4GETA

Crystal structure of biogenic amine binding protein from rhodnius prolixus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
SGCSTVDTVKDFNKDNFFTGSWYITHYKLGDSTLEVGDKNCTKFLHQKTADGKIKEVFSNYNPNAKTYSYDISFAKVSDFDGNNGKYTAKNVIVEKDGRKIDERTLQVSYIDTDYSKYSVVHVCDPAAPDYYLYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGNKCQYDDETLQKLLKQSFPNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biogenic amine-binding protein
publication title Structure and ligand-binding properties of the biogenic amine-binding protein from the saliva of a blood-feeding insect vector of Trypanosoma cruzi.
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Amine-binding protein
total genus 55
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4getA00
2CBSA 3TGCA 3CWKA 2WEWA 4AZQA 1NGLA 4TKHA 1ZNEA 5FFHA 3KFFA 3P6FA 1JJXA 3WXQA 1A18A 4LKTA 1T68X 1E06A 2QO5A 3UEXA 4BQUA 1QQSA 4UU2A 4YH0A 2Q4NA 3P6HA 4QZUA 4YGGA 1U18A 4TKBA 2IFBA 4YFQA 3VG6A 5LJCA 2BLGA 4HPCA 4YGZA 2G79A 4AZNA 4YKMA 3CQRA 2A13A 5BVTA 1BSOA 1EIIA 1MUPA 2WUTA 2GJ5A 4ZR2A 2R73A 2DM5A 2AT5X 1SA8A 4HPDA 4ORRA 1I4UA 1X8UA 4HPAA 2WWPA 1LNMA 4ZHFA 1IKEA 2N93A 2JN3A 1A57A 3TZSA 2AT0X 1IIUA 2KT4B 2AT6X 4ORWA 1QFVA 3U9PC 3OJYC 5C0NA 1VYGA 2QO4A 1YIVA 3NQ3A 1KQWA 1GT4A 5EEDA 3B2LA 4AW8A 2X46A 4XMGA 4MVIA 4ZHCA 4ODDA 4NLJA 3EBWA 4ORSA 1FE3A 2FS6A 4DQ4A 2L5PA 3MBTA 5K06A 3BLGA 1O1UA 2CM4A 4K19A 1VYFA 3ZUIA 1IFCA 1G85A 4XMFA 2NNDA 1PM1X 4O9SA 5L8NA 1DV9A 4YFPA 1SY1A 3RSWA 2ALLX 2ACPX 4YGHA 2NNEA 3O2YA 4YDAA 1BSYA 3BY0A 1LIDA 1XKIA 1JJJA 1YP7A 4WFUA 2L68A 1AQBA 2CBRA 3APXA 4EXZA 4BOEA 2FR2A 1HMRA 1BEBA 3B2HA 4QAEA 5FAZA 4GNWA 4LZUA 1GT1A 1HMSA 2KTDA 5DPQA 3F9DA 1LPJA 2GC9A 4NYRA 2GTFX 5EZ2A 3O19A 4XMEA 5DG4A 4YFRA 1EW3A 3VG4A 1LIEA 2FS7A 2AT8X 5HTEA 1KT5A 4AZMA 1QFTA 2WQ9A 4TLJA 2FT9A 5B27A 2QM9A 4XMDA 1AVGI 2HZRA 1ZNDA 2R56A 3FLLA 3KFGA 3TF6A 1ADLA 4ORYA 3FA6A 1G5WA 1BRQA 5D8JA 3VG2A 4ZGUA 3KZAA 3DTQA 1LKEA 1G74A 4IB6A 4OMXA 1ICMA 4NLIA 4OMWA 4IB7A 4ZHHA 1H91A 1X8QA 2HNXA 2MM3A 5B29A 1ML7A 1BLRA 1UREA 1D3SA 1E5PA 3P6DA 3AKMA 3PH5A 2QOSC 4Y0SA 3STMX 4AZRA 2ASNX 1DFVA 2RQ0A 3DSZA 4OS8A 1VPRA 4QYNA 3HK1A 2Q39A 3BU1A 3HWFA 2G78A 3BS2A 4TKJA 1GX8A 5BVSA 2G7BA 3CBCA 3FW5A 1GXAA 1LIFA 2RCTA 1ZRYA 2X45A 2K23A 1TW4A 1B8EA 2L67A 2RCQA 3APUA 1CBSA 3U0DA 5KHPA 3TGBA 4IB8A 1KT3A 3FR5A 3NADA 1FELA 3KFIA 1I05A 4OS0A 1A2DA 4QGWA 4N7DA 1EXSA 1SXWA 4IAXA 1JZUA 3WJBA 2FTBA 1B0OA 4WFVA 3FR4A 3D95A 5D4AA 4ES7A 1OEKA 1BM5A 2QO6A 1L6MA 3VG7A 1GGLA 1X89A 4RUNA 1LIBA 1UZ2X 2NP1A 4IMOA 1TOUA 2W2FA 3APVA 3C78X 4D6AA 3EM0A 5IO7A 1PMPA 5CE4A 1JV4A 4A1YA 1QY1A 3FR2A 1GX9A 1TXLA 2NNQA 1QG5A 2AL0X 4LKPA 3APWA 3ELXA 3UEVA 2JU3A 2Q2PA 2RD7C 3ELZA 3PECA 5D47A 1OBQA 5KICA 1ERBA 1FENA 3GAQA 1LICA 1GKAA 4GETA 3BX8A 5HWZA 1HBPA 3FA8A 3JS1A 4ZCBA 1I06A 1YWAA 1GT3A 4TQ2A 5L8OA 1EALA 2FRSA 3EYCA 1EUOA 5F1EA 5HZ6A 5IO5A 3S26A 1BSQA 3ZUOA 2LFOA 2L9CA 4YDBA 1DZJA 4Y0QA 1TOWA 1CBIA 3I17A 3NQ9A 1NP4A 1KGLA 4QGVA 5L8IA 2LB6A 2CZTA 4Y0PA 1DZMA 1B4MA 2A2UA 1GKAB 3C77X 1OPBA 3G7XA 1T8VA 3KFHA 3BU9A 5HTDA 3IFBA 4YBPA 5HCDC 2CM9A 2AKQA 5HZ5A 1OEEA 5D45A 1ZNGA 2EU7X 5EPQA 4YMYA 1EIOA 3F8AA 4DQ3A 1ZNHA 3B2IA 3WJGA 1AELA 5AQ6A 5F6BA 4PSQA 1BRPA 5F7GA 2YG2A 1OEJA 3BSZE 1MX8A 5LJHA 2WEXA 2Q2MA 4I3DA 4QGXA 1T0VA 1G7NA 4OS3A 2AT3X 5H9AA 4ALOA 4LZVA 1ICNA 1TVQA 2JOZA 4IAWA 2LKKA 4HPBA 1X8OA 5LJKA 2P8GA 4BVMA 3WBGA 3WJCA 5HBSA 4QZTA 4TJZA 3L4RA 1QABE 1LF7A 1GM6A 4IBAA 1O1VA 3RZYA 3FIQA 4M7MA 5EEEA 1D2UA 3TGAA 5F6ZA 1KZXA 3VG5A 1U0XA 2CZUA 4GNYA 5EDBA 2R74A 2A0AA 2LBAA 5LJBA 4MVLA 5HZQA 3EMMA 1DZKA 1KZWA 4GRJA 1ACDA 1PEEA 5HAEA 3PH6A 4MVKA 1QWDA 4KIIA 2FLJA 2XSTA 2WR6A 4R0BA 3BX7A 4YCEA 3T1DA 4ZFXA 4N7CA 4HFOA 4D6BA 2MO5A 1E02A 3FENA 4A60A 2E4JA 3HWGA 1KOIA 4IB9A 2HMBA 3PP6A 5LKFA 4RUUA 1DF3A 1IKJA 3CQNA 4EDEA 3NPOA 1ALBA 4Y0RA 3C76X 4XMCA 1EPAA 3NR3A 3D97A 4NNTA 3NP1A 4AZPA 4ZJ0A 5D48A 1YWDA 1U17A 3QKGA 5HA1A 1EQDA 1MDCA 3I0AA 3P6GA 3MVFA 1KQXA 2OVDA 3P6CA 1NP1A 3BDRA 5LJGA 1CBQA 4EFGA 4QYPA 4TNNA 4YKOA 1OBPA 3CBSA 1RBPA 2WSJA 1IFBA 1X71A 1SXYA 4ZHGA 1ZNLA 3STKA 2PY1A 3WJEA 1PBOA 1AB0A 3FELA 1RLBE 3IA8A 1SXUA 5BVQA 1OBUA 4M6SA 1OPAA 2XKLA 3AKNA 3B2JA 2HZQA 5H9KA 2OZQA 3FA7A 5LJEA 4IMNA 2AMMX 3B2KA 1SY3A 3HWEA 4NNSA 4AYHA 2WQAE 5HZ8A 1HBQA 2W2BA 4I3BA 2ACOA 5FENA 1YWCA 2HLVA 1KT4A 2JU7A 1LFOA 3NX1A 4UU3A 1XCAA 1I04A 2F73A 3CR6A 4ZHDA 5HCEC 1KT7A 5HA0A 3FEPA 3ZQ3A 3WJDA 1S7DA 3VG3A 1BBPA 1S44A 4ZH6A 1EPBA 1SY0A 1X8PA 2K62A 1X8NA 2OVEA 4ORXA 1FEMA 2AH7X 3SAOA 4AZOA 5HZ9A 3HWDA 1YP6A 2W2AA 5H9NA 3FA9A 1CRBA 1BWYA 4YCHA 2A3FX 2RA6A 1KT6A 4ALBA 4ZH9A 4A1HA 4GKCA 1MVGA 4I3CA 3UEWA 4GE1A 2HYSA 1JYJA 1ERXA 5HCCC 1HMTA 1YUPA 3NX2A 4EEJA 5H8TA 1ZNKA 3KQ0A 2OVAA 1IW2A 1E00A 1HN2A 3FMZA 2MJIA 1CJ5A 1P6PA 5EDCA 1SY2A 2FWVA 1DC9A 1N0SA 3FW4A 1FDQA 3PEDA 4I9SA 5LJDA 1YWBA 1BJ7A 1FTPA 1SXXA 4WBKA 2ANSA 2O62A 5H9LA 1DZPA 4GH7A 3O22A 2A2GA 1KXOA 3EBKA 3FEKA 1GT5A 3K3LA 1Z24A 3P6EA 1A3YA 3PPTA 4I9RA 3U03A 4CK4A 1R0UA 4NYQA 5LKEA 1O8VA 5KIDA 2POAA 5F58A 1QY2A 2OFMX 2Q9SA 3STNA 4XMHA 2LBVA 3Q6LA 1B56A 4YBUA 1JYDA 1CBRA 4ARHA 1MX7A 3CMPA 4ORUA 1S2PA 4A8ZA 3JSQA 4NP1A 1JBHA 3WJFA 1HQPA 1QY0A 3BRNA 3D96A 2JU8A 2FR3A 3WVMA 5JR8A 3UEUA 5IO6A 2OFRX
chains in the Genus database with same CATH superfamily
