ6 A;  2W2B A;  3EMM A;  4ORW A;  4ARH A;  2CM4 A;  4QZU A;  4AZM A;  3NX1 A;  1VYF A;  2QO5 A;  1T8V A;  5IO6 A;  3FR2 A;  2MM3 A;  4HFO A;  4YKO A;  1A3Y A;  2LBA A;  5HA0 A;  1KQW A;  1EPA A;  1HN2 A;  2G7B A;  2FS7 A;  3L4R A;  2AH7 X;  1OEK A;  2GTF X;  5EDB A;  1X71 A;  3B2L A;  3STN A;  3O19 A;  4ZR2 A;  3FA9 A;  3WJG A;  4BQU A;  4D6B A;  1P6P A;  3APW A;  2LFO A;  4ZHF A;  3WVM A;  4UU3 A;  5KHP A;  1HBQ A;  1TOW A;  1NGL A;  2AT8 X;  3TZS A;  1KXO A;  3TGB A;  1UZ2 X;  4QGV A;  3FA6 A;  2AKQ A;  1ACD A;  3APU A;  3KFF A;  3FA8 A;  1X8O A;  2OZQ A;  4YMY A;  1ICN A;  1BSQ A;  3UEW A;  1KOI A;  4ZH6 A;  2W2F A;  2XST A;  4YFR A;  1BEB A;  1B0O A;  3VG5 A;  1GT3 A;  1I06 A;  4AYH A;  3I0A A;  3SAO A;  3BS2 A;  3RSW A;  5L8N A;  4DQ3 A;  1H91 A;  4OMX A;  4TNN A;  1E5P A;  3WXQ A;  5CE4 A;  1LPJ A;  4ORX A;  3PEC A;  2FLJ A;  1E06 A;  1FEM A;  5L8O A;  1KZW A;  3HWE A;  4ZH9 A;  4ZHH A;  3IFB A;  1SY1 A;  4NLI A;  1QAB E;  2IFB A;  2GJ5 A;  4GRJ A;  4I9S A;  4LZU A;  5BVS A;  3S26 A;  2AT5 X;  5HCC C;  5K06 A;  1IIU A;  1N0S A;  3C76 X;  4QAE A;  1URE A;  1DV9 A;  2LBV A;  4MVI A;  4ODD A;  3ELX A;  2OFM X;  2OFR X;  3APX A;  1EUO A;  1ZNE A;  3DSZ A;  4BVM A;  5KIC A;  2WQA E;  3FW5 A;  4LKT A;  1S2P A;  2EU7 X;  1E02 A;  5DG4 A;  1CBS A;  2FWV A;  2JU3 A;  3CWK A;  4IAW A;  3TGC A;  5C0N A;  3FEL A;  4M7M A;  5EPQ A;  4MVK A;  1ADL A;  1ZNK A;  3DTQ A;  3FA7 A;  2FT9 A;  2JOZ A;  4GNY A;  3D96 A;  3U9P C;  1JJX A;  5HZ9 A;  3BU1 A;  4YH0 A;  1U0X A;  3PED A;  1QFT A;  3HWG A;  1YIV A;  5D8J A;  1BM5 A;  3BLG A;  3FMZ A;  1EII A;  4TQ2 A;  1QFV A;  4NP1 A;  3WJE A;  1LIB A;  1BRP A;  5F58 A;  1ZNH A;  4IMN A;  1GM6 A;  4HPA A;  4GNW A;  3NP1 A;  1D2U A;  2WSJ A;  5JR8 A;  1T68 X;  5FFH A;  2AT0 X;  1G7N A;  2KTD A;  5LJG A;  4QYP A;  2MO5 A;  2NNQ A;  4XMD A;  5H9A A;  1TOU A;  4QZT A;  3VG6 A;  2WEX A;  5D4A A;  5F6Z A;  4WFV A;  1T0V A;  2RCT A;  1JJJ A;  5H9N A; 
#chains in the Genus database with same CATH topology
 3TGC A;  3VG2 A;  1VWN B;  1HMT A;  1OBQ A;  4CPE A;  4EFG A;  1MX8 A;  3WBG A;  4D6A A;  2NNE A;  1TXL A;  4YGH A;  5IRW A;  5HTD A;  2RCQ A;  4ZFX A;  1ZNG A;  4BCS A;  2R73 A;  2I5Z O;  2X45 A;  2X8F A;  2KTS A;  4YDB A;  1AB0 A;  1STP A;  2ASN X;  4KC8 A;  1MDC A;  1TW4 A;  2OVE A;  3KZA A;  5EDC A;  4L1N A;  4WHI A;  3WJB A;  1SWC A;  4ZJ0 A;  1LF7 A;  1S44 A;  1CBI A;  1NQN A;  1YWA A;  3AKN A;  3H3I A;  2FR2 A;  4TJZ A;  3UEV A;  2FS6 A;  4NYQ A;  2HZQ A;  4B55 A;  3PH6 A;  1PMP A;  3KFH A;  2HZR A;  3CMP A;  1RSU B;  1KT7 A;  3PH5 A;  5FAZ A;  2OL8 O;  