3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Unknown function
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
3A8IE 1H9KA 2JEAI 2NN6H 1Q12A 3OOCA 1I6VC 1B9NA 3M4YA 2BE5C 4RCNA 1YNJC 1Y8NB 1K8MA 1OXUA 2EVBA 1B9MA 1CI3M 2D5DA 1DXMA 3U9SA 1OXXK 5KNCA 4KN7C 3P20A 4H0LC 1FYCA 1E2VA 1V43A 1GUOA 2DNCA 3PUWA 4JK1C 2LMCB 2QF7A 2D62A 1OXSC 1DCZA 4DNRB 2BE5D 2F1MA 2KCCA 4G7HC 4G7ZC 3PV0A 2YYZA 3OW7A 5K36H 4HR7B 2JXMB 3BG3A 3QJYA 4KN4C 5BN3A 2V4DA 4BA2I 2PNRC 3IKJA 1IW7C 1GHJA 3WDNA 1EWHA 5BN4A 2K7VA 3CRKC 1Y8PB 3H94A 4I7ZC 4OO1H 4TKOB 4G7OC 3HGBA 2D2CC 1ONLA 1VDZA 4KKUA 4KHZA 1GHKA 2EJMA 1HQMC 1GJXA 2BA1A 3T56B 1QJOA 1ZKOA 3KLRA 3QG1A 3MXUA 5KNBA 1IW7D 1VCIA 1SMYC 3VR3A 3GD7A 1Q90A 1H9RA 3VR2A 5K36G 1Y69U 2A68C 4H13C 3M85A 4KKSA 3VR6A 4IFDH 3RLFA 2E76C 1DD2A 1VF7A 2NN6G 1Q1BA 3D31A 1Y8OB 1HCZA 1H9SB 3N6RA 4OGQC 3VA7A 1ZYRC 1OXVA 1T5EA 2K33A 3LWUA 3T53B 4JBWA 3M7NA 1IYUA 2AUKA 2NN6I 1Q1EA 1TKWB 1GUTA 1CFMA 2A68D 2A69D 1GUGA 3AB9A 3A8KE 5JEAH 1Z7TA 3OPOA 2R6GA 3ND8A 2DN8A 3I72A 4LK1C 1A6XA 5C0XH 3D4RA 3LNNA 5KNDA 4H44C 1CTMA 3L7ZC 3PUZA 4PV1C 3VR4A 5BN5A 4IQZA 3FMCA 2A6HC 1HPCA 2KA7A 2PCFB 3NE5B 3EQLC 3PUVA 4KI0A 2A69C 3SE0A 4OO1G 3BDOA 3FPPA 3W3AA 4DNTB 1H9SA 4KKTA 4DK0A 1BDOA 1GUSA 2AWOA 1FR3A 2E75C 3A8JE 1Z6HA 2E74C 2JEBI 4KMUC 1G291 3PUYA 5C0XG 2B8GA 2EDGA 3DXJC 2BDOA 3VR5A 4XTCS 2L5TA 2PPBC 2A6HD 2EJGC 4DK1A 1TU2B 1HTPA 2B8FA 2JE6I 2CW0C 2ZT9C 3I73A 3PUXA 4XIGS 4L8JA 3MFYA 3T51B 3TZUA 3A7LA 2O5IC 2A6EC 4IFDG 4LJZC 2DNEA 3ND9A 4TQUS 2AUJD 2EJFC 2IT1A 1YNNC 1LABA 3IFTA 1LACA 2K32A 1PMRA 3CRLC 3SDZA 1VF5C 1E2WA 3A7AB 2O5JC 1H9JA 5A35A 2Q8IB 1O78A 4BA1I 1GUNA 1V8QA 1H9MA 3QIAA 1K8OA 1IYVA 2A6ED 4GZYC 1O7LA 3GQBA 3I4LA 5JEAG 1OXTA 2BA0A 1E2ZA
chains in the Genus database with same CATH superfamily
5DM73 4FP5D 2WEWA 1W6KA 1F2MA 1K8MA 1JE5A 1RXJA 4DV3L 2RTAA 3AEHA 5ELNA 2D0OA 4R4IA 5KRUA 5C44B 1LDOA 2NVTB 1ILPA 1R4PB 4H0LC 2I5HA 4P71A 4GETA 4BY1B 2DJFC 4JG2A 4XQQA 3VHHA 2CZUA 2JMBA 5IO6A 1KL3A 2L68A 4DV2L 1TWHB 4B3ML 2NVQH 2R73A 3UDIA 5I9PA 2PI2E 1VMPA 2P5ZX 1RHPA 4PNYA 2FHNX 2K03A 1EFID 2PO4A 4XT1B 4LQZA 3WJCA 4BX6B 4BA2I 4CGYB 1CZWA 4N7DA 3HOLA 2BHVA 4C3IB 4XQNA 3G71A 5M3FB 4BXXH 5ELFA 3U4ZA 2XKLA 5T1IA 1LFOA 3JQOA 4WHIA 3O19A 4K5XA 1SWOA 2G79A 4B9XA 3C1EA 1ZKOA 3BX8A 4X65Q 1VQPA 1LIEA 4QQBX 2OY1O 1X71A 2I07B 1SWBA 3HK1A 1F9QA 2DJGC 2MNAA 1D7QA 3ZW0B 1F9SA 5HWZA 3MXNA 1BOSA 5LL6X 2SNSA 2H5XA 5IYBG 1I6HH 2R93H 3FA7A 3KF8A 1B4OA 4NMZA 2OFMX 4K5VA 2EU7X 2HDLA 1NNXA 5M5WB 3FLLA 4ODDA 1KHIA 4BQUA 4A3EB 1K8AC 1LCZA 3CCUA 3MX7A 5JOBA 3H3VH 3VG5A 2IZKA 2RTFB 2RHQB 3DWAA 4CDEC 1Y52X 2DN8A 1K24A 5ISRA 1KT7A 3FW4A 5D4AA 4XYOA 1VQKA 4KC8A 3VE2A 4A60A 1SWSA 2YTXA 4NDXA 1Q81C 2JA6G 4ZUJA 3WOEA 1DZKA 1SWFA 1SRHA 3L4RA 1STPA 4DR6Q 1XWEA 5HAEA 2KUMA 4DNTB 3FKIH 1HNWL 2PQEA 1ZNLA 5I6YA 1KC8C 3BRNA 1AP0A 1FJ1E 2JEBI 3FR5A 1I3QB 2G5LA 1SYFA 5EPKA 1EW3A 3EIVA 1SWUA 1SMXA 1ZEQX 2P8GA 3CCRA 3RY2A 4QUCA 1W2BA 2MP1A 1JJJA 4KC7A 3LGJA 4XIGS 4GOPC 3FEWX 1ESFA 4ZAIA 2A6EC 1VWNB 2YTYA 3KFUA 1RXKA 5H9NA 1EU4A 4RWSC 1RAVA 1JOKA 1A8VA 2EYLA 1DONA 1G7NA 3SDZA 4OS0A 4B55A 1LIDA 3JS1A 2B29A 4OMXA 2K75A 2F0SA 4X3SA 4JI4L 1ICNA 5C5LA 4C1NK 3PCOB 4MVLA 1KDBA 4BCSA 3I55A 4ZH6A 2E2JB 3T16A 4DAYA 1YUPA 5DAUA 2OYBO 1QG5A 1V9PA 2JP1A 2F0MA 1ERXA 1SRFA 2NP1A 1O7YA 2ID0A 2AMMX 5KICA 4IAXA 5D8JA 3HKZG 1RF2D 2NVXH 2K5WA 4U9CA 2D5DA 3DEPA 4P72A 1M4VA 1IL2A 5EJWA 1NC9A 4I3CA 4ZH9A 1PRTC 3QKGA 4QB4A 1V43A 1XMQQ 3FENA 4PMBA 2GTLO 1SXTA 4JK1C 4IAWA 1KZWA 5HCEC 2ALYB 1BVSA 1EQRA 2J0TD 1Y1VH 1KRSA 2HIVA 3NPPA 4G7HC 1R0UA 4KH8A 1U9RA 4MHEA 3MBTA 1SEBD 3MXNB 4X65L 3WJBA 5C6AA 3HWDA 1QUQA 3KF8B 2V4DA 5IGEA 2PNRC 2R7FA 1E02A 3S1MB 3WJFA 5BN4A 3BDLA 3FA8A 4HPDA 5C4ZA 3KDFA 4IUQA 2OVAA 3HGBA 2YU9B 4Y59A 1SMPI 5HZ8A 4BBRG 1CA5A 1WVLA 2EJMA 1HTLD 4PZ8A 4U46A 1D1KA 4X62Q 4CPFA 4A3LG 4LKPA 1MSHA 4BY7G 1V1OA 4WRDA 3V2TA 3MXUA 3HWEA 1C0AA 4R1JA 3T2XA 5C4XG 1VWAB 1E5PA 1O1UA 3Q23A 1X8UA 4ORRA 4ORSA 1LT6D 4OL7A 2AHOB 4IB6A 4GJSA 3OIPA 2YMSA 2ZAGA 5L3YA 1Q1BA 1OXVA 5E4WC 3PDFA 1T8VA 4JBWA 1PHJA 5I9OA 3AU7A 1BLRA 4I7AA 3KBXA 1OTCA 2I0QA 2UYWA 4DR6L 1VWCB 1IYJB 4QYPA 4G57A 1N8RC 1QY0A 2AWNA 3S2HH 2WSJA 2EYMA 4YGGA 4YHHQ 3LNNA 3CP0A 2QO6A 4YWLA 4DAPA 2R56A 5HCCC 1RXHA 3S1NH 3P02A 4LKTA 5EEDA 3ULJA 1MDCA 2OL6O 2A5CA 3PQUA 1CSQA 1K9MC 3ZW1A 3DUZA 2NNDA 4ID6A 2VDFA 3BVMA 4LAAA 2GJ5A 2RTGB 1KLUD 3I56A 3GTPB 1SN8A 2EZVA 2Z1CA 2EYHA 5C0XG 2WR6A 4DAYB 3PSIA 4GDZA 3WYPA 2QCBA 1PYBA 1KLGD 2L1BA 2N88A 3TP5A 2F0OA 3VR5A 3NX1A 1EEID 5C0XI 2KHSA 2ZT9C 1JT8A 5HY6A 1CM9A 2OQKA 4CDDC 5J39A 4A3BB 1SY3A 4ZCBA 4DU9A 4IFDG 5IO5A 3PIPA 1FNWA 3NHHA 2OFBA 2EOTA 1EUOA 2F4VQ 1U0XA 2RF4A 4HPBA 4YDBA 3GTLH 4IFDI 3KOJA 3L9AX 2DGYA 1O7IA 4BA1I 2VUMG 1EY4A 1V8QA 3EJIA 3KFHA 5FLXL 2FMMA 1STGA 3URYA 5KEEA 2E2HH 1EPBA 4AZRA 3CPFA 4DV7Q 2AT5X 1XMQL 4Z28A 1QUQB 3JAMi 5IP7G 1PFBA 3A8IE 4GN5A 3B6YA 3PMFA 1UE6A 3KDFB 4PQXA 2GC9A 1KZXA 1VQCA 2EY2A 1SA8A 5IRWA 1YWDA 4DR4Q 2K05A 4KY6A 5ELDA 3B2LA 4A3MB 2K5VA 2NYZD 5KNCA 5E1FA 1VWIB 4KT5A 2WB1B 5BYPA 1IW2A 3G7LA 5M5YB 1TWAH 4BBSG 2JU7A 2PZTA 2R61A 3RR5A 3BDCA 5KIDA 3EA6A 2EE1A 1JWSD 1A18A 1PLFA 4HPAA 4X62L 3I4NB 1YIJA 2QA4A 4YGZA 1HQPA 3QJYA 3UEWA 1XMOL 1FGBD 4C3HG 1AW7A 1Z24A 5F2BA 1JJ2A 4BWGB 