3OE3A 2CBSA 2RTEB 2MWHA 5IRAA 3TGCA 3CWKA 1W4TA 2WEWA 5CSEA 3LHNA 1VWDB 4MIRA 3AUMO 5CHKA 4AZQA 4FBRA 1NGLA 1SRHA 1ZNEA 4TKHA 5FFHA 3KFFA 3P6FA 4BX7B 2PI3O 4KC8A 1A18A 4LKTA 3WXQA 4CDDA 1WBIA 1JJXA 1T68X 4DNEA 1E06A 1VWRB 2QO5A 3UEXA 1NQMA 1Y9LA 1QQSA 4BQUA 4UU2A 4YH0A 2Q4NA 3P6HA 1JIWI 1VWFB 4QZUA 4YGGA 1SWQA 5L3YA 1U18A 3OD9A 4TKBA 2HKDA 1JJUA 2IFBA 4YFQA 3AEHA 3VG6A 3VG3A 2RTNB 5LJCA 2BLGA 4HPCA 1HY2A 4JO6A 5B2AO 4YGZA 2G79A 4AZNA 1LCZA 4YKMA 2IZAA 5K68A 3CQRA 1VWNB 2A13A 5BVTA 1BSOA 4O3WA 1MUPA 1VWIB 1EIIA 2WUTA 2GJ5A 4ZR2A 1VWJB 2R73A 2RTHB 2DM5A 2AT5X 4KC7A 4U8UO 3WYPA 4DCBA 1SA8A 2VFCA 2QMIA 3PQUA 4HPDA 4ORRA 1I4UA 1X8UA 3KVNA 4HPAA 4INNA 4Z2VA 2WWPA 3H3IA 2X8SA 5IXGA 1LNMA 4YVBA 2Y32A 4ZHFA 1IKEA 2N93A 2JN3A 3SLJA 1A57A 2UZ2A 3TZSA 2AT0X 1IIUA 3OBLA 2KT4B 2AT6X 1STSB 4ML7B 4ORWA 3ZW2A 4CPIA 4ON1A 1QFVA 4I60A 4L3RA 3U9PC 3OJYC 4QRLA 3E3CA 1SWEA 4BGFA 1VYGA 5C0NA 2QO4A 1YIVA 3HOEA 3NQ3A 3RY2A 1KQWA 1GT4A 2Z4HA 1STPA 5EEDA 3B2LA 4AW8A 2X46A 4XMGA 1LELA 1NDJA 2QCBA 2G5LA 4MVIA 1SWSA 4GU8A 1VWQB 1Y9TA 3FIDA 4ODDA 4NLJA 4Z2PA 4ZHCA 4U8UN 2DJGA 3EBWA 4ORSA 3WYQA 1NBXA 1FE3A 2FS6A 4DQ4A 2L5PA 3MBTA 2YMSA 3BLGA 1O1UA 2CM4A 4K19A 3ZWEA 5K06A 1VYFA 3ZUIA 1IFCA 3QQ2A 1G85A 2WPUA 4XMFA 2NNDA 1PM1X 4O9SA 3RY1A 5L8NA 1DV9A 4YFPA 1Y53X 1SY1A 2ZAGA 3RSWA 2ALLX 2ACPX 3WZNA 4YGHA 2NNEA 3O2YA 4YDAA 1MOYA 1BSYA 2A8GA 3BY0A 4GJVA 1LIDA 1XKIA 4PJ2A 1JJJA 1YP7A 4WFUA 2BHVA 2RTCB 2L68A 5B10O 1I9HA 1AQBA 2CBRA 3APXA 4MISA 4EQAC 4EXZA 4BOEA 2FR2A 2Z4IA 4GD9A 3P02A 1HMRA 1BEBA 3B2HA 4QAEA 5FAZA 1IJ8A 4GNWA 1GT1A 4LZUA 1EIOA 1HMSA 2KTDA 3NQKA 4IABA 2Y3FA 5DPQA 3F9DA 1LPJA 2GC9A 4NYRA 2GTFX 5EZ2A 1SWJA 3O19A 2ZAIA 1K24A 2A5CA 1EW3A 4XMEA 5DG4A 3VG4A 4YFRA 1LIEA 2BSZA 2FS7A 2AT8X 5HTEA 3RDOA 1KT5A 2CAMA 1QFTA 2JW1A 2WQ9A 4TLJA 4WHIA 4AZMA 4GUZA 2FT9A 5B27A 1KL4A 2QM9A 4XMDA 1AVGI 2AF5A 2HZRA 5IRUA 1ZNDA 3UAQA 3T6FA 2R56A 2ZSCA 3FLLA 3KFGA 3TF6A 2GTLO 4GK9A 1ADLA 1SWTA 4ORYA 3FA6A 1G5WA 1BRQA 2IZIA 2RTBB 5D8JA 2KTSA 3VG2A 4Z2OA 4ZGUA 3KZAA 3DTQA 1LKEA 1G74A 3WZOA 4IB6A 4OMXA 1ICMA 4NLIA 4OMWA 4IB7A 5BYPA 4ZHHA 4CDEA 2KW1A 2RTAA 4GDAA 1H91A 1X8QA 3JQOA 4GGTA 2HNXA 2MM3A 3EW2A 5B29A 3GE2A 1ML7A 1BLRA 1UREA 1D3SA 1SWPA 1E5PA 1HXLA 3P6DA 3AKMA 3PH5A 2QOSC 4Y0SA 3STMX 4AZRA 2ASNX 1PBYA 1DFVA 4ZGFA 1SLEB 2GTLN 2RQ0A 3DSZA 1VPRA 4OS8A 2JGSA 4QYNA 3HK1A 1HXZA 2Q39A 3BU1A 1JQPA 2G78A 2OVSA 3BS2A 3HWFA 4TKJA 1GX8A 5BVSA 2G7BA 2X55A 3CBCA 3FW5A 1GXAA 1LIFA 2RCTA 1ZRYA 2X45A 1SWFA 2K23A 3VE1A 1K3BA 1TW4A 1B8EA 2L67A 2RCQA 3APUA 1CBSA 3PQSA 3SLOA 3U0DA 5KHPA 1LDOA 3TGBA 4IB8A 1KT3A 3FR5A 3NADA 2MHDA 1FELA 3KFIA 1I05A 4OS0A 1A2DA 1SWRA 4N7DA 1EXSA 1UYOX 4QGWA 1VWMB 2RTJA 3RDXA 1SXWA 4IAXA 1JZUA 1Y55X 2FTBA 3WJBA 1B0OA 4GDZA 5B5FA 4WFVA 3FR4A 3D95A 3F6ZB 2BS5A 4OKAA 5D4AA 2C1QA 3RWXA 4ES7A 1OEKA 1SWAA 4LQZA 1BM5A 2QO6A 3N91A 1L6MA 3VG7A 1GGLA 1X89A 2A5BA 3HOLA 4RUNA 1LIBA 4KH8A 1UZ2X 2NP1A 4IMOA 1TOUA 2W2FA 3APVA 3C78X 2IZBA 1KL5A 2RTDB 1PMPA 3EM0A 1JV4A 4O4OA 4A1YA 4D6AA 5CE4A 5IO7A 1MM9A 3RDMA 1NQNA 1QY1A 1N7YA 2IZHB 3FR2A 3RDSA 1GX9A 1RSTB 1TXLA 1SRIA 1PTSA 1SWHA 4U8UM 3SLTA 2NNQA 1QG5A 2AL0X 4LKPA 5FQ6E 3APWA 3ELXA 1RXKA 1SLGB 2OF8A 3D4RA 1VWPB 2JU3A 2RTFB 2OY5O 2Q2PA 4FQBB 3UEVA 2RD7C 3MM0A 3RBYA 2F01A 3ELZA 3PECA 1AVEA 5D47A 1OBQA 3PDFA 1ERBA 1FENA 5KICA 3GAQA 1LICA 3T2XA 2FKJA 1GKAA 4GETA 4FBOA 3BX8A 5HWZA 3VE2A 1HBPA 3FA8A 3JS1A 4ZCBA 1KL3A 2OFRX 2Y3EA 3FYFA 1EI5A 3V8UA 1I06A 1YWAA 4B55A 1GT3A 4TQ2A 5L8OA 1EALA 2FRSA 3EYCA 1EUOA 3RKGA 4GGRA 5F1EA 5HZ6A 5IO5A 1WUBA 3S26A 1BSQA 3ZUOA 2LFOA 1VYOA 2RTMA 4O3ZA 1SLFB 1SWUA 2L9CA 2KD2A 2MF6A 4YDBA 1DZJA 4Y0QA 1TOWA 1CBIA 3I17A 3NQ9A 1NP4A 3ZZVA 1KGLA 4QGVA 1VWOB 5L8IA 2LB6A 2CZTA 2I5ZO 4Y0PA 1DZMA 4CDFA 5FQ7E 4CPEA 1B4MA 4U46A 1GKAB 2A2UA 3C77X 1OPBA 3G7XA 1T8VA 3KFHA 3BU9A 2IZEB 5HTDA 1LCVA 3IFBA 4YBPA 2X56A 5HCDC 2CM9A 2AKQA 1LDQA 2RTKA 1OEEA 4O4UA 2IZCB 5D45A 5HZ5A 1ZNGA 2EU7X 5EPQA 4YMYA 2M4LA 1W6FA 2OL6O 3F8AA 4DQ3A 1ZNHA 3B2IA 3WJGA 5IRWA 5JD2A 5AQ6A 5F6BA 3RDQA 1AELA 4PSQA 4FGIB 1VWHB 2RTGB 1BRPA 2LA7A 5F7GA 2YG2A 4Y59A 1DF8A 1OEJA 3BSZE 1MX8A 5LJHA 2JMBA 2WEXA 2Q2MA 4I3DA 1VWGB 4QGXA 1T0VA 1G7NA 4L1NA 4OS3A 2AT3X 5H9AA 5K67A 4ALOA 4LZVA 1MEPA 2GTLM 2IZDB 1ICNA 1TVQA 2JOZA 4IAWA 2LKKA 2X8TA 1X8OA 4FBVA 4HPBA 2P8GA 3ZW0A 5LJKA 4BVMA 3WBGA 3WJCA 2IZKA 5HBSA 3ZW1A 4U9CA 2BT9A 4QZTA 2BC3A 4TJZA 3L4RA 3SZIA 1QABE 1LF7A 1GM6A 4IBAA 2X32A 1N43A 1O1VA 3SZJA 3RZYA 3FIQA 1Y0GA 1SRGA 4M7MA 3EC5A 3VHHA 5EEEA 1D2UA 3TGAA 5F6ZA 1KZXA 1SWDA 4COTA 2C4IA 3VG5A 1U0XA 2CZUA 4GNYA 5EDBA 3HTYA 3T6LA 2R74A 2A0AA 2LBAA 3MX7A 5LJBA 2OL7A 4MVLA 2X34A 2AVIA 5HZQA 3EMMA 4EEJA 3CKFA 1DZKA 1KZWA 4GRJA 1ACDA 1PEEA 5AEOA 5HAEA 3PH6A 5B11O 3ZI8A 4MVKA 2C1SA 3ZW0B 1QWDA 4KIIA 2F09A 1HQQA 4I6SA 2FLJA 2XSTA 3D9WA 2WR6A 4R0BA 4BCSA 4GZVA 3BX7A 4YCEA 3T1DA 4ZFXA 4N7CA 4HFOA 4D6BA 2MO5A 1E02A 3FENA 4O49A 4A60A 2E4JA 3HWGA 3VPJE 1KOIA 4IB9A 2OF9A 2HMBA 3PP6A 1GX3A 2OY7A 3S60A 5LKFA 4RUUA 4QQ1A 1DF3A 1IKJA 3CQNA 3LTWA 4EDEA 4JHQA 3NPOA 4NW4A 1ALBA 4OELA 4Y0RA 3S5VA 3C76X 2VFBA 4XMCA 5AJCA 1EPAA 3NR3A 3D97A 4NNTA 3NP1A 4AZPA 4ZJ0A 1Y52X 5D48A 3EW1A 1YWDA 1U17A 3QKGA 4NV8A 5HA1A 1EQDA 1MDCA 3I0AA 3P6GA 1SWGA 1N9YA 3MVFA 1KQXA 2GH7A 2OVDA 4JNJA 3P6CA 2RTPB 1NP1A 5B5GA 3BDRA 5LJGA 4BX6A 4QNIA 1CBQA 4EFGA 4QYPA 4TNNA 4YKOA 1OBPA 3CBSA 1RBPA 2WSJA 1SREA 1X71A 1IFBA 1SXYA 4ZHGA 3RE5A 1ZNLA 3STKA 2PY1A 1VWKB 1PBOA 3WJEA 2FKGA 1AB0A 3FELA 1VWAB 1RLBE 3PK2A 1SWCA 5F2BA 3IA8A 1SXUA 5BVQA 4OEMA 1OBUA 4M6SA 1OPAA 4O3XB 1I78A 1NC9A 2XKLA 3AKNA 3B2JA 2HZQA 4BX5A 5H9KA 2OZQA 3FA7A 2OFAA 5LJEA 4IMNA 1FJ1E 2AMMX 1SY3A 3B2KA 3HWEA 2UYWA 2RTLA 4NNSA 4AYHA 4JGLA 2WQAE 5HZ8A 