3RE6 A;  1VWQ B;  3VPJ E;  3ZZV A;  5LJK A;  5HZ5 A;  1AEL A;  1ZRY A;  2ANS A;  3PP6 A;  1AVE A;  1OBP A;  2G79 A;  3HK1 A;  4OS8 A;  5IRA A;  3CKG A;  1QY2 A;  1TVQ A;  1SRH A;  4NNT A;  1DZJ A;  3NQ3 A;  4NYR A;  5HBS A;  1KT4 A;  3B2K A;  5LJD A;  1SWQ A;  3T6L A;  4CV7 A;  1SY0 A;  3BX7 A;  5B2A O;  4Z6J A;  2GTL O;  1LFO A;  3NQ9 A;  2ACO A;  1I04 A;  3FEK A;  3Q6L A;  4CSB A;  2X55 A;  4NLI A;  4GE1 A;  1WUB A;  4O4O A;  3C77 X;  5D48 A;  2QO4 A;  4BOE A;  2A2G A;  2NND A;  1YP6 A;  3P6H A;  1GGL A;  2X56 A;  3B2H A;  1A57 A;  1ZNL A;  3P6F A;  1RLB E;  2PI3 O;  3ZW0 B;  2RN4 A;  4HPD A;  3G7X A;  5LJB A;  2FKG A;  5IXG A;  4GDA A;  1PBO A;  1ICM A;  1LNM A;  2BS5 A;  4NW4 A;  4GDZ A;  1MVG A;  2KT4 B;  4AZP A;  4Z2P A;  3SZI A;  5CYB A;  2NP1 A;  1PM1 X;  2HNX A;  3U0D A;  4CPF A;  2BHV A;  4ZHC A;  1GX8 A;  4OS3 A;  1SWB A;  1NP1 A;  1VWF B;  1QY1 A;  4WFU A;  1DZK A;  3EYC A;  1EPB A;  3RWX A;  4YCH A;  4BBO A;  3FEP A;  1KT6 A;  2DM5 A;  5B27 A;  3WJF A;  5BVT A;  3NPO A;  4AZN A;  3KQ0 A;  1LID A;  4GGZ A;  1DC9 A;  2IZF B;  4GGR A;  1X8Q A;  4I9R A;  1Y52 X;  3FIQ A;  4L3R A;  2FRS A;  3EW1 A;  4ZHG A;  3HWD A;  4OEL A;  3STK A;  1MOY A;  4MVL A;  3BRN A;  1DF8 A;  1NDJ A;  3PK2 A;  2HYS A;  2AL0 X;  3JSQ A;  4AZO A;  2WWP A;  4MVE A;  1BSY A;  4PSQ A;  4XMH A;  2AMM X;  1SRE A;  4MIR A;  4YFQ A;  3MM0 A;  1A18 A;  3SZH A;  3P6D A;  5LKE A;  1SLD B;  4EEJ A;  3P6C A;  2F73 A;  1QWD A;  1GKA A;  1RXK A;  1HY2 A;  3D97 A;  5EEE A;  3T2W A;  4A1H A;  4OEM A;  2LB6 A;  4QQ1 A;  2FR3 A;  2X8T A;  1SXU A;  1SWE A;  3B2J A;  3ZWE A;  1RXJ A;  1IKE A;  1MX7 A;  3F9D A;  5L8I A;  1UYO X;  2G5L A;  1GXA A;  1EW3 A;  1FDQ A;  2JU7 A;  1SWP A;  1N9Y A;  2WEW A;  2WQ9 A;  4EXZ A;  2K62 A;  3FW4 A;  3KFG A;  4CPH B;  1N9M A;  4ZCB A;  2FHN X;  3MVF A;  1OSP O;  1YWC A;  3VHM A;  1KGL A;  1KL3 A;  2A2U A;  1KZX A;  1CRB A;  4INN A;  3JS1 A;  1LIF A;  1SY3 A;  1O1U A;  4YFP A;  5D45 A;  4FBO A;  4AZQ A;  1VYG A;  2Q2P A;  3D95 A;  2CBR A;  2VFC A;  3LHN A;  1SRG A;  1FJ1 E;  1VWA B;  2E4J A;  2RTG B;  3O2Y A;  5HZQ A;  4KH8 A;  2HKD A;  1I78 A;  1YWD A;  5HAE A;  2JW1 A;  1JIW I;  3OJY C;  5H9K A;  1JYJ A;  4BX5 B;  1OEJ A;  2W2A A;  2CZT A;  3F6Z B;  4R0B A;  4TKJ A;  1GX3 A;  1B56 A;  3BSZ E;  2QOM A;  4HWM A;  1FEL A;  2X4M A;  5LKF A;  3RKG A;  3F8A A;  3P6E A;  3RDO A;  4EKV A;  3UEX A;  3BDR A;  3HOL A;  4IMO A;  5IO7 A;  4IB9 A;  4LQZ A;  3VG7 A;  1SA8 A;  5F1E A;  1Z24 A;  2MHD A;  1ALB A;  2A13 A;  4QGX A;  1KT3 A;  1ERX A;  4N7D A;  3S5X A;  1EI5 A;  4JNJ A;  1E2T A;  1B8E