3E6ZX 2MM3A 1ML0D 2K1BA 5M3MH 1DZMA 1KDAA 3DM3A 5IODA 4HJ5A 1HHVA 1HZCA 1SYBA 2VL6A 3JC66 4ZHDA 5IYBH 2B2TC 3SK6A 1GXDC 4GDAA 3TEHB 3RLOA 4EXZA 1X8PA 1WTOA 5IT9c 2AVIA 4EEJA 4ZRZA 1YEZA 5IOCA 4IOCA 4KKSA 3VR6A 3J80E 1MIUA 1U4LA 5EKLA 2UXBQ 2FWVA 4YHHL 3ZW1B 3HOXG 1XTCD 3VA5A 2N55A 2Z4IA 1YHBA 4YKOA 1T5EA 3LWUA 1SNDA 1DJRD 3S2DH 1LNMA 4M8AA 3O22A 5M5XH 1SWHA 3SK5A 3GTJB 3CMAA 3HOYG 3EVQA 5IO7A 1HNZQ 2A5BA 3Q24A 2X8FA 2Y32A 2K01A 2WAQG 4AH6A 1SY0A 5JEAH 5LJEA 1PXUA 1M8AA 2NB0A 1VWLB 3MEHA 2E4JA 4U8UN 4LFAQ 3MM0A 2G8CO 1ET9A 2OY5O 1JCKB 5C0NA 3NENA 4O4XA 3HS0C 3PUZA 4X3UA 2KEEA 4CJ2C 5GAEC 5LMNW 2JA5B 4OIKA 4PG3A 1STNA 2HHHQ 1JB7A 4LF4Q 1X3PA 5CV5A 1S72A 1ZNHA 1NJIC 4QGVA 4KI0A 1MBYA 3U9OA 2F0QA 1UE1A 1HZBA 2C9OA 1W6FA 1FR3A 2WKCA 1SLGB 2W2AA 5IXGA 1ENAA 2AMCB 1E0BA 2EY1A 3HOZG 1ENFA 1FNUA 2F0TA 4O3YA 1NMFA 1SE3A 2ES2A 1BBWA 2L5TA 5D48A 2A6HD 3T1YQ 2XGTA 1JE4A 1CUKA 3I73A 3VYSA 5H8TA 4L8JA 1W6JA 4DV7L 4OKAA 3CMPA 3UAQA 3M3YH 1GKAA 3HKZE 4IALA 4XQJA 3LTWA 4U3QA 1LT3D 4HMIA 2G9HD 4JV5Q 1TS4A 3KK7A 4GLVB 3VG4A 5CV4A 2A8VA 4O3WA 4ILWA 3U58A 1S5DD 1TR5A 3N52A 1GM5A 3NR3A 3H09A 2XVSA 2PI2A 3CHBD 1IYVA 3CD6A 4JI5Q 4TLJA 2WIIB 3CW2C 3RKGA 2B63H 1QFVA 4IB7A 4N9PA 4A93B 1HXZA 4AQYL 1UYOX 5LJGA 3CCLA 5AEOA 3ER0A 1ASYA 2ENBA 1I6VC 3T13A 4LZVA 4MISA 1B4MA 3Q6LA 2QILA 2KVMA 2DJGA 1CI3M 4YDAA 1Y14B 2E5LL 4AZOA 4ZHHA 2GTFX 4CKBA 3NWTA 5I2XA 1N32Q 3GTKH 4HCSA 1UE5A 3E5SA 4DA2A 1QNUA 2Z4HA 5K5PA 5NUCA 4IRWA 2CHBD 2BE5D 2AQ3B 1YNJD 4LF5Q 2HCCA 3Q0AA 1SRUA 1SNQA 2AF5A 5LJDA 1A0IA 1IHZA 1KD1C 1LTTD 1STBA 1OEKA 2KHIA 4OWXB 1VWEB 4CDEA 2HIXA 2CAMA 4FF3A 1Y1WB 4G7OC 3VYUA 5IWAQ 1D6EC 2D2CC 3EBKA 1Y9TA 3AEVA 3DM1A 3BZKA 3CMEA 1VPRA 4A3FG 4Y7NH 1UAPA 1RSUB 2F0PA 2A1AA 4RG1A 4YBPA 4IURA 4A3JG 1LTLA 2F3IA 2Q39A 5IGDA 4ORXA 2RCNA 1B56A 4ZYSA 1HNZL 5IRAA 4Y5DA 1Q90A 2OEOA 3ERQA 2RCTA 1MJEA 1CKNA 1BEBA 5CE4A 2K5NA 3P24A 4LFAL 3GTMH 1ICWA 1GOZA 1L6MA 3VA7A 2K23A 5ELEA 4A3GH 2DY7A 1KXLA 2Y0SB 4PMCA 4GOPA 2HHHL 4LF4L 1SWKA 1CFMA 1CHQD 3S1QB 2KEDA 1V1PB 2WFWA 4DF7A 3WVMA 4GZVA 1EFWA 1GKAB 5C0XH 1JQPA 5D65A 1EUJA 3S15B 1HMRA 1LCWA 1I4UA 3J81j 3VR4A 5C4JH 2F0HA 3P7JA 3P6GA 2HZQA 3T1YL 4CPIA 4KHPL 5JR8A 1HPCA 4DV6L 4ABNA 3J81L 4NLJA 1VQ5A 4BXXG 5COYA 1VWOB 2X34A 2E2DC 3R2IA 4WJ3M 1PH7A 3S24A 3RNUA 1PH4A 4JV5L 2NZ1D 5G3LD 2RTBB 1WOCA 4KMUC 5CV9A 2XTIA 4I95A 2JN4A 2VUMH 1VQJA 4ZCKA 1GD7A 1WI5A 1C8CA 3T51B 4JBJA 1TS5A 4JOIA 4NV8A 4JI5L 4U673 1II3A 1I50B 2Z9HA 5CV8A 2QO5A 5IP7H 2WINB 4FF2A 3BU9A 5EQ0A 2R93G 4A3IB 1PMRA 1LTRD 4TNNA 3VG6A 3MA2B 3P1HA 2JW1A 1AELA 3PEDA 4DUYQ 2A2GA 3F8TA 2X6GA 2JA7B 1GGLA 4GUZA 2AL0X 1KQSA 3IFDA 1HMSA 1N32L 1DOKA 1G6ZA 1SWJA 3TF6A 4BBSH 1YNND 1S3OA 3RUZA 1FL0A 2JA9A 3D6WA 1HR0Q 4LF5L 3SLJA 3M4YA 1WTXA 2EVBA 3ZI8A 3OTOQ 1NBXA 4CPHB 4FNFA 3FKIG 3P20A 2RCFA 4LFCL 4EVOA 5IWAL 5L37A 3CU7A 1GVPA 3K5MA 2FKGA 1UUPA 2F73A 1YIVA 4DV5Q 3CXCA 3K58A 1CKNB 5G3LF 4ZLTF 1OBUA 1GT4A 3T6FA 1S7DA 3VU1A 1D5MC 1E24A 3M4OB 1X6OA 1E06A 2C4IA 5KYLA 1X54A 4LMQD 4GOPB 5DG4A 1I4RA 4DN4M 1ZNEA 3S16B 1MKHA 3K0YA 2OCEA 1YI2A 3HOXH 3VHMA 3I4MH 4GK9A 3WZOA 2CBRA 2HDMA 1R9TH 3TGAA 2UZ2A 1X56A 1PZKD 1LCVA 1MX8A 2A19A 3NK9A 3CC7A 4CKEA 2IFBA 3B2HA 1STRB 3K7AB 2OZQA 1TVXA 1KDCA 4L63B 1SWDA 1TS2A 3PQIA 4C5PA 3FA6A 3BYYB 2ZSCA 3K5OA 2JU8A 1DD2A 4GS3A 4EDEA 1ZNDA 1TXYA 4HN7A 4A3DG 4K19A 3WZPA 3MVVA 2BDNA 1TWGB 4IN3A 3F2DA 3MHBA 1STHA 1V1QA 1XNRQ 2KHJA 1ENCA 5EPLA 5D14A 4KY7A 1PBYA 4GNYA 4DV0Q 1Y1VG 3HWGA 1SWEA 2AH7X 3E9IA 5K68A 1CTMA 3L7ZC 2AQ2B 1X3EA 4HPCA 2QCPX 2A6HC 2KECA 3HKSA 2XIWA 3FYFA 5BR8L 1SY1A 1QY1A 4BX5A 3PIO3 2N93A 3SGIA 4JCVE 1I9HA 4DK0A 4NXMQ 3STKA 1ICFB 1JJUA 2VQFQ 1OEJA 4ZHFA 3CKFA 4UP8A 2B8GA 1EY5A 3EBEA 4I9SA 4Z2VA 1CZGA 4DR1Q 3TGBA 3GP7A 2F3VA 1Q3LA 5K06A 3WWVA 5GADC 2IZHB 1EY9A 3L0OA 4LUVA 3S5XA 2IY5B 1ESRA 3D97A 2IZLB 1J8IA 1KT6A 2QEXA 5DLQE 3VHIA 1DFVA 1HR0L 2N78A 2LY7A 1WYDA 4OMWA 4HJ8A 1HMTA 1A2TA 1LTAD 4LF7Q 1B44D 2NZHA 3QOLA 4R4CA 4YIJA 3OTOL 3ZW0A 4WFVA 1BSYA 4C2MB 2W2FA 4ZGFA 2B2TA 3A56A 4DV5L 1C48A 1HA6A 3CBSA 3C46A 3HOVG 3PO3B 1LPJA 3P6DA 1CSPA 3BU2A 2BE5C 3W1GA 1YNJC 5H1SE 3FW5A 2Q2MA 2WV6D 3AMUA 3PPTA 2VW9A 2GTLM 5HZ6A 1L2FA 3D3RA 3GTQB 3ZZVA 1FYCA 1GKHA 3CPWA 1YWBA 4IABA 2DNCA 2IZJA 4C3JH 5CMDA 1MX7A 1WBIA 1K83H 1VQ9A 3HOUB 4A3FH 3FEKA 1JWUD 4IOAA 2ICEC 1K3RA 3OW7A 4WBKA 2R92H 1QWYA 4CKCA 2X69A 5ELOA 1MVGA 2BT9A 3QQ2A 2LFOA 1L0XB 4A3KH 5CHKA 4IJHA 2M4LA 3ZJYC 4QRLA 4CJ1B 4EQNA 2PW7A 4GGRA 3DWQA 3X00A 3GTGH 2RTRB 3PH5A 4LUOA 4MVKA 1BRQA 2I5MX 1T5XD 3G48A 1RL2A 4RFBA 3RZOH 1SXYA 2FS7A 3STMX 4DK3C 2HKDA 2KQ3A 2HLVA 4XMDA 3RDUA 3R93A 1SWLA 3K80C 1FGUA 1H9RA 2HYSA 1TWFB 2H4OA 2F0EA 1XNRL 1SREA 3BU1A 1N9MA 4V0BA 2E76C 2MJIA 4DV0L 4BX5B 2A0AA 1VQAA 1HCZA 3KJOA 1LTGD 1N34Q 3ICEA 4ZUIA 3RY1A 4ODGA 2FT9A 1NMGA 2RDGA 4WFN3 4ME3A 4N8FA 2G78A 5EKKA 1Q1EA 4LFBL 1S5FD 4HJ9A 1XPOA 4FYDA 1Y53X 1LUZA 3M9BA 2A69D 1GUGA 2LXJA 1CBRA 3JAMc 2A5HA 1BF4A 1SLJA 1K28A 4FDBA 4Z9CB 4IJLA 2RQXA 4BY1G 4NXML 2R6GA 2A74C 1U18A 3KBGA 3MVFA 1ZYRD 4LK1C 2A3FX 1PH9A 2RBMA 1STEA 4JNJA 1BO0A 2MHVA 4I60A 4DR1L 4QIWE 3BS2A 1I4HA 1BUVT 5CC4A 4AYBG 1CBSA 1KRTA 4L3RA 5M3MG 3NEMA 4HSVA 2VZAA 4JBMA 1NQMA 5HTEA 1S4ZA 1UE7A 3I7FA 4PMWA 4QMGA 1AZQA 3WJDA 1I4GA 5M3FG 4HSPA 1NY4A 2RHSB 4IUVA 3NTKA 1N33Q 