4GGZA 1HBQA 4BX6B 2W2BA 4I3BA 2ACOA 4Z27A 5FENA 3MG5A 1W5RA 1YWCA 2HLVA 1KT4A 2JU7A 2IZJA 1LFOA 3NX1A 4I95A 4UU3A 1XCAA 1SWBA 2RTRB 1I04A 2F73A 3CR6A 4CDCA 4BBOA 4U3QA 4ZHDA 3WJDA 1SWLA 4ID2A 1E2TA 5HCEC 3LV4A 1KT7A 3WOVA 5HA0A 3Q34A 3FEPA 2FHNX 4GJSA 3ZQ3A 1JMZA 1OSPO 1RXJA 1BBPA 1S44A 1S7DA 2IZLB 4ZH6A 1EPBA 1VWCB 4MVEA 4CSBA 4BX5B 1SY0A 1X8PA 2X4MA 3RE6A 2OY1O 1SWKA 2K62A 1X8NA 2OVEA 4ORXA 1FEMA 2FHLA 2AH7X 3SAOA 2QOMA 4AZOA 4KT5A 5HZ9A 2OL8O 3HWDA 1YP6A 2W2AA 4O4SA 5H9NA 5FQ8E 2VDFA 3FA9A 1CRBA 4CV7A 1BWYA 4YCHA 1LUQA 2A3FX 1KT6A 2RA6A 4ALBA 4ZH9A 4A1HA 4GKCA 1MVGA 4I3CA 4Y5DA 1SRJA 3UEWA 4Z6JA 4IRWA 2G8CO 4GE1A 2HYSA 5AJBA 1JYJA 4CPFA 1ERXA 1KFFA 5HCCC 1HMTA 1SRFA 1SWNA 1YUPA 3NX2A 4MEEA 5H8TA 3WZPA 2BS6A 2IZFB 3FDCA 4O3YA 1ZNKA 3KQ0A 2OVAA 1N9MA 1VWBB 3RDUA 1IW2A 1E00A 3NBXX 3X00A 3FMZA 3HPEA 2MJIA 4O4XA 4CPHA 1CJ5A 1P6PA 5EDCA 2RTOB 4KCAA 3T2WA 4C5PA 1SY2A 2FWVA 1DC9A 1N0SA 3FW4A 1FDQA 3PEDA 4I9SA 5LJDA 1YWBA 1BJ7A 1FTPA 1VWEB 1SXXA 4WBKA 2ANSA 2O62A 2OFBA 2IZGB 2FGSA 2X8FA 1DZPA 3P24A 4GH7A 5H9LA 1RSUB 3O22A 2A2GA 1KXOA 2OYBO 3EBKA 3FEKA 1GT5A 3K3LA 1Z24A 3P6EA 3WZQA 1A3YA 2RTIB 3PPTA 4I9RA 3SOTA 3CKGA 4CK4A 1R0UA 4NYQA 3VGWA 5LKEA 4HWMA 3U03A 1O8VA 4Z28A 2RN4A 5KIDA 2POAA 5F58A 4BJ8A 1QY2A 2OFMX 2Q9SA 3STNA 4XMHA 3SZHA 2LBVA 4EKVA 3ZW1B 5CYBA 4BX7A 3Q6LA 1B56A 4YBUA 2RTQB 2I5VO 4CPHB 1JYDA 5B3MO 1CBRA 4ARHA 1MX7A 1N4JA 2DJFA 3CMPA 4ORUA 1LCWA 1RXHA 1AVDA 1S2PA 1SLDB 3JSQA 1UYNX 4NP1A 4A8ZA 1JBHA 3WJFA 1JMXA 3VU1A 3VHMA 3VHIA 2OY8A 1HQPA 1QY0A 1MK5A 1VWLB 3BRNA 3D96A 2JU8A 2FR3A 1SMPI 3S5XA 3WVMA 1SWOA 3UEUA 5IO6A 1RAVA 5JR8A 4NV7A 1HN2A 1STRB
chains in the Genus database with same CATH topology
3OE3A 2CBSA 2MWHA 3TGCA 3CWKA 2WEWA 3LHNA 4MIRA 4AZQA 4FBRA 1NGLA 4TKHA 1ZNEA 5FFHA 3KFFA 3P6FA 1JJXA 4KC8A 1A18A 4LKTA 3WXQA 1T68X 1E06A 2QO5A 3UEXA 1Y9LA 1QQSA 4BQUA 4UU2A 4YH0A 2Q4NA 3P6HA 1JIWI 4QZUA 4YGGA 1U18A 3OD9A 4TKBA 2IFBA 4YFQA 3VG6A 5LJCA 2BLGA 4HPCA 4YGZA 2G79A 4AZNA 4YKMA 3CQRA 2A13A 5BVTA 1BSOA 4O3WA 1MUPA 1EIIA 2WUTA 2GJ5A 4ZR2A 2R73A 4KC7A 2DM5A 2AT5X 4U8UO 1SA8A 2QMIA 3PQUA 4HPDA 4ORRA 1I4UA 1X8UA 4INNA 4HPAA 2WWPA 3H3IA 2X8SA 1LNMA 4ZHFA 1IKEA 2N93A 2JN3A 1A57A 3TZSA 2AT0X 1IIUA 3OBLA 2KT4B 2AT6X 4ML7B 4ORWA 3ZW2A 4ON1A 1QFVA 4L3RA 3U9PC 3OJYC 4QRLA 3E3CA 5C0NA 1VYGA 2QO4A 1YIVA 3HOEA 3NQ3A 1KQWA 1GT4A 2Z4HA 5EEDA 3B2LA 4AW8A 2X46A 4XMGA 4MVIA 4GU8A 4ZHCA 1Y9TA 4ODDA 4NLJA 4U8UN 3EBWA 4ORSA 1FE3A 2FS6A 4DQ4A 2L5PA 3MBTA 2YMSA 3BLGA 1O1UA 2CM4A 4K19A 3ZWEA 5K06A 1VYFA 3ZUIA 1IFCA 1G85A 4XMFA 2NNDA 1PM1X 4O9SA 5L8NA 1DV9A 4YFPA 1SY1A 2ZAGA 3RSWA 2ALLX 2ACPX 4YGHA 2NNEA 3O2YA 4YDAA 1BSYA 3BY0A 4PJ2A 1LIDA 1XKIA 1JJJA 1YP7A 4WFUA 2BHVA 2L68A 1AQBA 2CBRA 3APXA 4MISA 4EQAC 4EXZA 4BOEA 2FR2A 2Z4IA 3P02A 1HMRA 1BEBA 3B2HA 4QAEA 5FAZA 4GNWA 4LZUA 1GT1A 1HMSA 2KTDA 3NQKA 4IABA 5DPQA 3F9DA 1LPJA 2GC9A 4NYRA 2GTFX 5EZ2A 3O19A 4XMEA 2ZAIA 5DG4A 4YFRA 1EW3A 3VG4A 1LIEA 2FS7A 2AT8X 5HTEA 1KT5A 2JW1A 1QFTA 4WHIA 2WQ9A 4TLJA 4AZMA 2FT9A 5B27A 2QM9A 4XMDA 1AVGI 2HZRA 1ZNDA 3UAQA 2R56A 3FLLA 3KFGA 3TF6A 2GTLO 4GK9A 1ADLA 4ORYA 3FA6A 1G5WA 1BRQA 5D8JA 2KTSA 3VG2A 4ZGUA 3KZAA 3DTQA 1LKEA 1G74A 4IB6A 4OMXA 1ICMA 4NLIA 4OMWA 4IB7A 5BYPA 4ZHHA 2KW1A 1H91A 1X8QA 3JQOA 2HNXA 2MM3A 5B29A 3GE2A 1ML7A 1BLRA 1UREA 1D3SA 1E5PA 3P6DA 3AKMA 3PH5A 2QOSC 4Y0SA 3STMX 4AZRA 2ASNX 1DFVA 4ZGFA 2GTLN 2RQ0A 3DSZA 1VPRA 4OS8A 4QYNA 3HK1A 2Q39A 3BU1A 3HWFA 2G78A 2OVSA 3BS2A 4TKJA 1GX8A 5BVSA 2G7BA 3CBCA 3FW5A 1GXAA 1LIFA 2RCTA 1ZRYA 2X45A 2K23A 3VE1A 1TW4A 1B8EA 2L67A 2RCQA 3APUA 1CBSA 3PQSA 3U0DA 5KHPA 3TGBA 4IB8A 1KT3A 3FR5A 3NADA 2MHDA 1FELA 3KFIA 1I05A 4OS0A 1A2DA 4QGWA 4N7DA 1EXSA 1SXWA 4IAXA 1JZUA 3WJBA 2FTBA 1B0OA 4GDZA 4WFVA 3FR4A 3D95A 3F6ZB 2BS5A 5D4AA 3RWXA 4ES7A 1OEKA 4LQZA 1BM5A 2QO6A 3N91A 1L6MA 3VG7A 1GGLA 1X89A 3HOLA 4RUNA 1LIBA 4KH8A 1UZ2X 2NP1A 4IMOA 1TOUA 2W2FA 3APVA 3C78X 4O4OA 3EM0A 4D6AA 1PMPA 5CE4A 1JV4A 5IO7A 4A1YA 1QY1A 3FR2A 1GX9A 1TXLA 4U8UM 2NNQA 1QG5A 2AL0X 4LKPA 5FQ6E 3APWA 3ELXA 3D4RA 3UEVA 2JU3A 2Q2PA 4FQBB 2RD7C 3RBYA 3ELZA 3PECA 5D47A 1OBQA 5KICA 1ERBA 1FENA 3GAQA 1LICA 1GKAA 4GETA 4FBOA 3BX8A 5HWZA 3VE2A 1HBPA 3FA8A 3JS1A 4ZCBA 3FYFA 1EI5A 3V8UA 1I06A 1YWAA 1GT3A 4TQ2A 5L8OA 1EALA 2FRSA 3EYCA 1EUOA 3RKGA 5F1EA 5HZ6A 5IO5A 3S26A 1BSQA 3ZUOA 2LFOA 4O3ZA 2L9CA 2KD2A 4YDBA 1DZJA 4Y0QA 1TOWA 1CBIA 3I17A 3NQ9A 1NP4A 3ZZVA 1KGLA 4QGVA 5L8IA 2LB6A 2CZTA 4Y0PA 1DZMA 5FQ7E 1B4MA 2A2UA 1GKAB 3C77X 1OPBA 3G7XA 1T8VA 3KFHA 3BU9A 5HTDA 3IFBA 4YBPA 5HCDC 2CM9A 2AKQA 4O4UA 5HZ5A 1OEEA 5D45A 1ZNGA 2EU7X 5EPQA 4YMYA 2M4LA 3F8AA 1EIOA 4DQ3A 1ZNHA 3B2IA 3WJGA 1AELA 5AQ6A 5F6BA 4PSQA 4FGIB 1BRPA 2LA7A 5F7GA 2YG2A 1OEJA 3BSZE 1MX8A 5LJHA 2JMBA 2WEXA 2Q2MA 4I3DA 4QGXA 1T0VA 1G7NA 4L1NA 4OS3A 2AT3X 5H9AA 4ALOA 4LZVA 2GTLM 1ICNA 1TVQA 2JOZA 4IAWA 2LKKA 2X8TA 1X8OA 4FBVA 4HPBA 2P8GA 3ZW0A 5LJKA 4BVMA 3WBGA 3WJCA 5HBSA 3ZW1A 4U9CA 2BT9A 4QZTA 4TJZA 3L4RA 1QABE 1LF7A 1GM6A 4IBAA 1O1VA 3RZYA 3FIQA 4M7MA 5EEEA 1D2UA 3TGAA 5F6ZA 1KZXA 4COTA 3VG5A 1U0XA 2CZUA 4GNYA 5EDBA 3HTYA 2R74A 2A0AA 2LBAA 3MX7A 5LJBA 4MVLA 5HZQA 3EMMA 1DZKA 1KZWA 4GRJA 1ACDA 1PEEA 5AEOA 5HAEA 3PH6A 3ZI8A 4MVKA 3ZW0B 1QWDA 4KIIA 2F09A 4I6SA 2FLJA 2XSTA 2WR6A 4R0BA 4GZVA 3BX7A 4YCEA 3T1DA 4ZFXA 4N7CA 4HFOA 4D6BA 2MO5A 1E02A 3FENA 4O49A 4A60A 2E4JA 3HWGA 3VPJE 1KOIA 4IB9A 2HMBA 3PP6A 3S60A 5LKFA 4RUUA 4QQ1A 1DF3A 1IKJA 3CQNA 4EDEA 3NPOA 4NW4A 1ALBA 4Y0RA 3S5VA 3C76X 4XMCA 5AJCA 1EPAA 3NR3A 