A;  5EED A;  4N7C A;  3ZW0 A;  4ALB A;  5K67 A;  4TKB A;  1OBU A;  4O3W A;  4GKC A;  4ORS A;  1SWN A;  5AQ6 A;  4NNS A;  1G74 A;  4Z28 A;  1SWG A;  2RTH B;  3T1D A;  4A1Y A;  5B29 A;  1VWR B;  1PBY A;  2UYW A;  2Y32 A;  2R56 A;  3CKF A;  4GZV A;  3BU9 A;  4CK4 A;  4Z27 A;  2ALL X;  3PPT A;  1EXS A;  2AVI A;  3WOV A;  1MM9 A;  2OVA A;  3LV4 A;  2XKL A;  4KT5 A;  1KT5 A;  4KII A;  1E00 A;  1X89 A;  3E3C A;  4QYN A;  4YGG A;  2AT6 X;  2Q39 A;  5LJH A;  2RTF B;  1SXW A;  2IZB A;  4GH7 A;  4YCE A;  4O9S A;  5H9L A;  4O49 A;  3RDM A;  2X46 A;  1X8N A;  1QG5 A;  2KW1 A;  1SWR A;  3Q34 A;  3CBC A;  1GT4 A;  2X8S A;  4GJS A;  2FTB A;  3VGW A;  1MUP A;  1O1V A;  1G85 A;  1STS B;  3C78 X;  3SLO A;  4Y0R A;  1VWD B;  1SRJ A;  3EBW A;  3WJD A;  2Q2M A;  1NC9 A;  1UYN X;  2IZH B;  4Y0P A;  1U18 A;  1KFF A;  2IZA A;  2OVS A;  4ORY A;  3VU1 A;  1VWL B;  1OEE A;  2C1S A;  4U46 A;  1MK5 A;  1HQQ A;  1HMR A;  2RA6 A;  3P02 A;  4HPB A;  1VWB B;  3RDX A;  4ZHD A;  1LIE A;  1XCA A;  2BC3 A;  2N93 A;  2P8G A;  1EQD A;  5EZ2 A;  3ZI8 A;  2QM9 A;  1YWB A;  4TKH A;  4IB6 A;  5HTE A;  1BLR A;  5HCD C;  1DF3 A;  2Y3E A;  1X8P A;  4CDC A;  1CBR A;  3FLL A;  1VWH B;  1SMP I;  4AZR A;  2A5B A;  2IZK A;  4LKP A;  4YBP A;  1VWO B;  1DFV A;  3UAQ A;  2ZSC A;  1I4U A;  3NAD A;  1K24 A;  1S7D A;  2POA A;  4O3Y A;  1GT5 A;  3SLT A;  1KL4 A;  3P6G A;  4ORR A;  2IZD B;  3WYP A;  4ZGU A;  2LKK A;  4O4S A;  4CPH A;  4CDE A;  1HMS A;  1O8V A;  3FR5 A;  1SLF B;  5LJE A;  1JMX A;  1VPR A;  1YP7 A;  2AT3 X;  3EM0 A;  3QKG A;  1OPB A;  4JGL A;  1LUQ A;  3VG3 A;  1LDO A;  1OPA A;  1KQX A;  1CJ5 A;  3TF6 A;  1Y9L A;  3RZY A;  5F7G A;  1RST B;  1ZND A;  4Y0Q A;  2RQ0 A;  4GD9 A;  1JQP A;  3ELZ A;  3CQN A;  4BJ8 A;  4BX5 A;  4DCB A;  1VWE B;  1SLG B;  1SXX A;  3APV A;  2RTO B;  3I17 A;  4Y0S A;  3VE1 A;  2RTJ A;  4YKM A;  1G5W A;  4ES7 A;  4EDE A;  5HA1 A;  4AW8 A;  1W6F A;  5AJC A;  1AVG I;  2F09 A;  1LIC A;  3ZQ3 A;  3CQR A;  1X8U A;  2CZU A;  4I3C A;  4ZGF A;  5KID A;  3NR3 A;  3BX8 A;  4IB8 A;  2OVD A;  4U8U M;  1IW2 A;  2QO6 A;  1D3S A;  1BRQ A;  1AVD A;  4GET A;  3FR4 A;  1RAV A;  3HWF A;  1GX9 A;  5H8T A;  3ZW1 B;  4YGZ A;  3ZUO A;  4A60 A;  2VFB A;  2ACP X;  3T6F A;  4IAB A;  2RD7 C;  5FEN A;  1JMZ A;  4IAX A;  1PEE A;  2QCB A;  1HXZ A;  2Q9S A;  3AEH A;  5FQ6 E;  3CBS A;  1LKE A;  2L9C A;  3FEN A;  4OS0 A;  4U8U N;  3LTW A;  1R0U A;  1L6M A;  1NP4 A;  2CAM A;  5IRU A;  3X00 A;  1IKJ A;  1N7Y A;  4XMC A;  5HZ8 A;  1JBH A;  3RDS A;  4KC7 A;  3MBT A;  4I6S A;  3BY0 A;  3EBK A;  4I3D A;  4I3B A;  3KFI A;  1FTP A;  1SY2 A;  