4YFRA 2PZWA 3CF5A 3NQKA 2WUTA 4DAMA 5LJKA 1JJXA 3WBGA 4LF7L 1IKMA 4HJ7A 1GX9A 1YZ6A 3PUXA 2NNQA 3E9HA 4KLKA 5JD2A 1BSQA 1IZ6A 3HOWH 2GH7A 4NP1A 4Y0SA 1Q82C 1F2YA 2RTOB 2ZTCA 3K6OA 2EJFC 5IT9E 1VWGB 2QMIA 1YNNC 1GO3E 3KLSA 1B3QA 3K59A 1LABA 1WD0A 4ORYA 1YJNA 2UUAQ 3ULPA 1B2TA 2IHFA 2Z6BA 1JOQA 5IRUA 2JA6B 1GUNA 1N4JA 2GTLN 4A3EG 1HZ9A 4ULLA 3IA8A 1DYQA 3OMCA 4F7XA 5JEAG 4A75A 1HRJA 3S1RB 1BKBA 2JA8B 3CCVA 2LS01 3U9PC 3DLLA 4JO6A 2NN6H 3SHLA 1N36Q 1PEEA 3MG5A 2IX1A 1G74A 3DSZA 2PZUA 1I5FA 2SDFA 4A3CG 1AQBA 3RE5A 2Q8TA 2F4IA 1UEAB 4UY8C 1VQLA 1TW4A 1VWQB 4LW1A 2B3GA 1K0RA 3P6CA 1QVGA 2FGSA 2ASBA 4POFA 1WJJA 4G7ZC 1LICA 3S26A 3RN5A 3B2JA 2B2WA 3BX7A 1R4QB 3BS1A 2MWHA 1GHJA 2K7VA 2M9VA 4F8MA 3ITPA 5L8OA 2EYOA 1VWKB 2BS5A 2FHLA 1PDQA 2RCQA 1LLRD 3LHNA 1N34L 5AJBA 4EQOA 1ALBA 3R8BA 4A8ZA 2E8GA 2NVYH 3T56B 4A3DH 5IY0A 2GA4B 5LMUQ 1K0SA 1BJ7A 2LBVA 1LIBA 4GJVA 5A2QL 4GU8A 3VPJE 2TMPA 3J81i 2OF8A 2R7ZH 4JOIC 5IGFA 2B63G 1TT2A 4H13C 4L5QA 4DQ3A 2OL8O 1DZ1A 5D47A 3FR4A 4OGQC 4IB8A 3I0AA 3CQRA 4A1YA 4MNOA 4YY3Q 4ALOA 1PTOD 2MGSA 3GTOB 2RA6A 1EOVA 2EPBA 1B8AA 1NR2A 1Y0GA 1PTOB 2FFKB 4BBRB 1BQQT 1N33L 2H1EA 5C3EH 3NQ9A 3CC2A 3W2DA 4GLXA 3AYHB 1XXGA 5J22A 5C0XJ 4BY7B 3FR2A 3E0EA 1VYOA 3OW2A 2MJ8A 1YHQA 2B2UA 5C4XB 1TQOA 3RLNA 1E1TA 1WCMH 4YCHA 2Z6KA 4A76A 1BDOA 2C35B 2E75C 3NBIA 4FO2A 4IFDJ 1G291 2CQAA 5D3IB 2UUAL 5AFWA 4HFOA 1BBUA 4TVAB 1VQ7A 5C3XA 3SAOA 2A8GA 1Q46A 3GV6A 1QFTA 3APUA 4FXGC 2CVRA 2B8FA 1QABE 4OS3A 2Q2IA 1SJED 4QF4A 1BBPA 3TQYA 2Z8LA 3A7LA 3SZIA 1B70B 1EZ8A 1VQ4A 4K5WA 1SROA 3MFGA 4DNEA 1LM0A 2YTVA 4CSBA 2K50A 3PO2H 3KVNA 3D4DA 3HOVH 4HIKA 3QOJA 1N36L 4A3GG 2F0UA 1TWCB 3I8ZA 4NNSA 1GXAA 2FTBA 1C7YA 1GT3A 3CQZB 2KTDA 1H9JA 4ZGUA 5B10O 5HA0A 1EXSA 1DZPA 2CW0D 3FDCA 1K3BA 1LELA 4QAEA 3RWXA 4AZQA 3KUPA 3RZYA 1PTOF 2PI3O 3APWA 1A62A 3SXHA 1PH2A 4I6SA 2ZTDA 3PF4A 2HNXA 1P6PA 2ICIA 1VMCA 4DXGA 3PGZA 4RKLA 3CCJA 5CSEA 3WJGA 1RSTB 1NE3A 4MEEA 2E2IH 4DR2Q 1O1VA 1NTGA 4H7BA 1RLBE 4ZR2A 4NPSA 1F9PA 1IBKQ 1G91A 4D6AA 1GUOA 4F88A 1N43A 3NQ3A 1NDJA 1EY0A 1VQDA 4GGZA 3MXGA 2Q2TA 1EY7A 1JYJA 2PYKA 4DNRB 3T6LA 4O0AA 5LMUL 5EPQA 1SAPA 1ICMA 4CJ0B 2QO4A 1G6PA 3NADA 5EPJA 1Z9FA 3WDNA 1FDQA 3VGWA 4I7ZC 1Y8PB 1WFQA 5IP9H 3P6EA 4CDCA 2WKDA 5EGTA 4MN3A 1X32A 5H9AA 1BCPD 2L0CA 4B3TQ 4LF6Q 2ZXOA 4PJ2A 1QJOA 2K4KA 4OWWB 4YY3L 4NW4A 2QW7A 1BCPB 3DWPA 3C77X 5KNBA 5F6ZA 2F0IA 2NBFA 5IGCA 3VR3A 1X89A 4JPBW 5C44H 1YJWA 2NVTH 3RBYA 3K81C 4BY1H 4AYBE 1YVCA 1Y8OB 2UXCQ 5CBEE 1ZYRC 3TDQA 1TOWA 4GNWA 1TWHH 3CR6A 4IO9A 1QE6A 3IFBA 4Q0FA 1KQWA 5F1EA 2HQEA 3IRBA 2TSSA 3A5UA 4C3HB 1N7YA 4O49A 3PK2A 5AJCA 2XSCA 3STNA 2W2BA 4A3MG 1STSB 3A8KE 2B39A 2ZTEA 1T0VA 3U03A 3DHQA 4C3IH 2RVLA 5M3FH 2ANSA 3D0FA 4QL5A 3I72A 1LTID 4O42A 4KTAA 4U68A 4DR3Q 2WQAE 4YH0A 4K0KQ 4H44C 2CH4A 2KENA 1B0OA 2V1CC 1JR0D 3KQ0A 3I4NG 3M4QA 1CBIA 3PUVA 2IX0A 2Q2HA 4CDFC 3A54A 1JYDA 2K62A 1EQDA 4CK4A 2XRSD 3I4MG 1SYEA 3UI2A 4L5SA 2KOLA 5B27A 3MEFA 4IPGA 3WOVA 3HTYA 2EY6A 1IL8A 3T1HQ 1UWVA 4UP7A 1BCPF 2Q9SA 1QOHA 1E7ZA 3ZUOA 5M5WH 1SFOB 4YCWA 1TIID 2PMZE 4A3EH 3HOYB 3TP7A 3I3CA 2NTSA 3DEOA 1BM5A 4FVMA 1YP7A 3QWNA 4TQUS 1UNSA 3IL8A 1E22A 1SWRA 2EYPA 1S5ED 2RTNB 1KQXA 1E2WA 1X65A 3D4WA 5L8NA 2I5VO 4ZQ3A 5FLMG 1OBQA 4A3CH 3I70A 1D3SA 4DR2L 3J7ZC 1N9YA 1K8OA 1O7LA 2SOBA 1IBKL 1XKIA 2LKVA 3H0GB 2OQ0A 2F4VL 5K36H 1H9KA 3HOZB 2N3SA 1KABA 4NW2A 1I3QH 1I06A 3FELA 1V1PA 1SYGA 4RH6A 3FPUB 1WTHA 3OSOA 3BYTB 5D3DA 3RZDB 1B50A 1IFBA 2L55A 1Z47A 3APXA 1OXXK 5FOBB 3F2UA 5EDBA 1Y9LA 2XRQD 4B3TL 4LF6L 4DR4L 3BZDB 1KNAA 3OBLA 3DMUA 5I4DA 1YBYA 2Q8RE 5FLXc 4N9TA 1CK1A 3AKNA 4S3SA 4DCBA 1SNCA 3GE2A 2CBSA 4O1NA 5H9KA 4X66Q 1KL4A 3MAQA 1SWQA 2DUDA 3UDXA 1VWBB 1EOTA 1VS0A 4KKUA 1CA6A 2E2JH 1W3SA 3WXQA 4L6TB 2Q2PA 3QR8A 1VWPB 3QG1A 1GT1A 1QG7A 2I5ZO 3EROA 1RKNA 4ALPA 3VR2A 4HMJA 1PTOC 1E2TA 5E4XA 3Q34A 2L9HA 3O13A 4B08A 5GAGC 1PTSA 3HG9A 4NYQA 4YFQA 3GO5A 4DR3L 4XMFA 4ZHGA 4A93G 4KJOA 4OWTB 4JI3Q 1Q8KA 4BOEA 4GN3B 2JQOA 4O4SA 2UU9Q 4DK6C 2LA7A 3S1MH 4JI6Q 2UXBL 2KCTA 1KNEA 4C3JG 3S14B 1NP1A 2RTJA 3FIQA 5JJZA 4D6BA 4DFAA 3BVZA 5LMNQ 4GNXA 4CPHA 5FO8B 3T1HL 3D4RA 5K67A 1I78A 5L8IA 2R92G 2ATWA 3S17B 4A3JB 2EYFA 5B5GA 2Y3EA 2MPMA 4JVZA 1LKEA 1B53A 4A4IA 4A3KG 2RTLA 3J80L 4ZKCB 1AVEA 3SZJA 1JICA 3H15A 1GUSA 4INNA 3VG7A 2ZXRA 1Y1WG 1F9RA 1NBWA 4KD3A 1G5WA 4ES7A 1CKMA 2RKSA 4IUNA 4NXNQ 2EDGA 4GKKQ 1B8EA 4KCAA 1VQ6A 4J15A 2B2WC 4M7MA 5CGKA 3VDYA 1HTPA 2JE6I 3ERSX 2CW0C 3CAMA 4RA8A 4JI2Q 3TN2A 1SXXA 2IZIA 1VWFB 5BVTA 4XMHA 3EMMA 4LJZC 3NTIA 4KHVA 1J6QA 3CBCA 4OELA 2NVQB 3R3OA 1XPRA 3CWKA 1DZJA 4I65A 3WZNA 2UXDQ 4O4OA 1RTOA 3C3LA 4O9SA 1A3TA 2MQHA 3RDXA 1SJHD 3KF6A 2Y0SG 1S44A 3G7XA 4FBRA 4A1HA 3TZSA 5FO7B 3NWSA 2R74A 1OXTA 3BSZE 1QNKA 4Z2OA 2ZJRA 1PYWD 2KW1A 2VFCA 2K6AA 3JAME 2FHTA 3GTPH 1BBXC 1QY2A 4TRDA 1B9NA 3PP6A 4YCUA 1AN8A 4EKVA 2G7BA 2L9CA 2K04A 4HIDA 4PSQA 1DXMA 2IL8A 1WTWA 1Y55X 4X66L 4A3BH 4I3BA 1G51A 2RDHA 1RD9D 2CWPA 2R93B 4QIWB 1I6HB 2JN3A 2OFRX 1X3FA 2QF7A 1SXUA 4Z27A 1JV4A 2I46A 1TY2A 4I9RA 1BCPC 3PV0A 2C1SA 2JXMB 3HOWG 1SLEB 1EWHA 2B2UC 5JJLA 1SWCA 1D5XC 1EQVA 1KT5A 2Z6KC 2Q4NA 1HNXQ 1ML7A 2AT0X 2PQAA 2BA1A 1SLDB 4IPDA 1EIFA 4A3IG 3C2PA 5DNFA 4GNXB 1VCIA 2UU9L 2HUGA 3FKIB 4A3MH 1C4QA 2JA7G 4JI6L 3R2TA 4C56C 4YCEA 3D96A 3A5ZB 