3D97A 4NNTA 3NP1A 4AZPA 4ZJ0A 5D48A 1YWDA 1U17A 3QKGA 5HA1A 1EQDA 1MDCA 3I0AA 3P6GA 3MVFA 1KQXA 2OVDA 3P6CA 1NP1A 3BDRA 5LJGA 4QNIA 1CBQA 4EFGA 4QYPA 4TNNA 4YKOA 1OBPA 3CBSA 1RBPA 2WSJA 1IFBA 1X71A 1SXYA 4ZHGA 1ZNLA 3STKA 2PY1A 3WJEA 1PBOA 1AB0A 3FELA 1RLBE 3IA8A 1SXUA 5BVQA 1OBUA 4M6SA 1OPAA 4O3XB 2XKLA 3AKNA 3B2JA 2HZQA 5H9KA 2OZQA 3FA7A 5LJEA 4IMNA 2AMMX 3B2KA 1SY3A 3HWEA 4NNSA 4AYHA 4JGLA 2WQAE 5HZ8A 1HBQA 2W2BA 4I3BA 2ACOA 5FENA 1YWCA 2HLVA 1KT4A 2JU7A 1LFOA 3NX1A 4I95A 4UU3A 1XCAA 1I04A 2F73A 3CR6A 4U3QA 4ZHDA 4ID2A 5HCEC 3LV4A 1KT7A 3WOVA 5HA0A 3FEPA 3ZQ3A 3WJDA 1S7DA 3VG3A 1BBPA 1S44A 4ZH6A 1EPBA 4MVEA 4CSBA 1SY0A 1X8PA 2K62A 1X8NA 2OVEA 4ORXA 1FEMA 2AH7X 3SAOA 4AZOA 4KT5A 5HZ9A 3HWDA 1YP6A 2W2AA 4O4SA 5H9NA 5FQ8E 3FA9A 1CRBA 4CV7A 1BWYA 4YCHA 2A3FX 2RA6A 1KT6A 4ALBA 4ZH9A 4A1HA 4GKCA 1MVGA 4I3CA 3UEWA 4GE1A 2HYSA 5AJBA 1JYJA 1ERXA 5HCCC 1HMTA 1YUPA 3NX2A 4EEJA 5H8TA 2BS6A 4O3YA 1ZNKA 3KQ0A 2OVAA 1IW2A 1E00A 3NBXX 1HN2A 3FMZA 2MJIA 4O4XA 1CJ5A 1P6PA 5EDCA 4KCAA 1SY2A 2FWVA 1DC9A 1N0SA 3FW4A 1FDQA 3PEDA 4I9SA 5LJDA 1YWBA 1BJ7A 1FTPA 1SXXA 4WBKA 2ANSA 2O62A 2X8FA 5H9LA 1DZPA 3P24A 4GH7A 3O22A 2A2GA 1KXOA 3EBKA 3FEKA 1GT5A 3K3LA 1Z24A 3P6EA 1A3YA 3PPTA 4I9RA 3SOTA 4CK4A 3U03A 1R0UA 4NYQA 5LKEA 4HWMA 1O8VA 5KIDA 2RN4A 2POAA 5F58A 1QY2A 2OFMX 2Q9SA 3STNA 4XMHA 2LBVA 3ZW1B 5CYBA 3Q6LA 1B56A 4YBUA 1JYDA 1CBRA 4ARHA 1MX7A 3CMPA 4ORUA 1S2PA 4A8ZA 3JSQA 4NP1A 1JBHA 3WJFA 3VU1A 1HQPA 1QY0A 3BRNA 3D96A 2JU8A 2FR3A 1SMPI 3S5XA 3WVMA 3UEUA 5IO6A 5JR8A 2OFRX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBS A;  3TGC A;  3CWK A;  2WEW A;  4AZQ A;  1NGL A;  4TKH A;  1ZNE A;  5FFH A;  3KFF A;  3P6F A;  1JJX A;  3WXQ A;  1A18 A;  4LKT A;  1T68 X;  1E06 A;  2QO5 A;  3UEX A;  4BQU A;  1QQS A;  4UU2 A;  4YH0 A;  2Q4N A;  3P6H A;  4QZU A;  4YGG A;  1U18 A;  4TKB A;  2IFB A;  4YFQ A;  3VG6 A;  5LJC A;  2BLG A;  4HPC A;  4YGZ A;  2G79 A;  4AZN A;  4YKM A;  3CQR A;  2A13 A;  5BVT A;  1BSO A;  1EII A;  1MUP A;  2WUT A;  2GJ5 A;  4ZR2 A;  2R73 A;  2DM5 A;  2AT5 X;  1SA8 A;  4HPD A;  4ORR A;  1I4U A;  1X8U A;  4HPA A;  2WWP A;  1LNM A;  4ZHF A;  1IKE A;  2N93 A;  2JN3 A;  1A57 A;  3TZS A;  2AT0 X;  1IIU A;  2KT4 B;  2AT6 X;  4ORW A;  1QFV A;  3U9P C;  3OJY C;  5C0N A;  1VYG A;  2QO4 A;  1YIV A;  3NQ3 A;  1KQW A;  1GT4 A;  5EED A;  3B2L A;  4AW8 A;  2X46 A;  4XMG A;  4MVI A;  4ZHC A;  4ODD A;  4NLJ A;  3EBW A;  4ORS A;  1FE3 A;  2FS6 A;  4DQ4 A;  2L5P A;  3MBT A;  5K06 A;  3BLG A;  1O1U A;  2CM4 A;  4K19 A;  1VYF A;  3ZUI A;  1IFC A;  1G85 A;  4XMF A;  2NND A;  1PM1 X;  4O9S A;  5L8N A;  1DV9 A;  4YFP A;  1SY1 A;  3RSW A;  2ALL X;  2ACP X;  4YGH A;  2NNE A;  3O2Y A;  4YDA A;  1BSY A;  3BY0 A;  1LID A;  1XKI A;  1JJJ A;  1YP7 A;  4WFU A;  2L68 A;  1AQB A;  2CBR A;  3APX A;  4EXZ A;  4BOE A;  2FR2 A;  1HMR A;  1BEB A;  3B2H A;  4QAE A;  5FAZ A;  4GNW A;  4LZU A;  1GT1 A;  1HMS A;  2KTD A;  5DPQ A;  3F9D A;  1LPJ A;  2GC9 A;  4NYR A;  2GTF X;  5EZ2 A;  3O19 A;  4XME A;  5DG4 A;  4YFR A;  1EW3 A;  3VG4 A;  1LIE A;  2FS7 A;  2AT8 X;  5HTE A;  1KT5 A;  4AZM A;  1QFT A;  2WQ9 A;  4TLJ A;  2FT9 A;  5B27 A;  2QM9 A;  4XMD A;  1AVG I;  2HZR A;  1ZND A;  2R56 A;  3FLL A;  3KFG A;  3TF6 A;  1ADL A;  4ORY A;  3FA6 A;  1G5W A;  1BRQ A;  5D8J A;  3VG2 A;  4ZGU A;  3KZA A;  3DTQ A;  1LKE A;  1G74 A;  4IB6 A;  4OMX A;  1ICM A;  4NLI A;  4OMW A;  4IB7 A;  4ZHH A;  1H91 A;  1X8Q A;  2HNX A;  2MM3 A;  5B29 A;  1ML7 A;  1BLR A;  1URE A;  1D3S A;  1E5P A;  3P6D A;  3AKM A;  3PH5 A;  2QOS C;  4Y0S A;  3STM X;  4AZR A;  2ASN X;  1DFV A;  2RQ0 A;  3DSZ A;  4OS8 A;  1VPR A;  4QYN A;  3HK1 A;  2Q39 A;  3BU1 A;  3HWF A;  2G78 A;  3BS2 A;  4TKJ A;  1GX8 A;  5BVS A;  2G7B A;  3CBC A;  3FW5 A;  1GXA A;  1LIF A;  2RCT A;  1ZRY A;  2X45 A;  2K23 A;  1TW4 A;  1B8E A;  2L67 A;  2RCQ A;  3APU A;  1CBS A;  3U0D A;  5KHP A;  3TGB A;  4IB8 A;  1KT3 A;  3FR5 A;  3NAD A;  1FEL A;  3KFI A;  1I05 A;  4OS0 A;  1A2D A;  4QGW A;  4N7D A;  1EXS A;  1SXW A;  4IAX A;  1JZU A;  3WJB A;  2FTB A;  1B0O A;  4WFV A;  3FR4 A;  3D95 A;  5D4A A;  4ES7 A;  1OEK A;  1BM5 A;  2QO6 A;  1L6M A;  3VG7 A;  1GGL A;  1X89 A;  4RUN A;  1LIB A;  1UZ2 X;  2NP1 A;  4IMO A;  1TOU A;  2W2F A;  3APV A;  3C78 X;  4D6A A;  3EM0 A;  5IO7 A;  1PMP A;  5CE4 A;  1JV4 A;  4A1Y A;  1QY1 A;  3FR2 A;  1GX9 A;  1TXL A;  2NNQ A;  1QG5 A;  2AL0 X;  4LKP A;  3APW A;  3ELX A;  3UEV A;  2JU3 A;  2Q2P A;  2RD7 C;  3ELZ A;  3PEC A;  5D47 A;  1OBQ A;  5KIC A;  1ERB A;  1FEN A;  3GAQ A;  1LIC A;  1GKA A;  4GET A;  3BX8 A;  5HWZ A;  1HBP A;  3FA8 A;  3JS1 A;  4ZCB A;  1I06 A;  1YWA A;  1GT3 A;  4TQ2 A;  5L8O A;  1EAL A;  2FRS A;  3EYC A;  1EUO A;  5F1E A;  5HZ6 A;  5IO5 A;  3S26 A;  1BSQ A;  3ZUO A;  2LFO A;  2L9C A;  4YDB A;  1DZJ A;  4Y0Q A;  1TOW A;  1CBI A;  3I17 A;  3NQ9 A;  1NP4 A;  1KGL A;  4QGV A;  5L8I A;  2LB6 A;  2CZT A;  4Y0P A;  1DZM A;  1B4M A;  2A2U A;  1GKA B;  3C77 X;  1OPB A;  3G7X A;  1T8V A;  3KFH A;  3BU9 A;  5HTD A;  3IFB A;  4YBP A;  5HCD C;  2CM9 A;  2AKQ A;  5HZ5 A;  1OEE A;  5D45 A;  1ZNG A;  2EU7 X;  5EPQ A;  4YMY A;  1EIO A;  3F8A A;  4DQ3 A;  1ZNH A;  3B2I A;  3WJG A;  1AEL A;  5AQ6 A;  5F6B A;  4PSQ A;  1BRP A;  5F7G A;  2YG2 A;  1OEJ A;  3BSZ E;  1MX8 A;  5LJH A;  2WEX A;  2Q2M A;  4I3D A;  4QGX A;  1T0V A;  1G7N A;  4OS3 A;  2AT3 X;  5H9A A;  4ALO A;  4LZV A;  1ICN A;  1TVQ A;  2JOZ A;  4IAW A;  2LKK A;  4HPB A;  1X8O