5LJC A;  1HQP A;  1DZP A;  1ERB A;  1I9H A;  1RBP A;  5HWZ A;  1BWY A;  2A0A A;  2OFB A;  4IBA A;  1VWM B;  4XMF A;  4ID2 A;  3TGA A;  2RTM A;  1PTS A;  2RTE B;  2RTK A;  2RTQ B;  2YG2 A;  3CR6 A;  1U17 A;  3O22 A;  4WBK A;  2A8G A;  2L67 A;  2OF9 A;  4XME A;  4ALO A;  1FE3 A;  2MF6 A;  2RTB B;  1EIO A;  1AQB A;  1IFB A;  4MEE A;  1Y0G A;  3HPE A;  2RTR B;  4IB7 A;  1BSO A;  5AJB A;  2DJG A;  5D47 A;  3S5V A;  1SRI A;  3WJC A;  3FID A;  1LEL A;  1JZU A;  3HTY A;  3WZP A;  1B4M A;  3IA8 A;  5DPQ A;  1A2D A;  3UEU A;  5AEO A;  1DZM A;  1EAL A;  1YUP A;  4ORU A;  3VHI A;  4YDA A;  3FYF A;  4CDD A;  4FBR A;  4GGT A;  3B2I A;  3OE3 A;  5F6B A;  4RUU A;  1LCV A;  3VHH A;  3WZN A;  3D4R A;  1FEN A;  3VG4 A;  2WUT A;  1SWT A;  3STM X;  2GTL N;  2GC9 A;  3EW2 A;  4BX7 B;  5IO5 A;  4DQ4 A;  2K23 A;  4QGW A;  2I5V O;  5BVQ A;  2OYB O;  4OKA A;  1BJ7 A;  1JV4 A;  2ZAI A;  1SWD A;  3GAQ A;  1SXY A;  5F2B A;  2JU8 A;  2JMB A;  1GT1 A;  2FKJ A;  4OMW A;  1HBP A;  3MG5 A;  4UU2 A;  4FQB B;  2Q4N A;  3NX2 A;  4M6S A;  2L5P A;  1IFC A;  4NLJ A;  2MWH A;  4GJV A;  1BBP A;  2CBS A;  4LZV A;  1SWK A;  2IZG B;  3RDQ A;  4RUN A;  1W5R A;  1QY0 A;  3K3L A;  3VE2 A;  2ZAG A;  3U03 A;  4HPC A;  5HCE C;  2CM9 A;  2R74 A;  1QQS A;  2Z4H A;  2HMB A;  1VWK B;  2A5C A;  4TLJ A;  1VWC B;  4BX6 B;  2PY1 A;  2OY5 O;  3V8U A;  4A8Z A;  2MJI A;  1XKI A;  4YBU A;  1ML7 A;  4U8U O;  2RTC B;  2JN3 A;  3AKM A;  2O62 A;  1I05 A;  4GUZ A;  2RTN B;  1CBQ A;  3D9W A;  1JYD A;  5CHK A;  1SWU A;  4XMG A;  2BLG A;  4O4X A;  2WR6 A;  2A3F X;  3RY1 A;  2F01 A;  2VDF A;  4BGF A;  2QOS C;  2G78 A;  2L68 A;  2HLV A;  4K19 A;  3ZUI A;  5HZ6 A;  2RCT A;  1Y55 X;  2W2B A;  3EMM A;  2AF5 A;  4IRW A;  4ORW A;  4ARH A;  2CM4 A;  4QZU A;  4AZM A;  4NV7 A;  2GH7 A;  1LDQ A;  3NX1 A;  1VYF A;  2QO5 A;  3MX7 A;  1JJU A;  2M4L A;  3FDC A;  4JO6 A;  1T8V A;  1VYO A;  2G8C O;  3FR2 A;  3ZW1 A;  5IO6 A;  2OY8 A;  3RBY A;  2MM3 A;  4HFO A;  4COT A;  3S60 A;  1SWF A;  4YKO A;  2C1Q A;  1A3Y A;  2LBA A;  2RTL A;  5FQ8 E;  5HA0 A;  3WYQ A;  1KQW A;  1EPA A;  1HN2 A;  2G7B A;  2FS7 A;  3L4R A;  4GU8 A;  2AH7 X;  1OEK A;  2GTF X;  2DJF A;  4C5P A;  5EDB A;  1STR B;  1X71 A;  3B2L A;  1SWJ A;  3STN A;  3O19 A;  4U9C A;  4GK9 A;  4QRL A;  3HOE A;  4ZR2 A;  1W4T A;  3FA9 A;  3WJG A;  4BQU A;  1P6P A;  2RTP B;  3GE2 A;  2RTA A;  4CPI A;  2Y3F A;  1HXL A;  4FBV A;  4D6B A;  3RE5 A;  3OBL A;  2KD2 A;  2RTI B;  3KVN A;  2X34 A;  3APW A;  3T2X A;  5B10 O;  2BSZ A;  3NBX X;  3PQU A;  2LFO A;  3ZW2 A;  2IZJ A;  4ZHF A;  3WVM A;  4UU3 A;  5KHP A;  1NQM A;  1HBQ A;  