2JK8A 5EKIA 1ASZA 5M5YH 2NN6G 1EYCA 1ET6A 4R4QA 5LMNL 4O4UA 3SOTA 1STYA 4DV4Q 1LTBD 4IUTA 3UE1A 1IYUA 3S5VA 1G2SA 2NN6I 3I4NH 3RD4A 1HN2A 2L5PA 4DR5Q 3WJEA 1K3BC 3V05A 3AB9A 2QOSC 3LWEA 1PA6A 3WYQA 3H6MA 2WAQE 3A0JA 1BR9A 1VQFA 2F0VA 4KV6A 3SEBA 1EI5A 4NXNL 3K57A 4GKKL 4IPHA 4ZK9B 1EPAA 4OELB 4YKMA 1D5ZC 1PM1X 1OPBA 1NSNS 5ELCA 2FR3A 4JI2L 1IBLQ 1Q8IA 4XMEA 3T4AC 3KF6B 3VG3A 1H9SA 3T2WA 3TMEA 2SNMA 2RSNA 2RA4A 5AJ3Q 1JMZA 2F52A 4QJFA 5CV7A 3PUYA 4YMYA 5J3BA 2OTLA 3C1FA 1WD1A 2UXDL 3RMHA 4OEMA 5FLMH 4FF4A 2NVXB 4QGUA 2EJGC 2C1QA 3APVA 1BNZA 4FBOA 2R7ZG 3U50C 3U0DA 3GTJH 3P6HA 5C3WA 1SNOA 3ND9A 4LUZA 4OIJA 4Q5VA 2RTEB 4CDCC 1NUCA 1MSGA 1Y1VB 1QZGA 3CRLC 1EQTA 2RTMA 1E00A 5T1GA 2JA5H 1SWTA 2KJXA 3J81c 1ACDA 3QIAA 1ZNGA 3F1ZA 1SWNA 2POAA 1LO5D 3S60A 4HIOA 4RGMA 2GVBA 3O2YA 2OT2A 3P75A 3TP8A 5C3EG 4ALBA 1N9WA 2JEAI 5IE8A 1KL5A 2RTHB 1AE2A 1QB5D 2QOMA 1SNPA 4DUYL 2QDLA 4X3TA 1AZPA 2PQAB 3RDSA 1DM0B 1WCMG 1TS3A 3U9SA 1VWDB 3JSQA 1BSOA 1I4PA 4ON1A 2FXQA 4DNIA 1MD2D 3A55A 4L1NA 1VWMB 1PFMA 4R4TA 1JC7A 5CYUA 4Z6JA 2NUCA 3HZXA 5EAYA 1I94Q 1M1KC 5CR3A 2RTPB 4BJ8A 2F0WA 3BVGA 1F2ZA 3HP3A 3BG3A 5BN3A 4NYRA 2KCMA 5HA1A 1VQHA 1MJCA 1PH6A 4C1NI 4AZPA 1U5KA 3IAYA 5LHY1 4YGHA 2MO5A 3MXPA 3PO2G 3S2HB 1JIWI 3HWFA 2IJ0A 4BX7A 1GHKA 3TBIB 3ZW2A 1UZ2X 1HQMC 4A93H 3D95A 5DEHA 3S1NB 4DV4L 4CDFA 4ZJ0A 1IW7D 1SYDA 2RQ0A 3PQSA 2JSOA 4DR5L 1SE8A 1LTSD 1RTNA 5JPMC 4J1MA 4MVEA 1HFGA 2LXKA 2EYJA 1VF7A 2M00A 3D31A 5KGUA 1GX3A 1NP4A 1H9SB 1B1ZA 4O2DA 3H3IA 5KIXA 3I17A 4OO1I 2X8SA 4JYAQ 1DF8A 1ADLA 3VG2A 2RTKA 2AUKA 4OEMB 1GUTA 3BJUA 1EWCA 2J7ZA 2IWHA 4K8IA 5DM63 4UDUC 2MO0A 1EWIA 2G9DA 1Y1WH 2N8NA 5HGQA 2WEXA 3KFFA 3STBD 3GTLB 4O3ZA 2OVEA 2F0KA 3HOUG 4ZKBB 1SRJA 5IYDG 4NLIA 4RHSA 4GE1A 1IKEA 4TKBA 5BN5A 1I4XA 1VQEA 4FBVA 2E2HB 4OHJA 2KA7A 2ACPX 4P73A 3EYCA 4ZHCA 5IP9G 3BDOA 2L4NA 2F09A 4MTKA 1LT4D 2FINB 1HUMA 2L67A 2IZGB 1SY2A 1BXTA 5HZQA 1X55A 1CBQA 3G6EA 2VS1A 4EFGA 4IB9A 3HFZB 4XTCS 1H91A 1TU2B 3EN2A 5C44G 1D2UA 3NELA 5FQ8E 4JI4Q 1HA5A 1TWAB 3S1QH 3PECA 2VQFL 5KYIA 5A2QE 3MC0B 2ZJPA 1XYIA 3OD9A 2RTCB 5JEAJ 4RCOA 3NSWA 4ORUA 4ARHA 1XX8A 2EIFA 3FP9A 4JI0Q 3SK4A 5E3FA 3S15H 1KIXA 1JB3A 1QZHA 3FVQA 4QCLA 4KY5A 4AYBB 2F03A 1AB0A 1B3AA 5M3MB 2JOZA 1MI2A 4OONA 4DXFA 2XSTA 4C3IG 2BA0A 3GAQA 4JW0A 3FIDA 4TKHA 4WORA 2KTSA 2IZFB 1PFSA 2PW5A 2VQEQ 4ZFXA 3EC5A 1I94L 1J9OA 1A15A 5EEEA 4BX7B 3ULLA 4QGWA 1U4PA 1OXUA 3H3VC 3TP6A 4R4OA 1PH1A 2AKWB 4XDXA 4DPGA 3Q6SA 1PH8A 4LF9Q 3B2KA 3UE0A 2ZM6Q 1I50H 2G5DA 1YP6A 1FE3A 1OO9B 4RAUC 2O2LD 1KL9A 4LZUA 4UU2A 3W5OA 2F1MA 4A3IH 4GNXC 3S2DB 5ELBA 1VQGA 2HT1A 5M5XB 4M1UB 4AYHA 1A3VA 4G4KA 2X55A 2JA7H 4FGIB 2MHDA 1XTDA 3TS2A 2RSOA 3PIOA 3H94A 4TKOB 1PZID 3PIP3 1LT5D 5EBCA 5IIFA 1GJXA 1X8NA 4B9WA 3LV4A 4MVIA 4YVBA 2PMZB 2L12A 1NQNA 4JYAL 2CKZB 1PV4A 1GM6A 1L1OA 2EQSA 3KLSX 4OX9Q 4FF1A 4XMGA 3WOFA 1KFFA 2OVSA 1Q7YC 5K36G 2F0LA 1HXYD 3J80i 4KJNA 1AH9A 5F7GA 3OWFA 4XMCA 1O8VA 1FTPA 2JA8G 3K7UC 2OF9A 1AE3A 4HJAA 3L3OC 1SMYD 4DUZQ 1JQYD 1HH2P 3I90A 1S5BD 1FNVA 3M4OH 1B7YB 5F2DA 2CQOA 3KLWA 3M3YB 3SZHA 2A68D 1MUPA 3SLTA 3E3CA 5LKEA 3FEPA 4GGTA 2WP8J 3LX0A 4QZUA 1L0YB 3K8AA 3PH6A 3ND8A 5FKAC 3S16H 5JVH3 2LFNA 5HBSA 3FRPB 5JPNC 4EQAC 4LWCA 3HKZB 4IQZA 3CCEA 4DAVA 2Y3FA 2CWAA 5FLXE 3K7AH 4H02A 2B63B 2X45A 3CCQA 3RDMA 4DR7Q 3E0JA 2KD2A 1IKLA 1QILA 4RGTA 4JI1Q 4JI0L 4WFUA 1PFNA 3ZUIA 2L11A 2A73B 3C78X 1TY0A 2OVDA 4YBUA 1TWGH 1U4MA 5M9OA 1WTVA 4HEDA 1WTPA 1VQNA 3GTKB 2X4MA 4QGXA 2AUJD 2QDBA 2VQEL 2KBNA 1LACA 1SE2A 3OMGA 4ME5A 3OE3A 3F6ZB 2EXDA 3K3LA 4P75A 2O5JC 5A35A 1K8GA 3Q8DA 1M90C 1PZJD 1BWYA 1ZNKA 4QNIA 4LF9L 1LF7A 2HCIA 2ZM6L 4B3RQ 3PF5A 4DGZA 5JJIA 1F77A 4HIMA 4Y7NB 3C76X 3ZWEA 1VQBA 1T68X 3H91A 3D6CA 3A74A 3U4VA 4QZTA 4MZ9A 4RCNA 3GV3A 3J7A5 2IPKD 2CM4A 4R9WA 4BVMA 4K6LA 1HY2A 5IT9L 1XMOQ 1L1OB 2B2VA 4NP5A 3GTMB 4RHRA 1KTKA 5DPQA 3FMZA 3P6FA 1PH3A 4QUFA 1TVQA 2EY5A 2D62A 2FMCA 4A3GB 1DCZA 3BDRA 1G85A 2YYZA 5CV6A 2QEJC 3J7YW 4CBVA 2I5LX 2MO1A 4GKCA 4HR7B 2RTDB 4OX9L 1IW7C 2JYOA 4O3XB 4OO1H 3CRKC 4PZ7A 4C2MH 1A3UA 1JMCA 1A57A 4DKAC 1VDZA 1QVFA 4CV7A 1PYSB 1P16A 1CHPD 5C4JB 3PO3H 5EDCA 4R0BA 2VB3X 4K6DA 1QWDA 4DUZL 3UDGA 2K5DA 1GT5A 3NXWA 3AFQA 5CYBA 1HUNA 3GD7A 2XWBB 3GTQH 2MFIA 4K14A 3RLFA 2AT3X 1D8LA 1SXWA 3CKIB 1HQRD 2EXZA 3N6RA 1SWPA 4U8UM 3HOUH 1QQSA 1HJPA 5IYDH 3STBC 1AFPA 1A2UA 1JZUA 2VUMB 2FRSA 4X64Q 3UDFA 4Y0PA 2DY8A 4Z2PA 1IXRA 5IYCH 3VE1A 1KAAA 4A3BG 1CRBA 2LKKA 1DOLA 4YWMA 4DR7L 1N0SA 4JI8Q 1W4TA 1W5RA 2XN9C 3FHWA 3X3NA 4JI1L 3AKMA 1OBPA 2OL7A 2RTQB 4E6IA 2BCOA 1Q86C 2A69C 4QYNA 5LJCA 1EY8A 3W3AA 4BBSB 1TWFH 1SNMA 1G8ZD 1EALA 2J4XA 1S2PA 3MTSA 5BVQA 3ZQ3A 4YFPA 5I6WA 2PPBC 3OIQA 1EYGA 1H95A 2ALLX 3NQTA 3OHXC 2HD3A 2O5IC 3EW2A 2OXPA 3KYHC 1SWGA 4B3RL 3RE6A 2WB1G 3NQIA 5H9LA 2DNEA 4IBAA 4KD4A 2IT1A 1F2LA 1HBQA 1RBPA 4RMFA 4AQYQ 2K52A 2FS6A 3WZQA 1PBOA 3CQNA 3T1DA 1U17A 4NKLA 4Y52H 1ILQA 1YNXA 3GQBA 1IBMQ 2E5LQ 1X3GA 1E1OA 1X8OA 2SEBD 3HOXB 3I4MB 5AQ6A 4RUNA 1EL0A 4N8X1 1U4RA 2F0GA 3BY0A 1YHAA 1R9TB 3OOCA 1EIOA 1I05A 2DM5A 4J8QA 3AUMO 5BVSA 1Y8NB 2QKIC 1VYFA 4AZMA 4ORWA 2WAQB 3NX2A 1JORA 4IUUA 4UAIA 3PUWA 2YV5A 1U0LA 1MM9A 3RN2A 4EQPA 1HQQA 2KCNA 2X32A 1AVGI 3UEVA 1MK5A 5E7NA 4Y0QA 4KN4C 2IX3A 2O62A 4CHTB 2JA6H 1FVIA 4WJ4A 2VXWA 5FAZA 3ONAB 