A;  5LJK A;  2P8G A;  4BVM A;  3WBG A;  3WJC A;  5HBS A;  4QZT A;  4TJZ A;  3L4R A;  1QAB E;  1LF7 A;  1GM6 A;  4IBA A;  1O1V A;  3RZY A;  3FIQ A;  4M7M A;  5EEE A;  1D2U A;  3TGA A;  5F6Z A;  1KZX A;  3VG5 A;  1U0X A;  2CZU A;  4GNY A;  5EDB A;  2R74 A;  2A0A A;  2LBA A;  5LJB A;  4MVL A;  5HZQ A;  3EMM A;  1DZK A;  1KZW A;  4GRJ A;  1ACD A;  1PEE A;  5HAE A;  3PH6 A;  4MVK A;  1QWD A;  4KII A;  2FLJ A;  2XST A;  2WR6 A;  4R0B A;  3BX7 A;  4YCE A;  3T1D A;  4ZFX A;  4N7C A;  4HFO A;  4D6B A;  2MO5 A;  1E02 A;  3FEN A;  4A60 A;  2E4J A;  3HWG A;  1KOI A;  4IB9 A;  2HMB A;  3PP6 A;  5LKF A;  4RUU A;  1DF3 A;  1IKJ A;  3CQN A;  4EDE A;  3NPO A;  1ALB A;  4Y0R A;  3C76 X;  4XMC A;  1EPA A;  3NR3 A;  3D97 A;  4NNT A;  3NP1 A;  4AZP A;  4ZJ0 A;  5D48 A;  1YWD A;  1U17 A;  3QKG A;  5HA1 A;  1EQD A;  1MDC A;  3I0A A;  3P6G A;  3MVF A;  1KQX A;  2OVD A;  3P6C A;  1NP1 A;  3BDR A;  5LJG A;  1CBQ A;  4EFG A;  4QYP A;  4TNN A;  4YKO A;  1OBP A;  3CBS A;  1RBP A;  2WSJ A;  1IFB A;  1X71 A;  1SXY A;  4ZHG A;  1ZNL A;  3STK A;  2PY1 A;  3WJE A;  1PBO A;  1AB0 A;  3FEL A;  1RLB E;  3IA8 A;  1SXU A;  5BVQ A;  1OBU A;  4M6S A;  1OPA A;  2XKL A;  3AKN A;  3B2J A;  2HZQ A;  5H9K A;  2OZQ A;  3FA7 A;  5LJE A;  4IMN A;  2AMM X;  3B2K A;  1SY3 A;  3HWE A;  4NNS A;  4AYH A;  2WQA E;  5HZ8 A;  1HBQ A;  2W2B A;  4I3B A;  2ACO A;  5FEN A;  1YWC A;  2HLV A;  1KT4 A;  2JU7 A;  1LFO A;  3NX1 A;  4UU3 A;  1XCA A;  1I04 A;  2F73 A;  3CR6 A;  4ZHD A;  5HCE C;  1KT7 A;  5HA0 A;  3FEP A;  3ZQ3 A;  3WJD A;  1S7D A;  3VG3 A;  1BBP A;  1S44 A;  4ZH6 A;  1EPB A;  1SY0 A;  1X8P A;  2K62 A;  1X8N A;  2OVE A;  4ORX A;  1FEM A;  2AH7 X;  3SAO A;  4AZO A;  5HZ9 A;  3HWD A;  1YP6 A;  2W2A A;  5H9N A;  3FA9 A;  1CRB A;  1BWY A;  4YCH A;  2A3F X;  2RA6 A;  1KT6 A;  4ALB A;  4ZH9 A;  4A1H A;  4GKC A;  1MVG A;  4I3C A;  3UEW A;  4GE1 A;  2HYS A;  1JYJ A;  1ERX A;  5HCC C;  1HMT A;  1YUP A;  3NX2 A;  4EEJ A;  5H8T A;  1ZNK A;  3KQ0 A;  2OVA A;  1IW2 A;  1E00 A;  1HN2 A;  3FMZ A;  2MJI A;  1CJ5 A;  1P6P A;  5EDC A;  1SY2 A;  2FWV A;  1DC9 A;  1N0S A;  3FW4 A;  1FDQ A;  3PED A;  4I9S A;  5LJD A;  1YWB A;  1BJ7 A;  1FTP A;  1SXX A;  4WBK A;  2ANS A;  2O62 A;  5H9L A;  1DZP A;  4GH7 A;  3O22 A;  2A2G A;  1KXO A;  3EBK A;  3FEK A;  1GT5 A;  3K3L A;  1Z24 A;  3P6E A;  1A3Y A;  3PPT A;  4I9R A;  3U03 A;  4CK4 A;  1R0U A;  4NYQ A;  5LKE A;  1O8V A;  5KID A;  2POA A;  5F58 A;  1QY2 A;  2OFM X;  2Q9S A;  3STN A;  4XMH A;  2LBV A;  3Q6L A;  1B56 A;  4YBU A;  1JYD A;  1CBR A;  4ARH A;  1MX7 A;  3CMP A;  4ORU A;  1S2P A;  4A8Z A;  3JSQ A;  4NP1 A;  1JBH A;  3WJF A;  1HQP A;  1QY0 A;  3BRN A;  3D96 A;  2JU8 A;  2FR3 A;  3WVM A;  5JR8 A;  3UEU A;  5IO6 A;  2OFR X; 
#chains in the Genus database with same CATH topology
 3OE3 A;  2CBS A;  2RTE B;  2MWH A;  5IRA A;  3TGC A;  3CWK A;  1W4T A;  2WEW A;  5CSE A;  3LHN A;  1VWD B;  4MIR A;  3AUM O;  5CHK A;  4AZQ A;  4FBR A;  1NGL A;  1SRH A;  1ZNE A;  4TKH A;  5FFH A;  3KFF A;  3P6F A;  4BX7 B;  2PI3 O;  4KC8 A;  1A18 A;  4LKT A;  3WXQ A;  4CDD A;  1WBI A;  1JJX A;  1T68 X;  4DNE A;  1E06 A;  1VWR B;  2QO5 A;  3UEX A;  1NQM A;  1Y9L A;  1QQS A;  4BQU A;  4UU2 A;  4YH0 A;  2Q4N A;  3P6H A;  1JIW I;  1VWF B;  4QZU A;  4YGG A;  1SWQ A;  5L3Y A;  1U18 A;  3OD9 A;  4TKB A;  2HKD A;  1JJU A;  2IFB A;  4YFQ A;  3AEH A;  3VG6 A;  3VG3 A;  2RTN B;  5LJC A;  2BLG A;  4HPC A;  1HY2 A;  4JO6 A;  5B2A O;  4YGZ A;  2G79 A;  4AZN A;  1LCZ A;  4YKM A;  2IZA A;  5K68 A;  3CQR A;  1VWN B;  2A13 A;  5BVT A;  1BSO A;  4O3W A;  1MUP A;  1VWI B;  1EII A;  2WUT A;  2GJ5 A;  4ZR2 A;  1VWJ B;  2R73 A;  2RTH B;  2DM5 A;  2AT5 X;  4KC7 A;  4U8U O;  3WYP A;  4DCB A;  1SA8 A;  2VFC A;  2QMI A;  3PQU A;  4HPD A;  4ORR A;  1I4U A;  1X8U A;  3KVN A;  4HPA A;  4INN A;  4Z2V A;  2WWP A;  3H3I A;  2X8S A;  5IXG A;  1LNM A;  4YVB A;  2Y32 A;  4ZHF A;  1IKE A;  2N93 A;  2JN3 A;  3SLJ A;  1A57 A;  2UZ2 A;  3TZS A;  2AT0 X;  1IIU A;  3OBL A;  2KT4 B;  2AT6 X;  1STS B;  4ML7 B;  4ORW A;  3ZW2 A;  4CPI A;  4ON1 A;  1QFV A;  4I60 A;  4L3R A;  3U9P C;  3OJY C;  4QRL A;  3E3C A;  1SWE A;  4BGF A;  1VYG A;  5C0N A;  2QO4 A;  1YIV A;  3HOE A;  3NQ3 A;  3RY2 A;  1KQW A;  1GT4 A;  2Z4H A;  1STP A;  5EED A;  3B2L A;  4AW8 A;  2X46 A;  4XMG A;  1LEL A;  1NDJ A;  2QCB A;  2G5L A;  4MVI A;  1SWS A;  4GU8 A;  1VWQ B;  1Y9T A;  3FID A;  4ODD A;  4NLJ A;  4Z2P A;  4ZHC A;  4U8U N;  2DJG A;  3EBW A;  4ORS A;  3WYQ A;  1NBX A;  1FE3 A;  2FS6 A;  4DQ4 A;  2L5P A;  3MBT A;  2YMS A;  3BLG A;  1O1U A;  2CM4 A;  4K19 A;  3ZWE A;  5K06 A;  1VYF A;  3ZUI A;  1IFC A;  3QQ2 A;  1G85 A;  2WPU A;  4XMF A;  2NND A;  1PM1 X;  4O9S A;  3RY1 A;  5L8N A;  1DV9 A;  4YFP A;  1Y53 X;  1SY1 A;  2ZAG A;  3RSW A;  2ALL X;  2ACP X;  3WZN A;  4YGH A;  2NNE A;  3O2Y A;  4YDA A;  1MOY A;  1BSY A;  2A8G A;  3BY0 A;  4GJV A;  1LID A;  1XKI A;  4PJ2 A;  1JJJ A;  1YP7 A;  4WFU A;  2BHV A;  2RTC B;  2L68 A;  5B10 O;  1I9H A;  1AQB A;  2CBR A;  3APX A;  4MIS A;  4EQA C;  4EXZ A;  4BOE A;  2FR2 A;  2Z4I A;  4GD9 A;  3P02 A;  1HMR A;  1BEB A;  3B2H A;  4QAE A;  5FAZ A;  1IJ8 A;  4GNW A;  1GT1 A;  4LZU A;  1EIO A;  1HMS A;  2KTD A;  3NQK A;  4IAB A;  2Y3F A;  5DPQ A;  3F9D A;  1LPJ A;  2GC9 A;  4NYR A;  2GTF X;  5EZ2 A;  1SWJ A;  3O19 A;  2ZAI A;  1K24 A;  2A5C A;  1EW3 A;  4XME A;  5DG4 A;  3VG4 A;  4YFR A;  1LIE A;  2BSZ A;  2FS7 A;  2AT8 X;  5HTE