1TOW A;  3NQK A;  1NGL A;  2AT8 X;  2OL6 O;  3QQ2 A;  4QNI A;  3RY2 A;  3SLJ A;  3TZS A;  2X32 A;  1KXO A;  4NV8 A;  3TGB A;  1UZ2 X;  2JGS A;  4QGV A;  2OL7 A;  3FA6 A;  3WZO A;  1VWG B;  2AKQ A;  1ACD A;  2Z4I A;  3APU A;  3KFF A;  4DNE A;  3FA8 A;  1X8O A;  2OZQ A;  4Z2O A;  4YMY A;  1ICN A;  1BSQ A;  3SZJ A;  3UEW A;  1KOI A;  4ZH6 A;  2W2F A;  2XST A;  4ML7 B;  2IZE B;  5CSE A;  1BEB A;  2OFA A;  4YFR A;  1B0O A;  3VG5 A;  5B5F A;  1GT3 A;  1IJ8 A;  2BT9 A;  1I06 A;  5FQ7 E;  5JD2 A;  4AYH A;  3I0A A;  2WPU A;  4CDF A;  3SAO A;  1N4J A;  3BS2 A;  3RSW A;  3N91 A;  4BX7 A;  5L8N A;  1LCZ A;  4DQ3 A;  1H91 A;  4OMX A;  4TNN A;  1E5P A;  3WXQ A;  5CE4 A;  1LPJ A;  4ORX A;  4Y5D A;  1SWS A;  1Y53 X;  3PEC A;  2FLJ A;  1E06 A;  1FEM A;  2OY1 O;  5L8O A;  2IZC B;  4EQA C;  2QMI A;  1KZW A;  3HWE A;  5B11 O;  5B3M O;  4ZH9 A;  4ZHH A;  3IFB A;  1SY1 A;  3AUM O;  1QAB E;  2IFB A;  2GJ5 A;  4GRJ A;  4I9S A;  1SLE B;  1LCW A;  4LZU A;  2AT5 X;  5BVS A;  3S26 A;  5HCC C;  4Y59 A;  4Z2V A;  5K06 A;  1IIU A;  1NBX A;  1N0S A;  4KCA A;  1K3B A;  3C76 X;  4QAE A;  4U3Q A;  4BX6 A;  1URE A;  2UZ2 A;  2BS6 A;  1DV9 A;  2LBV A;  4MVI A;  4ODD A;  3ELX A;  3P24 A;  2FHL A;  2OFM X;  2FGS A;  2OFR X;  1EUO A;  1ZNE A;  3APX A;  3DSZ A;  4FGI B;  2WQA E;  4I95 A;  4BVM A;  5KIC A;  3FW5 A;  4LKT A;  4O4U A;  1S2P A;  2EU7 X;  1E02 A;  5DG4 A;  5L3Y A;  1SWO A;  1WBI A;  1CBS A;  2FWV A;  2JU3 A;  3CWK A;  4IAW A;  1KL5 A;  5C0N A;  1RXH A;  3FEL A;  1VWP B;  4I60 A;  4M7M A;  2OF8 A;  3EC5 A;  5EPQ A;  4MVK A;  5BYP A;  2GTL M;  1ADL A;  1VWI B;  1ZNK A;  3DTQ A;  3FA7 A;  2FT9 A;  2JOZ A;  3PQS A;  4O3Z A;  3SOT A;  4GNY A;  2OY7 A;  3PDF A;  1N43 A;  3D96 A;  3U9P C;  1JJJ A;  1MEP A;  5HZ9 A;  3BU1 A;  2YMS A;  4YH0 A;  1JJX A;  1U0X A;  3PED A;  1SRF A;  4JHQ A;  1SWH A;  1QFT A;  2IZI A;  3HWG A;  1YIV A;  4ON1 A;  3JQO A;  5D8J A;  2RTD B;  1BM5 A;  3BLG A;  3FMZ A;  1EII A;  4TQ2 A;  1VWJ B;  1QFV A;  4NP1 A;  3WJE A;  1LIB A;  1BRP A;  5F58 A;  1ZNH A;  4IMN A;  4PJ2 A;  4YVB A;  4MIS A;  1GM6 A;  2C4I A;  2IZL B;  4GNW A;  4HPA A;  3NP1 A;  1D2U A;  2WSJ A;  5JR8 A;  1T68 X;  5FFH A;  2AT0 X;  1G7N A;  2KTD A;  5K68 A;  5LJG A;  1SWA A;  3WZQ A;  4QYP A;  2MO5 A;  1Y9T A;  3OD9 A;  2NNQ A;  4XMD A;  5B5G A;  5H9A A;  1TOU A;  4QZT A;  3VG6 A;  2WEX A;  3RDU A;  5D4A A;  2LA7 A;  1SWL A;  5F6Z A;  4WFV A;  1T0V A;  1GKA B;  4O3X B;  5H9N A; 
#chains in the Genus database with same CATH homology