3UEUA 4GLAC 3KFGA 1KGLA 4AW8A 1DOMA 4GN4B 3S1RH 2JA8H 1KT3A 3RDOA 1EY6A 4KHZA 4YCVA 2BLGA 4GKJQ 1I04A 3N91A 4FQBB 1YJ9A 2KT4B 4V190 1XJVA 4X64L 4P2CB 2JA5G 1K73C 5FQ6E 2UUBQ 1RIPA 3F9DA 1SMYC 2B2YA 1JBHA 4X6AH 4DV1Q 2A68C 1CT1D 3NUCA 3J81E 3CCSA 4UP9A 1JJGA 4TSSA 3TS0A 2FJ2A 1CQVA 3H0GG 4JI8L 4JHQA 2ASNX 1YWAA 1EZ6A 1P8LA 3ZYYX 2O4XA 3T53B 2X8TA 3CKGA 3VYRA 4XXEA 3UEXA 2DJFA 3I4OA 4L5TA 4KHPQ 1FEMA 4DV6Q 2VNUD 2UXCL 1KAWA 5D45A 1HFNA 1UYNX 5JAVA 2WPUA 5KNDA 1ZXTA 4PV1C 4LF8Q 5B11O 4LNQA 1HZAA 1SSOA 1IJ8A 3NE5B 2HZRA 4Y0RA 3FPPA 5FJ8G 4KKTA 1X8QA 2OWOA 4AIMA 2AWOA 4K0KL 3A8JE 4FXDA 5HTDA 2E74C 4R8IA 1D2BA 3QB3A 1EEFD 2BDOA 3DXJC 3NBHA 1AVDA 4U8UO 3OWEB 1C9OA 1FENA 2HMBA 1DC9A 2VFBA 3SLOA 2X56A 1L0WA 3M4PA 1IBML 5CORA 4BBOA 2XWJB 3GTOH 4C3JB 3VYTA 2RDFA 1K83B 2YU9H 1IIUA 4A3FB 1JMXA 4UPAA 2IZCB 1PTOH 3EM0A 4RUUA 4BBRH 3IFTA 2K32A 3SK8A 2R92B 2BSZA 1O7ZA 1SR3A 1XNQQ 2OFAA 2Q8IB 3Q22A 2OTJA 2C5CA 2JJQA 4A3LH 2WACA 4BY7H 1HBPA 3BLGA 1CJ5A 1L1OC 4A3KB 1OSPO 5F58A 5C4XH 1MEPA 4POGA 4DQ4A 1ERBA 3NP8A 4LFCQ 2K14A 3GTGB 1CQFA 1Q12A 2IHEA 1VWRB 3RZOB 3EFXD 1HR0W 2OF1A 4NNTA 1TXLA 4GRJA 1B9MA 4IPCA 3OJYC 1WTRA 1A63A 5FENA 1KXOA 1FD7D 5HCDC 4KIIA 2A13A 4GKJL 2LMCB 2ZJQA 1OXSC 4YWKA 2KCCA 1TWCH 3HPEA 2NTTA 2UUBL 4BGFA 3CQZH 4P74A 2WQ9A 2CZTA 3KFIA 3IKJA 4EQ5A 3NP1A 3V8UA 4XYQA 4DV1L 4PZ6A 1LIFA 5EBDA 2ACOA 1DF3A 4OXPA 3TGCA 4K2LA 2JGSA 2F3WA 2HQLA 1SWAA 1HXLA 4QY7A 5B29A 2QM9A 2F0DA 1LDQA 2LSSA 1X9NA 2IZAA 3ELXA 1J5EQ 3AQQA 1BRPA 5IGBA 3KJPA 4M6SA 1VQIA 4MTNA 2X46A 4HWMA 2WWPA 4XT3B 1RJTA 4IFDH 2LB6A 3MWYW 4LF8L 4MIRA 2K33A 4NB3A 2PNHA 1RDPD 1NCVA 1PH5A 4IMOA 5GROA 1TKWB 2GVAA 3I91A 5HURA 3NBHB 3HOWB 1UREA 3FDTA 1JWMD 3F8AA 1RODA 2VB2X 5BR8Q 2RD7C 3OPOA 2M2LA 2WB1E 2AT8X 5C5MA 1RCVD 1OPAA 4N7CA 4JI3L 2R3ZA 4I3DA 1X3QA 1PVOA 1YITA 1EYDA 3FMCA 2XNAC 3EQLC 3SE0A 2MUYA 5C4HA 1PMPA 5J1ZA 1SRIA 1SRGA 3X3MA 1WUBA 1OEEA 1QVCA 2NWGA 2B2VC 1AEXA 4J6HA 2UUCQ 5KHPA 5F6BA 1EIIA 2L15A 4JI7Q 3H3VI 1TOUA 1XNQL 3EBWA 5LJBA 1NGLA 2IZBA 2CCZA 4GH7A 4JC0A 3TZUA 5GQOA 4MIUA 3MFYA 4C3HH 3DTQA 1STAA 2PY1A 2FKJA 4KK7A 2F01A 1FJGQ 2K28A 1VWHB 3ELZA 3A7AB 3TRZA 4B3SQ 4RGOS 3SR1A 2MF6A 2VY3A 2IW3A 2A6ED 4GZYC 4K2KA 3HEJA 3J80c 1LYLA 2F0FA 2NNEA 2RTIB 1T9HA 1EQQA 5FK9C 1G2TA 2OY8A 4WJWA 1S40A 1A3YA 1S5CD 3CC4A 3MZ5A 3TZDA 2K5HA 5GAHC 3BZCA 2CH4W 2NVYB 1GUWA 4A3DB 5HZ9A 3D9WA 4COTA 2X6LA 2IZDB 4OS8A 3CCMA 1XCAA 1SFOH 2R7ZB 1IFCA 4R8NA 1SBBB 4KN7C 3HOYH 1E2VA 5CBAE 3W1BA 3G6JB 5B3MO 1MGSA 3AFPA 1EU3A 2BH2A 4JBKA 1A2DA 1EIGA 5FO9B 1VWJB 4FXKC 3TSSA 4IMNA 1I4QA 3S9WA 1J5EL 2IZEB 2GN5A 2NZOA 3F2CA 3SVMA 4DV3Q 3RDQA 5HGTA 4CDDA 4X3KA 1PRTD 4TQ2A 4RGNA 1ZRYA 5FQ7E 1SLFB 3JAML 2Q2UA 4NV7A 5LJHA 1PRTB 3E3XA 3H0GH 1ONLA 5C3EB 3F2BA 4DV2Q 4B3MQ 1FELA 4IUPA 3HOZH 1VQOA 3KLRA 1XPUA 2JU3A 4HAEA 2BOSA 3QO2A 3NPOA 1WCMB 2F0JA 3RZDH 2CFMA 1VQMA 4L5RC 2OY7A 4LFBQ 5TSSA 1Y69U 1O80A 2N49A 1NAPA 2BC3A 3B2IA 1HNXL 3M85A 1IKJA 2ZAIA 2RN4A 4JGLA 5JVG3 2Z0SA 4F87A 4BX6A 2LBAA 1NR4A 4HTHA 3K5NA 4APVA 3M7NA 3V96A 4IZ8A 5HZ5A 1D1IA 1QCBD 5IGGA 2FLJA 5I2YA 2D9UA 1SDFA 3OYYA 5LL6S 5FJ8H 1EYAA 4EGVA 1LUQA 3L2PA 1WTQA 5LKFA 3HOEA 1E3PA 4CPEA 3RSWA 2BH8A 2AQ1B 1Z7TA 2F0NA 2K5QA 2UUCL 3HOVB 3PO2B 2AT6X 4QQ1A 1JJCB 1A6XA 1LV9A 1GX8A 4ML7B 4BS9A 4JI7L 3D8GA 3EW1A 3FA9A 2R7DA 1SE4A 2FR2A 1EIYB 2D0PA 1UEBA 5EZ2A 2PCFB 4K8JA 2YG2A 3TREA 3J7AV 4OO1G 1KT4A 3NTHA 1PRTF 1EIHA 3G4SA 4GD9A 5B2AO 3K5LA 4TKJA 1Z6HA 1FJGL 1DGSA 3I2ZA 1MHWC 1VYGA 3PO3G 3GDEA 4AZNA 5B5FA 4TJZA 4B3SL 2AKQA 4UU3A 1IBLL 2E2IB 4DK1A 2CM9A 4EX5A 1CKOA 1YWCA 2A2UA 5AJ3L 1MOYA 3M7GA 4RKBA 1VQ8A 1HNWQ 3S14H 3KZAA 1DV9A 5JJKA 4ID2A 3K0XA 1SYCA 1VF5C 1KOIA 3J7AF 3S17H 1O78A 4A3JH 3NBXX 4HCEA 1H9MA 2QGQA 5IYCG 4UHVA 3HRZC 2Y0SE 5FFHA 3I4LA 2B2YC 2BS6A 1E2ZA 2ZXPA 1JOOA
chains in the Genus database with same CATH topology
5DM73 4FP5D 2WEWA 1W6KA 1F2MA 1K8MA 5KRUA 5C44B 2NVTB 1ILPA 1R4PB 4H0LC 4GETA 4BY1B 4XQQA 2CZUA 2JMBA 5IO6A 2L68A 1TWHB 2R73A 5I9PA 1VMPA 4PNYA 1RHPA 2K03A 1EFID 2PO4A 4XT1B 4LQZA 3WJCA 4BA2I 4CGYB 1CZWA 4N7DA 3HOLA 2BHVA 4C3IB 4XQNA 5M3FB 5ELFA 2XKLA 5T1IA 1LFOA 3JQOA 4WHIA 3O19A 4K5XA 2G79A 4B9XA 3C1EA 1ZKOA 3BX8A 1LIEA 1X71A 2I07B 3HK1A 1F9QA 3ZW0B 1F9SA 5HWZA 3MXNA 1BOSA 5LL6X 2SNSA 3FA7A 3KF8A 1B4OA 4NMZA 2OFMX 4K5VA 2EU7X 2HDLA 5M5WB 3FLLA 4ODDA 4BQUA 4A3EB 3MX7A 5JOBA 3VG5A 3DWAA 2DN8A 5ISRA 1KT7A 3FW4A 5D4AA 4XYOA 4KC8A 3VE2A 4A60A 4NDXA 4ZUJA 3WOEA 1DZKA 3L4RA 1XWEA 5HAEA 2KUMA 4DNTB 2PQEA 1ZNLA 5I6YA 3BRNA 1AP0A 2JEBI 3FR5A 1I3QB 1SYFA 5EPKA 1EW3A 1ZEQX 2P8GA 4QUCA 2MP1A 1JJJA 4KC7A 4XIGS 3FEWX 1ESFA 4ZAIA 2A6EC 5H9NA 1EU4A 4RWSC 1JOKA 2EYLA 1DONA 1G7NA 3SDZA 4OS0A 1LIDA 3JS1A 4OMXA 4X3SA 2F0SA 1ICNA 5C5LA 4C1NK 4MVLA 1KDBA 4ZH6A 2E2JB 3T16A 4DAYA 1YUPA 5DAUA 1QG5A 2JP1A 2F0MA 1ERXA 2NP1A 1O7YA 2ID0A 2AMMX 5KICA 4IAXA 5D8JA 1RF2D 2K5WA 4U9CA 2D5DA 3DEPA 4I3CA 1M4VA 4ZH9A 5EJWA 1PRTC 3QKGA 4QB4A 1V43A 3FENA 4PMBA 2GTLO 1SXTA 4JK1C 4IAWA 1KZWA 5HCEC 2J0TD 4G7HC 1R0UA 3NPPA 4KH8A 1U9RA 4MHEA 3MBTA 1SEBD 3WJBA 5C6AA 3HWDA 2V4DA 5IGEA 2PNRC 1E02A 3S1MB 3WJFA 5BN4A 3BDLA 3FA8A 4HPDA 5C4ZA 2OVAA 4IUQA 3HGBA 2YU9B 1SMPI 5HZ8A 1CA5A 1WVLA 2EJMA 1HTLD 1D1KA 4LKPA 1MSHA 1V1OA 4WRDA 3V2TA 3MXUA 3HWEA 1E5PA 1O1UA 3Q23A 1X8UA 4ORRA 4ORSA 