A;  3RDO A;  1KT5 A;  2CAM A;  1QFT A;  2JW1 A;  2WQ9 A;  4TLJ A;  4WHI A;  4AZM A;  4GUZ A;  2FT9 A;  5B27 A;  1KL4 A;  2QM9 A;  4XMD A;  1AVG I;  2AF5 A;  2HZR A;  5IRU A;  1ZND A;  3UAQ A;  3T6F A;  2R56 A;  2ZSC A;  3FLL A;  3KFG A;  3TF6 A;  2GTL O;  4GK9 A;  1ADL A;  1SWT A;  4ORY A;  3FA6 A;  1G5W A;  1BRQ A;  2IZI A;  2RTB B;  5D8J A;  2KTS A;  3VG2 A;  4Z2O A;  4ZGU A;  3KZA A;  3DTQ A;  1LKE A;  1G74 A;  3WZO A;  4IB6 A;  4OMX A;  1ICM A;  4NLI A;  4OMW A;  4IB7 A;  5BYP A;  4ZHH A;  4CDE A;  2KW1 A;  2RTA A;  4GDA A;  1H91 A;  1X8Q A;  3JQO A;  4GGT A;  2HNX A;  2MM3 A;  3EW2 A;  5B29 A;  3GE2 A;  1ML7 A;  1BLR A;  1URE A;  1D3S A;  1SWP A;  1E5P A;  1HXL A;  3P6D A;  3AKM A;  3PH5 A;  2QOS C;  4Y0S A;  3STM X;  4AZR A;  2ASN X;  1PBY A;  1DFV A;  4ZGF A;  1SLE B;  2GTL N;  2RQ0 A;  3DSZ A;  1VPR A;  4OS8 A;  2JGS A;  4QYN A;  3HK1 A;  1HXZ A;  2Q39 A;  3BU1 A;  1JQP A;  2G78 A;  2OVS A;  3BS2 A;  3HWF A;  4TKJ A;  1GX8 A;  5BVS A;  2G7B A;  2X55 A;  3CBC A;  3FW5 A;  1GXA A;  1LIF A;  2RCT A;  1ZRY A;  2X45 A;  1SWF A;  2K23 A;  3VE1 A;  1K3B A;  1TW4 A;  1B8E A;  2L67 A;  2RCQ A;  3APU A;  1CBS A;  3PQS A;  3SLO A;  3U0D A;  5KHP A;  1LDO A;  3TGB A;  4IB8 A;  1KT3 A;  3FR5 A;  3NAD A;  2MHD A;  1FEL A;  3KFI A;  1I05 A;  4OS0 A;  1A2D A;  1SWR A;  4N7D A;  1EXS A;  1UYO X;  4QGW A;  1VWM B;  2RTJ A;  3RDX A;  1SXW A;  4IAX A;  1JZU A;  1Y55 X;  2FTB A;  3WJB A;  1B0O A;  4GDZ A;  5B5F A;  4WFV A;  3FR4 A;  3D95 A;  3F6Z B;  2BS5 A;  4OKA A;  5D4A A;  2C1Q A;  3RWX A;  4ES7 A;  1OEK A;  1SWA A;  4LQZ A;  1BM5 A;  2QO6 A;  3N91 A;  1L6M A;  3VG7 A;  1GGL A;  1X89 A;  2A5B A;  3HOL A;  4RUN A;  1LIB A;  4KH8 A;  1UZ2 X;  2NP1 A;  4IMO A;  1TOU A;  2W2F A;  3APV A;  3C78 X;  2IZB A;  1KL5 A;  2RTD B;  1PMP A;  3EM0 A;  1JV4 A;  4O4O A;  4A1Y A;  4D6A A;  5CE4 A;  5IO7 A;  1MM9 A;  3RDM A;  1NQN A;  1QY1 A;  1N7Y A;  2IZH B;  3FR2 A;  3RDS A;  1GX9 A;  1RST B;  1TXL A;  1SRI A;  1PTS A;  1SWH A;  4U8U M;  3SLT A;  2NNQ A;  1QG5 A;  2AL0 X;  4LKP A;  5FQ6 E;  3APW A;  3ELX A;  1RXK A;  1SLG B;  2OF8 A;  3D4R A;  1VWP B;  2JU3 A;  2RTF B;  2OY5 O;  2Q2P A;  4FQB B;  3UEV A;  2RD7 C;  3MM0 A;  3RBY A;  2F01 A;  3ELZ A;  3PEC A;  1AVE A;  5D47 A;  1OBQ A;  3PDF A;  1ERB A;  1FEN A;  5KIC A;  3GAQ A;  1LIC A;  3T2X A;  2FKJ A;  1GKA A;  4GET A;  4FBO A;  3BX8 A;  5HWZ A;  3VE2 A;  1HBP A;  3FA8 A;  3JS1 A;  4ZCB A;  1KL3 A;  2OFR X;  2Y3E A;  3FYF A;  1EI5 A;  3V8U A;  1I06 A;  1YWA A;  4B55 A;  1GT3 A;  4TQ2 A;  5L8O A;  1EAL A;  2FRS A;  3EYC A;  1EUO A;  3RKG A;  4GGR A;  5F1E A;  5HZ6 A;  5IO5 A;  1WUB A;  3S26 A;  1BSQ A;  3ZUO A;  2LFO A;  1VYO A;  2RTM A;  4O3Z A;  1SLF B;  1SWU A;  2L9C A;  2KD2 A;  2MF6 A;  4YDB A;  1DZJ A;  4Y0Q A;  1TOW A;  1CBI A;  3I17 A;  3NQ9 A;  1NP4 A;  3ZZV A;  1KGL A;  4QGV A;  1VWO B;  5L8I A;  2LB6 A;  2CZT A;  2I5Z O;  4Y0P A;  1DZM A;  4CDF A;  5FQ7 E;  4CPE A;  1B4M A;  4U46 A;  1GKA B;  2A2U A;  3C77 X;  1OPB A;  3G7X A;  1T8V A;  3KFH A;  3BU9 A;  2IZE B;  5HTD A;  1LCV A;  3IFB A;  4YBP A;  2X56 A;  5HCD C;  2CM9 A;  2AKQ A;  1LDQ A;  2RTK A;  1OEE A;  4O4U A;  2IZC B;  5D45 A;  5HZ5 A;  1ZNG A;  2EU7 X;  5EPQ A;  4YMY A;  2M4L A;  1W6F A;  2OL6 O;  3F8A A;  4DQ3 A;  1ZNH A;  3B2I A;  3WJG A;  5IRW A;  5JD2 A;  5AQ6 A;  5F6B A;  3RDQ A;  1AEL A;  4PSQ A;  4FGI B;  1VWH B;  2RTG B;  1BRP A;  2LA7 A;  5F7G A;  2YG2 A;  4Y59 A;  1DF8 A;  1OEJ A;  3BSZ E;  1MX8 A;  5LJH A;  2JMB A;  2WEX A;  2Q2M A;  4I3D A;  1VWG B;  4QGX A;  1T0V A;  1G7N A;  4L1N A;  4OS3 A;  2AT3 X;  5H9A A;  5K67 A;  4ALO A;  4LZV A;  1MEP A;  2GTL M;  2IZD B;  1ICN A;  1TVQ A;  2JOZ A;  4IAW A;  2LKK A;  2X8T A;  1X8O A;  4FBV A;  4HPB A;  2P8G A;  3ZW0 A;  5LJK A;  4BVM A;  3WBG A;  3WJC A;  2IZK A;  5HBS A;  3ZW1 A;  4U9C A;  2BT9 A;  4QZT A;  2BC3 A;  4TJZ A;  3L4R A;  3SZI A;  1QAB E;  1LF7 A;  1GM6 A;  4IBA A;  2X32 A;  1N43 A;  1O1V A;  3SZJ A;  3RZY A;  3FIQ A;  1Y0G A;  1SRG A;  4M7M A;  3EC5 A;  3VHH A;  5EEE A;  1D2U A;  3TGA A;  5F6Z A;  1KZX A;  1SWD A;  4COT A;  2C4I A;  3VG5 A;  1U0X A;  2CZU A;  4GNY A;  5EDB A;  3HTY A;  3T6L A;  2R74 A;  2A0A A;  2LBA A;  3MX7 A;  5LJB A;  2OL7 A;  4MVL A;  2X34 A;  2AVI A;  5HZQ A;  3EMM A;  4EEJ A;  3CKF A;  1DZK A;  1KZW A;  4GRJ A;  1ACD A;  1PEE A;  5AEO A;  5HAE A;  3PH6 A;  5B11 O;  3ZI8 A;  4MVK A;  2C1S A;  3ZW0 B;  1QWD A;  4KII A;  2F09 A;  1HQQ A;  4I6S A;  2FLJ A;  2XST A;  3D9W A;  2WR6 A;  4R0B A;  4BCS A;  4GZV A;  3BX7 A;  4YCE A;  3T1D A;  4ZFX A;  4N7C A;  4HFO A;  4D6B A;  2MO5 A;  1E02 A;  3FEN A;  4O49 A;  4A60 A;  2E4J A;  3HWG A;  3VPJ E;  1KOI A;  4IB9 A;  2OF9 A;  2HMB A;  3PP6 A;  1GX3 A;  2OY7 A;  3S60 A;  5LKF A;  4RUU A;  4QQ1 A;  1DF3 A;  1IKJ A;  3CQN A;  3LTW A;  4EDE A;  4JHQ A;  3NPO A;  4NW4 A;  1ALB A;  4OEL A;  4Y0R A;  3S5V A;  3C76 X;  2VFB A;  4XMC A;  5AJC A;  1EPA A;  3NR3 A;  3D97 A;  4NNT A;  3NP1 A;  4AZP A;  4ZJ0 A;  1Y52 X;  5D48 A;  3EW1 A;  1YWD A;  1U17 A;  3QKG A;  4NV8 A;  5HA1 A;  1EQD A;  1MDC A;  3I0A A;  3P6G A;  1SWG A;  1N9Y A;  3MVF A;  1KQX A;  2GH7 A;  2OVD A;  4JNJ A;  3P6C A;  2RTP B;  1NP1 A;  5B5G A;  3BDR A;  5LJG A;  4BX6 A;  4QNI A;  1CBQ A;  4EFG A;  4QYP A;  4TNN A;  4YKO A;  1OBP A;  3CBS A;  1RBP A;  2WSJ A;  1SRE A;  1X71 A;  1IFB A;  1SXY A;  4ZHG A;  3RE5 A;  1ZNL A;  3STK A;  2PY1 A;  1VWK B;  1PBO