 3VG2 A;  1HMT A;  1OBQ A;  4EFG A;  1MX8 A;  3WBG A;  4D6A A;  2NNE A;  1TXL A;  4YGH A;  5HTD A;  2RCQ A;  4ZFX A;  1ZNG A;  2R73 A;  2X45 A;  2X8F A;  2KTS A;  4YDB A;  1AB0 A;  2ASN X;  4KC8 A;  1MDC A;  1TW4 A;  2OVE A;  3KZA A;  5EDC A;  4L1N A;  4WHI A;  3WJB A;  4ZJ0 A;  1LF7 A;  1S44 A;  1CBI A;  1YWA A;  3AKN A;  3H3I A;  2FR2 A;  4TJZ A;  3UEV A;  2FS6 A;  4NYQ A;  2HZQ A;  3PH6 A;  1PMP A;  3KFH A;  2HZR A;  3CMP A;  3PH5 A;  1KT7 A;  5FAZ A;  3VPJ E;  3ZZV A;  5LJK A;  5HZ5 A;  1AEL A;  1ZRY A;  2ANS A;  3PP6 A;  1OBP A;  2G79 A;  3HK1 A;  4OS8 A;  1QY2 A;  1TVQ A;  4NNT A;  4NYR A;  1DZJ A;  3NQ3 A;  5HBS A;  5LJD A;  1KT4 A;  3B2K A;  4CV7 A;  1SY0 A;  3BX7 A;  2GTL O;  1LFO A;  3NQ9 A;  2ACO A;  1I04 A;  3FEK A;  3Q6L A;  4CSB A;  4GE1 A;  4O4O A;  3C77 X;  5D48 A;  2QO4 A;  4BOE A;  2A2G A;  2NND A;  1YP6 A;  3P6H A;  1GGL A;  3B2H A;  1A57 A;  1ZNL A;  3P6F A;  1RLB E;  3ZW0 B;  2RN4 A;  4HPD A;  3G7X A;  5LJB A;  1PBO A;  1ICM A;  1LNM A;  2BS5 A;  4NW4 A;  4GDZ A;  1MVG A;  2KT4 B;  4AZP A;  5CYB A;  2NP1 A;  1PM1 X;  2HNX A;  3U0D A;  2BHV A;  4ZHC A;  1GX8 A;  4OS3 A;  1NP1 A;  1QY1 A;  4WFU A;  1DZK A;  3EYC A;  1EPB A;  3RWX A;  4YCH A;  3FEP A;  1KT6 A;  2DM5 A;  5B27 A;  3WJF A;  5BVT A;  3NPO A;  4AZN A;  3KQ0 A;  1LID A;  1DC9 A;  4I9R A;  1X8Q A;  3FIQ A;  4L3R A;  2FRS A;  4ZHG A;  3HWD A;  3STK A;  4MVL A;  3BRN A;  2HYS A;  2AL0 X;  3JSQ A;  4AZO A;  2WWP A;  4MVE A;  1BSY A;  4PSQ A;  4XMH A;  2AMM X;  4MIR A;  4YFQ A;  1A18 A;  3P6D A;  5LKE A;  4EEJ A;  3P6C A;  2F73 A;  1QWD A;  1GKA A;  5EEE A;  3D97 A;  4A1H A;  2LB6 A;  4QQ1 A;  2FR3 A;  2X8T A;  1SXU A;  3B2J A;  3ZWE A;  1IKE A;  1MX7 A;  3F9D A;  5L8I A;  1GXA A;  1EW3 A;  1FDQ A;  2JU7 A;  2WEW A;  2WQ9 A;  4EXZ A;  2K62 A;  3FW4 A;  3KFG A;  4ZCB A;  3MVF A;  1YWC A;  1KGL A;  2A2U A;  1KZX A;  1CRB A;  4INN A;  3JS1 A;  1LIF A;  1SY3 A;  1O1U A;  4YFP A;  5D45 A;  4FBO A;  4AZQ A;  1VYG A;  2Q2P A;  3D95 A;  2CBR A;  3LHN A;  2E4J A;  3O2Y A;  5HZQ A;  4KH8 A;  1YWD A;  5HAE A;  2JW1 A;  1JIW I;  3OJY C;  5H9K A;  1JYJ A;  1OEJ A;  2W2A A;  2CZT A;  3F6Z B;  4R0B A;  4TKJ A;  1B56 A;  3BSZ E;  4HWM A;  5LKF A;  1FEL A;  3RKG A;  3F8A A;  3P6E A;  3UEX A;  3BDR A;  3HOL A;  4IMO A;  5IO7 A;  4IB9 A;  4LQZ A;  3VG7 A;  1SA8 A;  5F1E A;  1Z24 A;  2MHD A;  1ALB A;  2A13 A;  4QGX A;  1KT3 A;  1ERX A;  4N7D A;  3S5X A;  1EI5 A;  5EED A;  1B8E A;  4N7C A;  3ZW0 A;  4ALB A;  4TKB A;  1OBU A;  4O3W A;  4GKC A;  4ORS A;  5AQ6 A;  4NNS A;  1G74 A;  3T1D A;  4A1Y A;  5B29 A;  2R56 A;  4GZV A;  3BU9 A;  4CK4 A;  2ALL X;  3PPT A;  1EXS A;  3WOV A;  2OVA A;  3LV4 A;  2XKL A;  4KT5 A;  1KT5 A;  