1LT6D 4OL7A 4IB6A 3OIPA 2YMSA 2ZAGA 1Q1BA 1OXVA 5E4WC 1T8VA 4JBWA 5I9OA 3AU7A 1BLRA 3KBXA 4QYPA 4G57A 1QY0A 2AWNA 2WSJA 2EYMA 4YGGA 3LNNA 2QO6A 2R56A 4DAPA 5HCCC 3P02A 4LKTA 5EEDA 1MDCA 3PQUA 3ZW1A 3DUZA 2NNDA 4ID6A 3BVMA 4LAAA 2GJ5A 1KLUD 3GTPB 2EZVA 2Z1CA 2EYHA 5C0XG 2WR6A 4GDZA 2N88A 1KLGD 2L1BA 3TP5A 3VR5A 2F0OA 3NX1A 1EEID 5C0XI 2KHSA 2ZT9C 1CM9A 5J39A 4A3BB 1SY3A 4ZCBA 4DU9A 4IFDG 5IO5A 1FNWA 3NHHA 2EOTA 1EUOA 1U0XA 4HPBA 4YDBA 4IFDI 3L9AX 4BA1I 1EY4A 1V8QA 3EJIA 3KFHA 5FLXL 2FMMA 1STGA 3URYA 5KEEA 1EPBA 4AZRA 2AT5X 1PFBA 3A8IE 3PMFA 1KZXA 4PQXA 2GC9A 2EY2A 1SA8A 1YWDA 2K05A 4KY6A 5ELDA 3B2LA 4A3MB 2NYZD 5KNCA 5E1FA 4KT5A 2WB1B 5BYPA 1IW2A 3G7LA 5M5YB 2JU7A 2PZTA 2R61A 3BDCA 5KIDA 3EA6A 2EE1A 1JWSD 1A18A 1PLFA 4HPAA 3I4NB 4YGZA 1HQPA 3QJYA 3UEWA 1FGBD 4C3HG 1AW7A 1Z24A 4BWGB 3E6ZX 2MM3A 1ML0D 2K1BA 1DZMA 1KDAA 5IODA 1HHVA 1SYBA 4ZHDA 2B2TC 3SK6A 1GXDC 4EXZA 1X8PA 1WTOA 4EEJA 4ZRZA 5IOCA 4KKSA 3VR6A 3J80E 5EKLA 1U4LA 2FWVA 3ZW1B 1XTCD 3VA5A 2N55A 2Z4IA 4YKOA 1T5EA 3LWUA 1SNDA 1DJRD 1LNMA 4M8AA 3O22A 3SK5A 3GTJB 5IO7A 3EVQA 2X8FA 3Q24A 2K01A 1SY0A 5JEAH 5LJEA 1PXUA 1M8AA 2NB0A 3MEHA 2E4JA 4U8UN 5C0NA 1ET9A 1JCKB 4O4XA 3HS0C 3PUZA 4X3UA 2KEEA 4CJ2C 2JA5B 4OIKA 1STNA 1ZNHA 1X3PA 5CV5A 4QGVA 4KI0A 1MBYA 3U9OA 2C9OA 2F0QA 2W2AA 1FR3A 2WKCA 1ENAA 1E0BA 2EY1A 1ENFA 1FNUA 2F0TA 4O3YA 1SE3A 2L5TA 5D48A 2A6HD 1JE4A 3I73A 3VYSA 5H8TA 4L8JA 1W6JA 3UAQA 3CMPA 1GKAA 4IALA 4XQJA 4U3QA 1LT3D 4HMIA 2G9HD 1TS4A 3KK7A 3VG4A 5CV4A 4O3WA 4ILWA 1S5DD 1TR5A 3N52A 3NR3A 3H09A 2XVSA 3CHBD 1IYVA 4TLJA 2WIIB 3RKGA 1QFVA 4IB7A 4N9PA 4A93B 5LJGA 5AEOA 2ENBA 1I6VC 3T13A 4LZVA 4MISA 1B4MA 3Q6LA 2QILA 2KVMA 4YDAA 1CI3M 4AZOA 4ZHHA 2GTFX 4CKBA 3NWTA 5I2XA 4HCSA 3E5SA 4DA2A 1QNUA 2Z4HA 5K5PA 5NUCA 2CHBD 2BE5D 2AQ3B 1YNJD 2HCCA 3Q0AA 1SNQA 5LJDA 1IHZA 1LTTD 1STBA 1OEKA 4FF3A 1Y1WB 4G7OC 3VYUA 1D6EC 2D2CC 3EBKA 1Y9TA 3DM1A 1VPRA 1UAPA 2F0PA 4YBPA 4IURA 2Q39A 5IGDA 4ORXA 1B56A 4ZYSA 1Q90A 2OEOA 3ERQA 2RCTA 1BEBA 5CE4A 3P24A 1ICWA 1GOZA 1L6MA 3VA7A 2K23A 5ELEA 2DY7A 2Y0SB 4PMCA 1CFMA 1CHQD 3S1QB 2KEDA 1V1PB 4DF7A 3WVMA 4GZVA 1GKAB 5C0XH 5D65A 3S15B 1HMRA 1I4UA 3VR4A 2F0HA 3P7JA 3P6GA 2HZQA 5JR8A 1HPCA 4ABNA 3J81L 4NLJA 5COYA 2E2DC 3R2IA 2NZ1D 5G3LD 4KMUC 5CV9A 4I95A 1C8CA 3T51B 1TS5A 4U673 1II3A 1I50B 5CV8A 2QO5A 2WINB 4FF2A 3BU9A 5EQ0A 4A3IB 1PMRA 1LTRD 4TNNA 3VG6A 3MA2B 3P1HA 2JW1A 1AELA 3PEDA 2A2GA 2X6GA 2JA7B 1GGLA 2AL0X 3IFDA 1HMSA 1DOKA 1G6ZA 3TF6A 1YNND 3RUZA 3D6WA 3M4YA 1WTXA 2EVBA 3ZI8A 4FNFA 3P20A 4EVOA 3CU7A 3K5MA 1UUPA 2F73A 1YIVA 3K58A 5G3LF 4ZLTF 1OBUA 1GT4A 1S7DA 3VU1A 1D5MC 3M4OB 1E06A 5KYLA 4LMQD 5DG4A 1I4RA 4DN4M 1ZNEA 3S16B 3K0YA 4GK9A 2CBRA 2HDMA 3TGAA 1PZKD 1MX8A 3NK9A 4CKEA 2IFBA 3B2HA 3K7AB 2OZQA 1TVXA 1KDCA 4L63B 1TS2A 3FA6A 3BYYB 3K5OA 2JU8A 1DD2A 4EDEA 1ZNDA 4HN7A 4K19A 3MVVA 2BDNA 1TWGB 4IN3A 3MHBA 1STHA 1ENCA 5EPLA 5D14A 4KY7A 4GNYA 3HWGA 2AH7X 1CTMA 3L7ZC 2AQ2B 4HPCA 2QCPX 2A6HC 2KECA 2XIWA 3FYFA 1SY1A 1QY1A 3PIO3 2N93A 4DK0A 3STKA 1OEJA 4ZHFA 4I9SA 2B8GA 1EY5A 1CZGA 3TGBA 3GP7A 2F3VA 1Q3LA 5K06A 1EY9A 3S5XA 1ESRA 3D97A 1J8IA 1KT6A 1DFVA 2LY7A 4OMWA 1HMTA 1A2TA 1LTAD 1B44D 3QOLA 4YIJA 3ZW0A 4WFVA 1BSYA 4C2MB 2W2FA 4ZGFA 2B2TA 3A56A 1C48A 1HA6A 3CBSA 3C46A 3PO3B 1LPJA 3P6DA 2BE5C 1YNJC 3FW5A 2Q2MA 2WV6D 3AMUA 3PPTA 2GTLM 5HZ6A 3D3RA 3GTQB 3ZZVA 1FYCA 1YWBA 4IABA 2DNCA 1MX7A 5CMDA 3HOUB 3FEKA 1JWUD 2ICEC 3OW7A 4WBKA 1QWYA 4CKCA 2X69A 2BT9A 1MVGA 2LFOA 1L0XB 2M4LA 4QRLA 4CJ1B 4EQNA 2PW7A 3DWQA 3PH5A 4MVKA 1BRQA 2FS7A 1T5XD 1SXYA 4RFBA 3STMX 2KQ3A 2HLVA 4XMDA 3R93A 2HYSA 1H9RA 1TWFB 2H4OA 2F0EA 3BU1A 4V0BA 2E76C 2MJIA 2A0AA 1HCZA 1LTGD 4ZUIA 4ODGA 2FT9A 2RDGA 4WFN3 2G78A 5EKKA 1Q1EA 1S5FD 4FYDA 2A69D 1GUGA 1CBRA 2A5HA 1BF4A 4Z9CB 2RQXA 2R6GA 2A74C 1U18A 3KBGA 3MVFA 1ZYRD 4LK1C 2A3FX 2RBMA 1STEA 1BO0A 2MHVA 3BS2A 1I4HA 1BUVT 5CC4A 1CBSA 4L3RA 4HSVA 5HTEA 1S4ZA 4PMWA 3WJDA 4QMGA 1AZQA 1I4GA 4HSPA 4IUVA 3NTKA 4YFRA 2PZWA 3NQKA 2WUTA 5LJKA 1JJXA 3WBGA 1IKMA 1GX9A 3PUXA 2NNQA 1BSQA 4Y0SA 4NP1A 1F2YA 3K6OA 2EJFC 5IT9E 2QMIA 1YNNC 3KLSA 1WD0A 3K59A 1LABA 4ORYA 1B2TA 1JOQA 2JA6B 1GUNA 2GTLN 3IA8A 1DYQA 3OMCA 4F7XA 5JEAG 1HRJA 3S1RB 2JA8B 2LS01 3U9PC 2NN6H 3SHLA 1PEEA 2IX1A 1G74A 3DSZA 2PZUA 2SDFA 1AQBA 2Q8TA 2F4IA 1UEAB 1TW4A 3P6CA 1LICA 4G7ZC 3S26A 3B2JA 2B2WA 3BX7A 1R4QB 3BS1A 2MWHA 1GHJA 2K7VA 2M9VA 4F8MA 3ITPA 5L8OA 2EYOA 2BS5A 1PDQA 2RCQA 1LLRD 3LHNA 5AJBA 4EQOA 1ALBA 3R8BA 4A8ZA 3T56B 2GA4B 1BJ7A 2LBVA 1LIBA 4GU8A 5A2QL 3VPJE 2TMPA 5IGFA 4DQ3A 1TT2A 4H13C 1DZ1A 5D47A 3FR4A 4OGQC 4IB8A 3I0AA 3CQRA 4A1YA 4ALOA 1PTOD 2MGSA 3GTOB 2RA6A 2EPBA 1NR2A 1PTOB 2FFKB 4BBRB 1BQQT 2H1EA 3NQ9A 3W2DA 5J22A 1XXGA 4BY7B 5C0XJ 3FR2A 2MJ8A 2B2UA 5C4XB 1TQOA 4YCHA 1BDOA 2E75C 3NBIA 4FO2A 4IFDJ 1G291 2CQAA 5D3IB 5AFWA 4HFOA 5C3XA 3SAOA 1QFTA 3GV6A 3APUA 4FXGC 2CVRA 2B8FA 1QABE 4OS3A 1SJED 4QF4A 1BBPA 2Z8LA 3A7LA 1EZ8A 4K5WA 3MFGA 4CSBA 3D4DA 4NNSA 3QOJA 2F0UA 1TWCB 3I8ZA 1GXAA 2FTBA 1GT3A 3CQZB 2KTDA 1H9JA 4ZGUA 5HA0A 1EXSA 1DZPA 2CW0D 4QAEA 3RWXA 4AZQA 3KUPA 3RZYA 1PTOF 3APWA 3SXHA 4I6SA 2HNXA 1P6PA 2ICIA 1VMCA 4DXGA 4RKLA 3WJGA 1O1VA 1RLBE 4ZR2A 4H7BA 1F9PA 1G91A 4D6AA 1GUOA 4F88A 3NQ3A 1EY0A 3MXGA 1JYJA 1EY7A 4DNRB 2PYKA 5EPQA 1SAPA 1ICMA 4CJ0B 2QO4A 3NADA 5EPJA 