A;  3WJE A;  2FKG A;  1AB0 A;  3FEL A;  1VWA B;  1RLB E;  3PK2 A;  1SWC A;  5F2B A;  3IA8 A;  1SXU A;  5BVQ A;  4OEM A;  1OBU A;  4M6S A;  1OPA A;  4O3X B;  1I78 A;  1NC9 A;  2XKL A;  3AKN A;  3B2J A;  2HZQ A;  4BX5 A;  5H9K A;  2OZQ A;  3FA7 A;  2OFA A;  5LJE A;  4IMN A;  1FJ1 E;  2AMM X;  1SY3 A;  3B2K A;  3HWE A;  2UYW A;  2RTL A;  4NNS A;  4AYH A;  4JGL A;  2WQA E;  5HZ8 A;  4GGZ A;  1HBQ A;  4BX6 B;  2W2B A;  4I3B A;  2ACO A;  4Z27 A;  5FEN A;  3MG5 A;  1W5R A;  1YWC A;  2HLV A;  1KT4 A;  2JU7 A;  2IZJ A;  1LFO A;  3NX1 A;  4I95 A;  4UU3 A;  1XCA A;  1SWB A;  2RTR B;  1I04 A;  2F73 A;  3CR6 A;  4CDC A;  4BBO A;  4U3Q A;  4ZHD A;  3WJD A;  1SWL A;  4ID2 A;  1E2T A;  5HCE C;  3LV4 A;  1KT7 A;  3WOV A;  5HA0 A;  3Q34 A;  3FEP A;  2FHN X;  4GJS A;  3ZQ3 A;  1JMZ A;  1OSP O;  1RXJ A;  1BBP A;  1S44 A;  1S7D A;  2IZL B;  4ZH6 A;  1EPB A;  1VWC B;  4MVE A;  4CSB A;  4BX5 B;  1SY0 A;  1X8P A;  2X4M A;  3RE6 A;  2OY1 O;  1SWK A;  2K62 A;  1X8N A;  2OVE A;  4ORX A;  1FEM A;  2FHL A;  2AH7 X;  3SAO A;  2QOM A;  4AZO A;  4KT5 A;  5HZ9 A;  2OL8 O;  3HWD A;  1YP6 A;  2W2A A;  4O4S A;  5H9N A;  5FQ8 E;  2VDF A;  3FA9 A;  1CRB A;  4CV7 A;  1BWY A;  4YCH A;  1LUQ A;  2A3F X;  1KT6 A;  2RA6 A;  4ALB A;  4ZH9 A;  4A1H A;  4GKC A;  1MVG A;  4I3C A;  4Y5D A;  1SRJ A;  3UEW A;  4Z6J A;  4IRW A;  2G8C O;  4GE1 A;  2HYS A;  5AJB A;  1JYJ A;  4CPF A;  1ERX A;  1KFF A;  5HCC C;  1HMT A;  1SRF A;  1SWN A;  1YUP A;  3NX2 A;  4MEE A;  5H8T A;  3WZP A;  2BS6 A;  2IZF B;  3FDC A;  4O3Y A;  1ZNK A;  3KQ0 A;  2OVA A;  1N9M A;  1VWB B;  3RDU A;  1IW2 A;  1E00 A;  3NBX X;  3X00 A;  3FMZ A;  3HPE A;  2MJI A;  4O4X A;  4CPH A;  1CJ5 A;  1P6P A;  5EDC A;  2RTO B;  4KCA A;  3T2W A;  4C5P A;  1SY2 A;  2FWV A;  1DC9 A;  1N0S A;  3FW4 A;  1FDQ A;  3PED A;  4I9S A;  5LJD A;  1YWB A;  1BJ7 A;  1FTP A;  1VWE B;  1SXX A;  4WBK A;  2ANS A;  2O62 A;  2OFB A;  2IZG B;  2FGS A;  2X8F A;  1DZP A;  3P24 A;  4GH7 A;  5H9L A;  1RSU B;  3O22 A;  2A2G A;  1KXO A;  2OYB O;  3EBK A;  3FEK A;  1GT5 A;  3K3L A;  1Z24 A;  3P6E A;  3WZQ A;  1A3Y A;  2RTI B;  3PPT A;  4I9R A;  3SOT A;  3CKG A;  4CK4 A;  1R0U A;  4NYQ A;  3VGW A;  5LKE A;  4HWM A;  3U03 A;  1O8V A;  4Z28 A;  2RN4 A;  5KID A;  2POA A;  5F58 A;  4BJ8 A;  1QY2 A;  2OFM X;  2Q9S A;  3STN A;  4XMH A;  3SZH A;  2LBV A;  4EKV A;  3ZW1 B;  5CYB A;  4BX7 A;  3Q6L A;  1B56 A;  4YBU A;  2RTQ B;  2I5V O;  4CPH B;  1JYD A;  5B3M O;  1CBR A;  4ARH A;  1MX7 A;  1N4J A;  2DJF A;  3CMP A;  4ORU A;  1LCW A;  1RXH A;  1AVD A;  1S2P A;  1SLD B;  3JSQ A;  1UYN X;  4NP1 A;  4A8Z A;  1JBH A;  3WJF A;  1JMX A;  3VU1 A;  3VHM A;  3VHI A;  2OY8 A;  1HQP A;  1QY0 A;  1MK5 A;  1VWL B;  3BRN A;  3D96 A;  2JU8 A;  2FR3 A;  1SMP I;  3S5X A;  3WVM A;  1SWO A;  3UEU A;  5IO6 A;  1RAV A;  5JR8 A;  4NV7 A;  1HN2 A;  1STR B; 
#chains in the Genus database with same CATH homology
 3OE3 A;  2CBS A;  2MWH A;  3TGC A;  3CWK A;  2WEW A;  3LHN A;  4MIR A;  4AZQ A;  4FBR A;  1NGL A;  4TKH A;  1ZNE A;  5FFH A;  3KFF A;  3P6F A;  1JJX A;  4KC8 A;  1A18 A;  4LKT A;  3WXQ A;  1T68 X;  1E06 A;  2QO5 A;  3UEX A;  1Y9L A;  1QQS A;  4BQU A;  4UU2 A;  4YH0 A;  2Q4N A;  3P6H A;  1JIW I;  4QZU A;  4YGG A;  1U18 A;  3OD9 A;  4TKB A;  2IFB A;  4YFQ A;  3VG6 A;  5LJC A;  2BLG A;  4HPC A;  4YGZ A;  2G79 A;  4AZN A;  4YKM A;  3CQR A;  2A13 A;  5BVT A;  1BSO A;  4O3W A;  1MUP A;  1EII A;  2WUT A;  2GJ5 A;  4ZR2 A;  2R73 A;  4KC7 A;  2DM5 A;  2AT5 X;  4U8U O;  1SA8 A;  2QMI A;  3PQU A;  4HPD A;  4ORR A;  1I4U A;  1X8U A;  4INN A;  4HPA A;  2WWP A;  3H3I A;  2X8S A;  1LNM A;  4ZHF A;  1IKE A;  2N93 A;  2JN3 A;  1A57 A;  3TZS A;  2AT0 X;  1IIU A;  3OBL A;  2KT4 B;  2AT6 X;  4ML7 B;  4ORW A;  3ZW2 A;  4ON1 A;  1QFV A;  4L3R A;  3U9P C;  3OJY C;  4QRL A;  3E3C A;  5C0N A;  1VYG A;  2QO4 A;  1YIV A;  3HOE A;  3NQ3 A;  1KQW A;  1GT4 A;  2Z4H A;  5EED A;  3B2L A;  4AW8 A;  2X46 A;  4XMG A;  4MVI A;  4GU8 A;  4ZHC A;  1Y9T A;  4ODD A;  4NLJ A;  4U8U N;  3EBW A;  4ORS A;  1FE3 A;  2FS6 A;  4DQ4 A;  2L5P A;  3MBT A;  2YMS A;  3BLG A;  1O1U A;  2CM4 A;  4K19 A;  3ZWE A;  5K06 A;  1VYF A;  3ZUI A;  1IFC A;  1G85 A;  4XMF A;  2NND A;  1PM1 X;  4O9S A;  5L8N A;  1DV9 A;  4YFP A;  1SY1 A;  2ZAG A;  3RSW A;  2ALL X;  2ACP X;  4YGH A;  2NNE A;  3O2Y A;  4YDA A;  1BSY A;  3BY0 A;  4PJ2 A;  1LID A;  1XKI A;  1JJJ A;  1YP7 A;  4WFU A;  2BHV A;  2L68 A;  1AQB A;  2CBR A;  3APX A;  4MIS A;  4EQA C;  4EXZ A;  4BOE A;  2FR2 A;  2Z4I A;  3P02 A;  1HMR A;  1BEB A;  3B2H A;  4QAE A;  5FAZ A;  4GNW A;  4LZU A;  1GT1 A;  1HMS A;  2KTD A;  3NQK A;  4IAB A;  5DPQ A;  3F9D A;  1LPJ A;  2GC9 A;  4NYR A;  2GTF X;  5EZ2 A;  3O19 A;  4XME A;  2ZAI A;  5DG4 A;  4YFR A;  1EW3 A;  3VG4 A;  1LIE A;  2FS7 A;  2AT8 X;  5HTE A;  1KT5 A;  2JW1 A;  1QFT A;  4WHI A;  2WQ9 A;  4TLJ A;  4AZM A;  2FT9 A;  5B27 A;  2QM9 A;  4XMD A;  1AVG I;  2HZR A;  1ZND A;  3UAQ A;  2R56 A;  3FLL A;  3KFG A;  3TF6 A;  2GTL O;  4GK9 A;  1ADL A;  4ORY A;  3FA6 A;  1G5W A;  1BRQ A;  5D8J A;  2KTS A;  3VG2 A;  4ZGU A;  3KZA A;  3DTQ A;  1LKE A;  1G74 A;  4IB6 A;  4OMX A;  1ICM A;  4NLI A;  4OMW A;  4IB7 A;  5BYP A;  4ZHH A;  2KW1 A;  1H91 A;  1X8Q A;  3JQO A;  2HNX A;  2MM3 A;  5B29 A;  3GE2 A;  1ML7 A;  1BLR A;  1URE A;  1D3S A;  1E5P A;  3P6D A;  3AKM A;  3PH5 A;  2QOS C;  4Y0S A;  3STM X;  4AZR A;  2ASN X;  1DFV A;  4ZGF A;  2GTL N;  2RQ0 A;  3DSZ A;  1VPR