4KII A;  1E00 A;  1X89 A;  3E3C A;  4QYN A;  4YGG A;  2AT6 X;  2Q39 A;  5LJH A;  1SXW A;  4GH7 A;  4YCE A;  4O9S A;  5H9L A;  4O49 A;  2X46 A;  1X8N A;  1QG5 A;  2KW1 A;  3CBC A;  1GT4 A;  2X8S A;  2FTB A;  1MUP A;  1O1V A;  1G85 A;  3C78 X;  4Y0R A;  3EBW A;  3WJD A;  2Q2M A;  4Y0P A;  1U18 A;  2OVS A;  3VU1 A;  4ORY A;  1OEE A;  1HMR A;  2RA6 A;  3P02 A;  4HPB A;  4ZHD A;  1LIE A;  1XCA A;  2N93 A;  2P8G A;  5EZ2 A;  1EQD A;  3ZI8 A;  2QM9 A;  1YWB A;  4TKH A;  4IB6 A;  5HTE A;  1BLR A;  5HCD C;  1DF3 A;  1X8P A;  1CBR A;  3FLL A;  1SMP I;  4AZR A;  4LKP A;  4YBP A;  1DFV A;  3UAQ A;  1I4U A;  3NAD A;  1S7D A;  2POA A;  4O3Y A;  1GT5 A;  3P6G A;  4ORR A;  4ZGU A;  2LKK A;  4O4S A;  1HMS A;  1O8V A;  3FR5 A;  5LJE A;  1VPR A;  1YP7 A;  2AT3 X;  3EM0 A;  3QKG A;  1OPB A;  4JGL A;  3VG3 A;  1OPA A;  1CJ5 A;  1KQX A;  3TF6 A;  1Y9L A;  3RZY A;  5F7G A;  1ZND A;  4Y0Q A;  2RQ0 A;  3ELZ A;  3CQN A;  1SXX A;  3APV A;  4Y0S A;  3I17 A;  3VE1 A;  4YKM A;  1G5W A;  4ES7 A;  4EDE A;  5HA1 A;  4AW8 A;  5AJC A;  1AVG I;  2F09 A;  1LIC A;  3ZQ3 A;  3CQR A;  1X8U A;  2CZU A;  4I3C A;  4ZGF A;  5KID A;  3NR3 A;  3BX8 A;  4IB8 A;  2OVD A;  4U8U M;  1IW2 A;  2QO6 A;  1D3S A;  1BRQ A;  4GET A;  3FR4 A;  3HWF A;  3ZW1 B;  1GX9 A;  5H8T A;  4A60 A;  4YGZ A;  3ZUO A;  2ACP X;  4IAB A;  2RD7 C;  5FEN A;  4IAX A;  1PEE A;  2Q9S A;  5FQ6 E;  3CBS A;  1LKE A;  2L9C A;  3FEN A;  4OS0 A;  4U8U N;  1R0U A;  1L6M A;  1NP4 A;  5HZ8 A;  1JBH A;  1IKJ A;  4XMC A;  4KC7 A;  3MBT A;  4I6S A;  3BY0 A;  3EBK A;  4I3D A;  4I3B A;  3KFI A;  1FTP A;  1SY2 A;  5LJC A;  1HQP A;  1DZP A;  1ERB A;  1RBP A;  5HWZ A;  1BWY A;  2A0A A;  4IBA A;  4XMF A;  4ID2 A;  3TGA A;  3CR6 A;  2YG2 A;  4WBK A;  3O22 A;  1U17 A;  2L67 A;  4XME A;  4ALO A;  1FE3 A;  1EIO A;  1AQB A;  1IFB A;  4IB7 A;  1BSO A;  5AJB A;  3S5V A;  5D47 A;  3WJC A;  1JZU A;  3HTY A;  1B4M A;  3IA8 A;  5DPQ A;  1A2D A;  3UEU A;  5AEO A;  1DZM A;  1EAL A;  1YUP A;  4ORU A;  4FBR A;  4YDA A;  3FYF A;  3B2I A;  3OE3 A;  5F6B A;  4RUU A;  3D4R A;  1FEN A;  3VG4 A;  2WUT A;  3STM X;  2GTL N;  2GC9 A;  5IO5 A;  4DQ4 A;  2K23 A;  4QGW A;  5BVQ A;  1BJ7 A;  1JV4 A;  2ZAI A;  3GAQ A;  1SXY A;  2JU8 A;  2JMB A;  1GT1 A;  4OMW A;  1HBP A;  4UU2 A;  4FQB B;  2Q4N A;  3NX2 A;  4M6S A;  2L5P A;  1IFC A;  4NLJ A;  2MWH A;  1BBP A;  2CBS A;  4LZV A;  4RUN A;  1QY0 A;  3K3L A;  3VE2 A;  2ZAG A;  3U03 A;  4HPC A;  5HCE C;  2CM9 A;  2R74 A;  1QQS A;  2Z4H A;  2HMB A;  4TLJ A;  2PY1 A;  3V8U A;  4A8Z A;  2MJI A;  1XKI A;  4YBU A;  1ML7 A;  4U8U O;  2JN3 A;  3AKM A;  2O62 A;  1I05 