3WDNA 1FDQA 4I7ZC 1Y8PB 3P6EA 2WKDA 5EGTA 4MN3A 1X32A 5H9AA 1BCPD 2L0CA 2ZXOA 4PJ2A 1QJOA 4NW4A 1BCPB 3DWPA 3C77X 5KNBA 5F6ZA 2F0IA 2NBFA 5IGCA 3VR3A 1X89A 3RBYA 1Y8OB 5CBEE 1ZYRC 3TDQA 1TOWA 4GNWA 3CR6A 1QE6A 3IFBA 4Q0FA 1KQWA 5F1EA 2HQEA 2TSSA 4O49A 4C3HB 5AJCA 2XSCA 3STNA 2W2BA 3U03A 3A8KE 2B39A 1T0VA 3DHQA 2RVLA 2ANSA 3I72A 1LTID 4O42A 4KTAA 4U68A 2WQAE 4YH0A 4H44C 1B0OA 1JR0D 3KQ0A 1CBIA 3PUVA 2IX0A 3A54A 1JYDA 2K62A 1EQDA 4CK4A 2XRSD 5B27A 1SYEA 3UI2A 2KOLA 3WOVA 3HTYA 2EY6A 1IL8A 1BCPF 2Q9SA 1QOHA 3ZUOA 1SFOB 1TIID 3HOYB 3TP7A 3I3CA 2NTSA 3DEOA 4FVMA 1YP7A 3QWNA 4TQUS 1UNSA 3IL8A 2EYPA 1S5ED 1KQXA 1E2WA 3D4WA 5L8NA 4ZQ3A 1OBQA 3I70A 1D3SA 1K8OA 1O7LA 2SOBA 1XKIA 2LKVA 3H0GB 5K36H 1H9KA 3HOZB 1KABA 4NW2A 1I06A 3FELA 1V1PA 1SYGA 4RH6A 3FPUB 3APXA 3OSOA 3BYTB 5D3DA 3RZDB 1B50A 1IFBA 2L55A 1Z47A 1OXXK 5FOBB 3F2UA 5EDBA 1Y9LA 2XRQD 3BZDB 1KNAA 3OBLA 3DMUA 5I4DA 2Q8RE 3AKNA 4N9TA 1CK1A 4S3SA 1SNCA 3GE2A 2CBSA 4O1NA 5H9KA 3MAQA 1EOTA 4KKUA 1CA6A 3WXQA 4L6TB 2Q2PA 3QG1A 1GT1A 1QG7A 3EROA 1RKNA 3VR2A 4HMJA 1PTOC 5E4XA 2L9HA 3O13A 4B08A 3HG9A 4NYQA 4YFQA 3GO5A 4ZHGA 4XMFA 4KJOA 4BOEA 4O4SA 2LA7A 3S14B 1KNEA 4C3JG 1NP1A 3FIQA 5JJZA 4D6BA 4DFAA 3BVZA 5FO8B 3D4RA 5L8IA 3S17B 4A3JB 2EYFA 2MPMA 1LKEA 1B53A 3J80L 4ZKCB 3VG7A 1JICA 4INNA 1GUSA 2ZXRA 1F9RA 4KD3A 1G5WA 4ES7A 2RKSA 4IUNA 2EDGA 1B8EA 4KCAA 2B2WC 4M7MA 5CGKA 1HTPA 2JE6I 2CW0C 3TN2A 4RA8A 1SXXA 5BVTA 4XMHA 3EMMA 4LJZC 3NTIA 4KHVA 3CBCA 2NVQB 3R3OA 3CWKA 1DZJA 4I65A 4O4OA 1RTOA 3C3LA 4O9SA 1A3TA 1SJHD 1S44A 3G7XA 4FBRA 4A1HA 3TZSA 5FO7B 3NWSA 2R74A 1OXTA 3BSZE 1QNKA 1PYWD 2KW1A 2K6AA 3JAME 2FHTA 1QY2A 1BBXC 4TRDA 1B9NA 3PP6A 1AN8A 2G7BA 2L9CA 2K04A 4PSQA 1DXMA 2IL8A 1WTWA 4I3BA 2RDHA 1RD9D 2R93B 4QIWB 1I6HB 2JN3A 2OFRX 2QF7A 1SXUA 1JV4A 2I46A 1TY2A 4I9RA 1BCPC 3PV0A 2JXMB 1EWHA 2B2UC 1D5XC 1EQVA 1KT5A 2Q4NA 1ML7A 2AT0X 2BA1A 3C2PA 5DNFA 1VCIA 2HUGA 3FKIB 1C4QA 3R2TA 4C56C 4YCEA 3D96A 5EKIA 2NN6G 1EYCA 1ET6A 4O4UA 3SOTA 1STYA 1LTBD 4IUTA 1IYUA 3S5VA 1G2SA 2NN6I 3RD4A 1HN2A 2L5PA 3WJEA 3V05A 3AB9A 2QOSC 3LWEA 3H6MA 1BR9A 2F0VA 4KV6A 3SEBA 1EI5A 3K57A 4ZK9B 1EPAA 4YKMA 1D5ZC 1PM1X 1OPBA 1NSNS 5ELCA 2FR3A 1Q8IA 4XMEA 3T4AC 1H9SA 3TMEA 2SNMA 2RSNA 2RA4A 5CV7A 3PUYA 4YMYA 3C1FA 1WD1A 3RMHA 4FF4A 2NVXB 2EJGC 3APVA 1BNZA 4FBOA 3U0DA 3P6HA 5C3WA 1SNOA 3ND9A 4OIJA 4Q5VA 1NUCA 1MSGA 1Y1VB 3CRLC 1EQTA 1E00A 5T1GA 2KJXA 1ACDA 3QIAA 1ZNGA 2POAA 1LO5D 3S60A 4RGMA 3O2YA 2OT2A 3P75A 3TP8A 4ALBA 2JEAI 1QB5D 1SNPA 4X3TA 1AZPA 1DM0B 1TS3A 3U9SA 3JSQA 1BSOA 1I4PA 4ON1A 1MD2D 3A55A 4L1NA 1PFMA 5CYUA 1JC7A 2NUCA 3HZXA 5CR3A 2F0WA 3BVGA 1F2ZA 3HP3A 3BG3A 5BN3A 4NYRA 5HA1A 4C1NI 4AZPA 3IAYA 5LHY1 4YGHA 2MO5A 3MXPA 1JIWI 3S2HB 3HWFA 2IJ0A 1GHKA 3TBIB 3ZW2A 1UZ2X 1HQMC 3D95A 5DEHA 3S1NB 4ZJ0A 1IW7D 1SYDA 2RQ0A 3PQSA 2JSOA 1LTSD 1RTNA 5JPMC 4J1MA 4MVEA 1HFGA 2EYJA 1VF7A 2M00A 3D31A 5KGUA 1NP4A 1H9SB 1B1ZA 3H3IA 5KIXA 3I17A 4OO1I 2X8SA 1ADLA 3VG2A 2AUKA 1GUTA 1EWCA 2J7ZA 2IWHA 4K8IA 5DM63 4UDUC 2G9DA 2WEXA 3KFFA 3GTLB 4O3ZA 2OVEA 2F0KA 4NLIA 4ZKBB 4RHSA 4GE1A 1IKEA 4TKBA 5BN5A 1I4XA 4FBVA 2E2HB 4OHJA 2KA7A 2ACPX 3EYCA 4ZHCA 3BDOA 2L4NA 2F09A 1LT4D 2FINB 1HUMA 2L67A 1SY2A 1BXTA 5HZQA 1CBQA 4EFGA 4IB9A 4XTCS 1H91A 1TU2B 1D2UA 5FQ8E 1HA5A 1TWAB 3PECA 5KYIA 5A2QE 3MC0B 1XYIA 3OD9A 5JEAJ 4RCOA 3NSWA 4ORUA 4ARHA 1XX8A 3SK4A 5E3FA 4QCLA 1JB3A 3FVQA 4KY5A 4AYBB 2F03A 1AB0A 1B3AA 5M3MB 2JOZA 1MI2A 4DXFA 2XSTA 4C3IG 2BA0A 3GAQA 4TKHA 4WORA 2KTSA 2PW5A 4ZFXA 1J9OA 1A15A 5EEEA 4QGWA 1U4PA 1OXUA 3H3VC 3TP6A 4XDXA 3Q6SA 3B2KA 1YP6A 1FE3A 1OO9B 4RAUC 2O2LD 4LZUA 4UU2A 2F1MA 3S2DB 5ELBA 5M5XB 4M1UB 4AYHA 1A3VA 4G4KA 4FGIB 2MHDA 2RSOA 3H94A 4TKOB 1PZID 3PIP3 1LT5D 5EBCA 5IIFA 1GJXA 1X8NA 4B9WA 3LV4A 4MVIA 2PMZB 2L12A 1GM6A 3KLSX 4FF1A 4XMGA 3WOFA 2OVSA 5K36G 2F0LA 1HXYD 4KJNA 5F7GA 3OWFA 4XMCA 1O8VA 1FTPA 3L3OC 1SMYD 1JQYD 1S5BD 3I90A 1FNVA 5F2DA 3M3YB 2A68D 1MUPA 3E3CA 5LKEA 3FEPA 2WP8J 3LX0A 4QZUA 1L0YB 3PH6A 3ND8A 5FKAC 5JVH3 2LFNA 5HBSA 3FRPB 5JPNC 4EQAC 3HKZB 4IQZA 4DAVA 5FLXE 2B63B 2X45A 3E0JA 2KD2A 1IKLA 1QILA 4RGTA 4WFUA 1PFNA 3ZUIA 2L11A 2A73B 3C78X 1TY0A 2OVDA 4YBUA 1U4MA 5M9OA 1WTVA 4HEDA 1WTPA 3GTKB 4QGXA 2AUJD 2QDBA 1LACA 1SE2A 3OMGA 4ME5A 3OE3A 3F6ZB 3K3LA 2O5JC 5A35A 1PZJD 1BWYA 1ZNKA 4QNIA 1LF7A 2HCIA 4DGZA 1F77A 4Y7NB 3C76X 3ZWEA 1T68X 3H91A 3D6CA 4QZTA 4RCNA 3GV3A 2IPKD 2CM4A 4R9WA 4BVMA 4K6LA 5IT9L 2B2VA 4NP5A 3GTMB 4RHRA 1KTKA 5DPQA 3FMZA 3P6FA 4QUFA 1TVQA 2EY5A 2D62A 2FMCA 4A3GB 1DCZA 3BDRA 1G85A 2YYZA 5CV6A 2QEJC 3J7YW 4CBVA 4GKCA 4HR7B 1IW7C 2JYOA 4O3XB 4OO1H 3CRKC 1A3UA 1A57A 1VDZA 4CV7A 1CHPD 5C4JB 5EDCA 4R0BA 2VB3X 4K6DA 1QWDA 2K5DA 1GT5A 3NXWA 5CYBA 1HUNA 3GD7A 2XWBB 4K14A 3RLFA 2AT3X 1SXWA 3CKIB 1HQRD 2EXZA 3N6RA 4U8UM 1QQSA 1JZUA 1AFPA 1A2UA 2VUMB 2FRSA 4Y0PA 2DY8A 3VE1A 1KAAA 1CRBA 2LKKA 1DOLA 1N0SA 2XN9C 3X3NA 3AKMA 1OBPA 4E6IA 2BCOA 2A69C 4QYNA 5LJCA 1EY8A 3W3AA 4BBSB 1SNMA 1G8ZD 1EALA 2J4XA 1S2PA 3MTSA 5BVQA 3ZQ3A 4YFPA 5I6WA 2PPBC 3OIQA 2ALLX 3NQTA 3OHXC 2O5IC 2OXPA 3NQIA 5H9LA 2DNEA 4IBAA 4KD4A 2IT1A 1F2LA 1HBQA 1RBPA 2FS6A 1PBOA 3CQNA 3T1DA 1U17A 4NKLA 1ILQA 1E2ZA 3GQBA 1X8OA 2SEBD 3HOXB 3I4MB 5AQ6A 4RUNA 1EL0A 3BY0A 1U4RA 2F0GA 1R9TB 3OOCA 1EIOA 1I05A 2DM5A 4J8QA 5BVSA 1Y8NB 2QKIC 1VYFA 4AZMA 