A;  4OS8 A;  4QYN A;  3HK1 A;  2Q39 A;  3BU1 A;  3HWF A;  2G78 A;  2OVS A;  3BS2 A;  4TKJ A;  1GX8 A;  5BVS A;  2G7B A;  3CBC A;  3FW5 A;  1GXA A;  1LIF A;  2RCT A;  1ZRY A;  2X45 A;  2K23 A;  3VE1 A;  1TW4 A;  1B8E A;  2L67 A;  2RCQ A;  3APU A;  1CBS A;  3PQS A;  3U0D A;  5KHP A;  3TGB A;  4IB8 A;  1KT3 A;  3FR5 A;  3NAD A;  2MHD A;  1FEL A;  3KFI A;  1I05 A;  4OS0 A;  1A2D A;  4QGW A;  4N7D A;  1EXS A;  1SXW A;  4IAX A;  1JZU A;  3WJB A;  2FTB A;  1B0O A;  4GDZ A;  4WFV A;  3FR4 A;  3D95 A;  3F6Z B;  2BS5 A;  5D4A A;  3RWX A;  4ES7 A;  1OEK A;  4LQZ A;  1BM5 A;  2QO6 A;  3N91 A;  1L6M A;  3VG7 A;  1GGL A;  1X89 A;  3HOL A;  4RUN A;  1LIB A;  4KH8 A;  1UZ2 X;  2NP1 A;  4IMO A;  1TOU A;  2W2F A;  3APV A;  3C78 X;  4O4O A;  3EM0 A;  4D6A A;  1PMP A;  5CE4 A;  1JV4 A;  5IO7 A;  4A1Y A;  1QY1 A;  3FR2 A;  1GX9 A;  1TXL A;  4U8U M;  2NNQ A;  1QG5 A;  2AL0 X;  4LKP A;  5FQ6 E;  3APW A;  3ELX A;  3D4R A;  3UEV A;  2JU3 A;  2Q2P A;  4FQB B;  2RD7 C;  3RBY A;  3ELZ A;  3PEC A;  5D47 A;  1OBQ A;  5KIC A;  1ERB A;  1FEN A;  3GAQ A;  1LIC A;  1GKA A;  4GET A;  4FBO A;  3BX8 A;  5HWZ A;  3VE2 A;  1HBP A;  3FA8 A;  3JS1 A;  4ZCB A;  3FYF A;  1EI5 A;  3V8U A;  1I06 A;  1YWA A;  1GT3 A;  4TQ2 A;  5L8O A;  1EAL A;  2FRS A;  3EYC A;  1EUO A;  3RKG A;  5F1E A;  5HZ6 A;  5IO5 A;  3S26 A;  1BSQ A;  3ZUO A;  2LFO A;  4O3Z A;  2L9C A;  2KD2 A;  4YDB A;  1DZJ A;  4Y0Q A;  1TOW A;  1CBI A;  3I17 A;  3NQ9 A;  1NP4 A;  3ZZV A;  1KGL A;  4QGV A;  5L8I A;  2LB6 A;  2CZT A;  4Y0P A;  1DZM A;  5FQ7 E;  1B4M A;  2A2U A;  1GKA B;  3C77 X;  1OPB A;  3G7X A;  1T8V A;  3KFH A;  3BU9 A;  5HTD A;  3IFB A;  4YBP A;  5HCD C;  2CM9 A;  2AKQ A;  4O4U A;  5HZ5 A;  1OEE A;  5D45 A;  1ZNG A;  2EU7 X;  5EPQ A;  4YMY A;  2M4L A;  3F8A A;  1EIO A;  4DQ3 A;  1ZNH A;  3B2I A;  3WJG A;  1AEL A;  5AQ6 A;  5F6B A;  4PSQ A;  4FGI B;  1BRP A;  2LA7 A;  5F7G A;  2YG2 A;  1OEJ A;  3BSZ E;  1MX8 A;  5LJH A;  2JMB A;  2WEX A;  2Q2M A;  4I3D A;  4QGX A;  1T0V A;  1G7N A;  4L1N A;  4OS3 A;  2AT3 X;  5H9A A;  4ALO A;  4LZV A;  2GTL M;  1ICN A;  1TVQ A;  2JOZ A;  4IAW A;  2LKK A;  2X8T A;  1X8O A;  4FBV A;  4HPB A;  2P8G A;  3ZW0 A;  5LJK A;  4BVM A;  3WBG A;  3WJC A;  5HBS A;  3ZW1 A;  4U9C A;  2BT9 A;  4QZT A;  4TJZ A;  3L4R A;  1QAB E;  1LF7 A;  1GM6 A;  4IBA A;  1O1V A;  3RZY A;  3FIQ A;  4M7M A;  5EEE A;  1D2U A;  3TGA A;  5F6Z A;  1KZX A;  4COT A;  3VG5 A;  1U0X A;  2CZU A;  4GNY A;  5EDB A;  3HTY A;  2R74 A;  2A0A A;  2LBA A;  3MX7 A;  5LJB A;  4MVL A;  5HZQ A;  3EMM A;  1DZK A;  1KZW A;  4GRJ A;  1ACD A;  1PEE A;  5AEO A;  5HAE A;  3PH6 A;  3ZI8 A;  4MVK A;  3ZW0 B;  1QWD A;  4KII A;  2F09 A;  4I6S A;  2FLJ A;  2XST A;  2WR6 A;  4R0B A;  4GZV A;  3BX7 A;  4YCE A;  3T1D A;  4ZFX A;  4N7C A;  4HFO A;  4D6B A;  2MO5 A;  1E02 A;  3FEN A;  4O49 A;  4A60 A;  2E4J A;  3HWG A;  3VPJ E;  1KOI A;  4IB9 A;  2HMB A;  3PP6 A;  3S60 A;  5LKF A;  4RUU A;  4QQ1 A;  1DF3 A;  1IKJ A;  3CQN A;  4EDE A;  3NPO A;  4NW4 A;  1ALB A;  4Y0R A;  3S5V A;  3C76 X;  4XMC A;  5AJC A;  1EPA A;  3NR3 A;  3D97 A;  4NNT A;  3NP1 A;  4AZP A;  4ZJ0 A;  5D48 A;  1YWD A;  1U17 A;  3QKG A;  5HA1 A;  1EQD A;  1MDC A;  3I0A A;  3P6G A;  3MVF A;  1KQX A;  2OVD A;  3P6C A;  1NP1 A;  3BDR A;  5LJG A;  4QNI A;  1CBQ A;  4EFG A;  4QYP A;  4TNN A;  4YKO A;  1OBP A;  3CBS A;  1RBP A;  2WSJ A;  1IFB A;  1X71 A;  1SXY A;  4ZHG A;  1ZNL A;  3STK A;  2PY1 A;  3WJE A;  1PBO A;  1AB0 A;  3FEL A;  1RLB E;  3IA8 A;  1SXU A;  5BVQ A;  1OBU A;  4M6S A;  1OPA A;  4O3X B;  2XKL A;  3AKN A;  3B2J A;  2HZQ A;  5H9K A;  2OZQ A;  3FA7 A;  5LJE A;  4IMN A;  2AMM X;  3B2K A;  1SY3 A;  3HWE A;  4NNS A;  4AYH A;  4JGL A;  2WQA E;  5HZ8 A;  1HBQ A;  2W2B A;  4I3B A;  2ACO A;  5FEN A;  1YWC A;  2HLV A;  1KT4 A;  2JU7 A;  1LFO A;  3NX1 A;  4I95 A;  4UU3 A;  1XCA A;  1I04 A;  2F73 A;  3CR6 A;  4U3Q A;  4ZHD A;  4ID2 A;  5HCE C;  3LV4 A;  1KT7 A;  3WOV A;  5HA0 A;  3FEP A;  3ZQ3 A;  3WJD A;  1S7D A;  3VG3 A;  1BBP A;  1S44 A;  4ZH6 A;  1EPB A;  4MVE A;  4CSB A;  1SY0 A;  1X8P A;  2K62 A;  1X8N A;  2OVE A;  4ORX A;  1FEM A;  2AH7 X;  3SAO A;  4AZO A;  4KT5 A;  5HZ9 A;  3HWD A;  1YP6 A;  2W2A A;  4O4S A;  5H9N A;  5FQ8 E;  3FA9 A;  1CRB A;  4CV7 A;  1BWY A;  4YCH A;  2A3F X;  2RA6 A;  1KT6 A;  4ALB A;  4ZH9 A;  4A1H A;  4GKC A;  1MVG A;  4I3C A;  3UEW A;  4GE1 A;  2HYS A;  5AJB A;  1JYJ A;  1ERX A;  5HCC C;  1HMT A;  1YUP A;  3NX2 A;  4EEJ A;  5H8T A;  2BS6 A;  4O3Y A;  1ZNK A;  3KQ0 A;  2OVA A;  1IW2 A;  1E00 A;  3NBX X;  1HN2 A;  3FMZ A;  2MJI A;  4O4X A;  1CJ5 A;  1P6P A;  5EDC A;  4KCA A;  1SY2 A;  2FWV A;  1DC9 A;  1N0S A;  3FW4 A;  1FDQ A;  3PED A;  4I9S A;  5LJD A;  1YWB A;  1BJ7 A;  1FTP A;  1SXX A;  4WBK A;  2ANS A;  2O62 A;  2X8F A;  5H9L A;  1DZP A;  3P24 A;  4GH7 A;  3O22 A;  2A2G A;  1KXO A;  3EBK A;  3FEK A;  1GT5 A;  3K3L A;  1Z24 A;  3P6E A;  1A3Y A;  3PPT A;  4I9R A;  3SOT A;  4CK4 A;  3U03 A;  1R0U A;  4NYQ A;  5LKE A;  4HWM A;  1O8V A;  5KID A;  2RN4 A;  2POA A;  5F58 A;  1QY2 A;  2OFM X;  2Q9S A;  3STN A;  4XMH A;  2LBV A;  3ZW1 B;  5CYB A;  3Q6L A;  1B56 A;  4YBU A;  1JYD A;  1CBR A;  4ARH A;  1MX7 A;  3CMP A;  4ORU A;  1S2P A;  4A8Z A;  3JSQ A;  4NP1 A;  1JBH A;  3WJF A;  3VU1 A;  1HQP A;  1QY0 A;  3BRN A;  3D96 A;  2JU8 A;  2FR3 A;  1SMP I;  3S5X A;  3WVM A;  3UEU A;  5IO6 A;  5JR8 A;  2OFR X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...