A;  1CBQ A;  1JYD A;  4XMG A;  2BLG A;  4O4X A;  2WR6 A;  2A3F X;  2QOS C;  2G78 A;  2L68 A;  2HLV A;  4K19 A;  3ZUI A;  5HZ6 A;  2RCT A;  2W2B A;  3EMM A;  4ORW A;  4ARH A;  2CM4 A;  4QZU A;  4AZM A;  3NX1 A;  1VYF A;  2QO5 A;  3MX7 A;  2M4L A;  1T8V A;  3ZW1 A;  5IO6 A;  3FR2 A;  3RBY A;  2MM3 A;  4HFO A;  4COT A;  3S60 A;  4YKO A;  1A3Y A;  2LBA A;  5FQ8 E;  5HA0 A;  1KQW A;  1EPA A;  1HN2 A;  2G7B A;  2FS7 A;  3L4R A;  4GU8 A;  2AH7 X;  1OEK A;  2GTF X;  5EDB A;  1X71 A;  3B2L A;  3STN A;  3O19 A;  4U9C A;  4GK9 A;  4QRL A;  3HOE A;  4ZR2 A;  3FA9 A;  3WJG A;  4BQU A;  4D6B A;  1P6P A;  3GE2 A;  4FBV A;  3OBL A;  2KD2 A;  3APW A;  3NBX X;  3PQU A;  3ZW2 A;  2LFO A;  4ZHF A;  3WVM A;  4UU3 A;  5KHP A;  1HBQ A;  1TOW A;  3NQK A;  1NGL A;  2AT8 X;  4QNI A;  3TZS A;  1KXO A;  3TGB A;  1UZ2 X;  4QGV A;  3FA6 A;  2AKQ A;  1ACD A;  2Z4I A;  3APU A;  3KFF A;  3FA8 A;  1X8O A;  2OZQ A;  4YMY A;  1ICN A;  1BSQ A;  3UEW A;  1KOI A;  4ZH6 A;  2W2F A;  2XST A;  4ML7 B;  4YFR A;  1BEB A;  1B0O A;  3VG5 A;  1GT3 A;  2BT9 A;  1I06 A;  5FQ7 E;  4AYH A;  3I0A A;  3SAO A;  3BS2 A;  3RSW A;  3N91 A;  5L8N A;  4DQ3 A;  1H91 A;  4OMX A;  4TNN A;  1E5P A;  3WXQ A;  5CE4 A;  1LPJ A;  4ORX A;  3PEC A;  2FLJ A;  1E06 A;  1FEM A;  5L8O A;  4EQA C;  2QMI A;  1KZW A;  3HWE A;  4ZH9 A;  4ZHH A;  3IFB A;  1SY1 A;  4NLI A;  1QAB E;  2IFB A;  2GJ5 A;  4GRJ A;  4I9S A;  4LZU A;  5BVS A;  3S26 A;  2AT5 X;  5HCC C;  5K06 A;  1IIU A;  1N0S A;  4KCA A;  4U3Q A;  3C76 X;  4QAE A;  1URE A;  2BS6 A;  1DV9 A;  2LBV A;  4MVI A;  4ODD A;  3ELX A;  3P24 A;  2OFM X;  2OFR X;  3APX A;  1EUO A;  1ZNE A;  3DSZ A;  4FGI B;  4I95 A;  2WQA E;  4BVM A;  5KIC A;  3FW5 A;  4LKT A;  4O4U A;  1S2P A;  2EU7 X;  1E02 A;  5DG4 A;  1CBS A;  2FWV A;  2JU3 A;  3CWK A;  4IAW A;  3TGC A;  5C0N A;  3FEL A;  4M7M A;  5EPQ A;  4MVK A;  5BYP A;  2GTL M;  1ADL A;  1ZNK A;  3DTQ A;  3FA7 A;  2FT9 A;  2JOZ A;  3PQS A;  4O3Z A;  3SOT A;  4GNY A;  3D96 A;  3U9P C;  1JJJ A;  1JJX A;  5HZ9 A;  3BU1 A;  2YMS A;  4YH0 A;  1U0X A;  3PED A;  4ON1 A;  1QFT A;  3HWG A;  1YIV A;  3JQO A;  5D8J A;  1BM5 A;  3BLG A;  3FMZ A;  1EII A;  4TQ2 A;  1QFV A;  4NP1 A;  3WJE A;  1LIB A;  1BRP A;  5F58 A;  1ZNH A;  4IMN A;  4PJ2 A;  4MIS A;  1GM6 A;  4HPA A;  4GNW A;  3NP1 A;  1D2U A;  2WSJ A;  5JR8 A;  1T68 X;  5FFH A;  2AT0 X;  1G7N A;  2KTD A;  5LJG A;  4QYP A;  2MO5 A;  1Y9T A;  3OD9 A;  2NNQ A;  4XMD A;  5H9A A;  1TOU A;  4QZT A;  3VG6 A;  2WEX A;  5D4A A;  2LA7 A;  5F6Z A;  4WFV A;  1T0V A;  1GKA B;  4O3X B;  5H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...