4ORWA 2WAQB 3NX2A 1JORA 4IUUA 4UAIA 3PUWA 4EQPA 3UEVA 2KCNA 1AVGI 4Y0QA 4KN4C 2IX3A 2O62A 4CHTB 2VXWA 5FAZA 3ONAB 3UEUA 3KFGA 1KGLA 4AW8A 1DOMA 1KT3A 1EY6A 4KHZA 2BLGA 4FQBB 1I04A 3N91A 2KT4B 4V190 4P2CB 5FQ6E 3F9DA 1SMYC 2B2YA 1JBHA 2A68C 1CT1D 3NUCA 3J81E 4TSSA 2FJ2A 1CQVA 2ASNX 1YWAA 1EZ6A 3ZYYX 2O4XA 3T53B 2X8TA 3VYRA 4XXEA 3UEXA 1FEMA 2VNUD 5D45A 1HFNA 5JAVA 5KNDA 1ZXTA 4PV1C 1SSOA 3NE5B 2HZRA 4Y0RA 3FPPA 4KKTA 1X8QA 2AWOA 3A8JE 4FXDA 5HTDA 2E74C 4R8IA 1D2BA 3QB3A 1EEFD 2BDOA 3DXJC 3NBHA 4U8UO 3OWEB 2HMBA 1FENA 1DC9A 5CORA 2XWJB 4C3JB 3VYTA 2RDFA 1K83B 1IIUA 3EM0A 4A3FB 4RUUA 3VG3A 1PTOH 3IFTA 2K32A 3SK8A 2R92B 1O7ZA 2Q8IB 3Q22A 1HBPA 2C5CA 3BLGA 1CJ5A 2WACA 4A3KB 5F58A 4DQ4A 1ERBA 3NP8A 3GTGB 1CQFA 1Q12A 3RZOB 3EFXD 4NNTA 2OF1A 1TXLA 4GRJA 1B9MA 3OJYC 1WTRA 5FENA 1KXOA 1FD7D 5HCDC 4KIIA 2A13A 2LMCB 1OXSC 2KCCA 2NTTA 2WQ9A 2CZTA 3KFIA 3IKJA 3NP1A 3V8UA 4XYQA 1LIFA 5EBDA 2ACOA 1DF3A 3TGCA 4K2LA 2F3WA 5B29A 2QM9A 2F0DA 3ELXA 1BRPA 5IGBA 4M6SA 2X46A 4HWMA 2WWPA 4XT3B 1RJTA 4IFDH 2LB6A 3MWYW 4MIRA 2K33A 1RDPD 1NCVA 4IMOA 1TKWB 3I91A 5HURA 3HOWB 1UREA 3FDTA 1JWMD 3F8AA 1RODA 2VB2X 2RD7C 3OPOA 2M2LA 2AT8X 5C5MA 1RCVD 1OPAA 4N7CA 2R3ZA 4I3DA 1X3QA 1EYDA 3FMCA 2XNAC 3EQLC 3SE0A 2MUYA 5C4HA 1PMPA 5J1ZA 3X3MA 1OEEA 2NWGA 5KHPA 2B2VC 1AEXA 4J6HA 5F6BA 1EIIA 1TOUA 3EBWA 5LJBA 1NGLA 4GH7A 3TZUA 4MIUA 3MFYA 3DTQA 1STAA 2PY1A 4KK7A 2K28A 3ELZA 3A7AB 4RGOS 3SR1A 2IW3A 2A6ED 4GZYC 4K2KA 3HEJA 2F0FA 2NNEA 1G2TA 5FK9C 4WJWA 1A3YA 1S5CD 3MZ5A 3TZDA 1GUWA 5HZ9A 2NVYB 4A3DB 4COTA 2X6LA 4OS8A 1XCAA 2R7ZB 1IFCA 4R8NA 1SBBB 4KN7C 1E2VA 5CBAE 3G6JB 1MGSA 1EU3A 1A2DA 5FO9B 1EIGA 4FXKC 3TSSA 4IMNA 1I4QA 3S9WA 3SVMA 5HGTA 4X3KA 1PRTD 4TQ2A 4RGNA 1ZRYA 5FQ7E 3JAML 5LJHA 1PRTB 1ONLA 5C3EB 1FELA 4IUPA 3KLRA 2JU3A 4HAEA 2BOSA 3QO2A 3NPOA 1WCMB 2F0JA 5TSSA 1Y69U 1O80A 1NAPA 3B2IA 3M85A 1IKJA 2ZAIA 2RN4A 4JGLA 5JVG3 4F87A 2LBAA 1NR4A 4HTHA 3K5NA 3M7NA 3V96A 4IZ8A 5HZ5A 1D1IA 5IGGA 1QCBD 2FLJA 5I2YA 2D9UA 1SDFA 5LL6S 1EYAA 4EGVA 5LKFA 1WTQA 3HOEA 3RSWA 2F0NA 2AQ1B 1Z7TA 2K5QA 3HOVB 3PO2B 2AT6X 4QQ1A 1BM5A 1A6XA 1LV9A 1GX8A 4ML7B 4BS9A 3D8GA 3FA9A 1SE4A 2FR2A 5EZ2A 2PCFB 4K8JA 2YG2A 3J7AV 4OO1G 1KT4A 3NTHA 1PRTF 1EIHA 3K5LA 4TKJA 1Z6HA 1VYGA 4AZNA 4TJZA 2AKQA 4UU3A 2E2IB 4DK1A 2CM9A 1YWCA 2A2UA 3M7GA 4RKBA 3KZAA 1DV9A 4ID2A 1SYCA 1VF5C 1KOIA 3J7AF 1O78A 3NBXX 4HCEA 1H9MA 3HRZC 5FFHA 3I4LA 2B2YC 2BS6A 4ULLA 2ZXPA 1JOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8I E;  1H9K A;  2JEA I;  2NN6 H;  1Q12 A;  3OOC A;  1I6V C;  1B9N A;  3M4Y A;  2BE5 C;  4RCN A;  1YNJ C;  1Y8N B;  1K8M A;  1OXU A;  2EVB A;  1B9M A;  1CI3 M;  2D5D A;  1DXM A;  3U9S A;  1OXX K;  5KNC A;  4KN7 C;  3P20 A;  4H0L C;  1FYC A;  1E2V A;  1V43 A;  1GUO A;  2DNC A;  3PUW A;  4JK1 C;  2LMC B;  2QF7 A;  2D62 A;  1OXS C;  1DCZ A;  4DNR B;  2BE5 D;  2F1M A;  2KCC A;  4G7H C;  4G7Z C;  3PV0 A;  2YYZ A;  3OW7 A;  5K36 H;  4HR7 B;  2JXM B;  3BG3 A;  3QJY A;  4KN4 C;  5BN3 A;  2V4D A;  4BA2 I;  2PNR C;  3IKJ A;  1IW7 C;  1GHJ A;  3WDN A;  1EWH A;  5BN4 A;  2K7V A;  3CRK C;  1Y8P B;  3H94 A;  4I7Z C;  4OO1 H;  4TKO B;  4G7O C;  3HGB A;  2D2C C;  1ONL A;  1VDZ A;  4KKU A;  4KHZ A;  1GHK A;  2EJM A;  1HQM C;  1GJX A;  2BA1 A;  3T56 B;  1QJO A;  1ZKO A;  3KLR A;  3QG1 A;  3MXU A;  5KNB A;  1IW7 D;  1VCI A;  1SMY C;  3VR3 A;  3GD7 A;  1Q90 A;  1H9R A;  3VR2 A;  5K36 G;  1Y69 U;  2A68 C;  4H13 C;  3M85 A;  4KKS A;  3VR6 A;  4IFD H;  3RLF A;  2E76 C;  1DD2 A;  1VF7 A;  2NN6 G;  1Q1B A;  3D31 A;  1Y8O B;  1HCZ A;  1H9S B;  3N6R A;  4OGQ C;  3VA7 A;  1ZYR C;  1OXV A;  1T5E A;  2K33 A;  3LWU A;  3T53 B;  4JBW A;  3M7N A;  1IYU A;  2AUK A;  2NN6 I;  1Q1E A;  1TKW B;  1GUT A;  1CFM A;  2A68 D;  2A69 D;  1GUG A;  3AB9 A;  3A8K E;  5JEA H;  1Z7T A;  3OPO A;  2R6G A;  3ND8 A;  2DN8 A;  3I72 A;  4LK1 C;  1A6X A;  5C0X H;  3D4R A;  3LNN A;  5KND A;  4H44 C;  1CTM A;  3L7Z C;  3PUZ A;  4PV1 C;  3VR4 A;  5BN5 A;  4IQZ A;  3FMC A;  2A6H C;  1HPC A;  2KA7 A;  2PCF B;  3NE5 B;  3EQL C;  3PUV A;  4KI0 A;  2A69 C;  3SE0 A;  4OO1 G;  3BDO A;  3FPP A;  3W3A A;  4DNT B;  1H9S A;  4KKT A;  4DK0 A;  1BDO A;  1GUS A;  2AWO A;  1FR3 A;  2E75 C;  3A8J E;  1Z6H A;  2E74 C;  2JEB I;  4KMU C;  1G29 1;  3PUY A;  5C0X G;  2B8G A;  2EDG A;  3DXJ C;  2BDO A;  3VR5 A;  4XTC S;  2L5T A;  2PPB C;  2A6H D;  2EJG C;  4DK1 A;  1TU2 B;  1HTP A;  2B8F A;  2JE6 I;  2CW0 C;  2ZT9 C;  3I73 A;  3PUX A;  4XIG S;  4L8J A;  3MFY A;  3T51 B;  3TZU A;  3A7L A;  2O5I C;  2A6E C;  4IFD G;  4LJZ C;  2DNE A;  3ND9 A;  4TQU S;  2AUJ D;  2EJF C;  2IT1 A;  1YNN C;  1LAB A;  3IFT A;  1LAC A;  2K32 A;  1PMR A;  3CRL C;  3SDZ A;  1VF5 C;  1E2W A;  3A7A B;  2O5J C;  1H9J A;  5A35 A;  2Q8I B;  1O78 A;  4BA1 I;  1GUN A;  1V8Q A;  1H9M A;  3QIA A;  1K8O A;  1IYV A;  2A6E D;  4GZY C;  1O7L A;  3GQB A;  3I4L A;  5JEA G;  1OXT A;  2BA0 A;  1E2Z A; 
#chains in the Genus database with same CATH topology
 5DM7 3;  4FP5 D;  2WEW A;  1W6K A;  1F2M A;  1K8M A;  1JE5 A;  1RXJ A;  4DV3 L;  2RTA A;  3AEH A;  5ELN A;  2D0O A;  4R4I A;  5KRU A;  5C44 B;  1LDO A;  2NVT B;  1ILP A;  1R4P B;  4H0L C;  2I5H A;  4P71 A;  4GET A;  4BY1 B;  2DJF C;  4JG2 A;  4XQQ A;  3VHH A;  2CZU A;  2JMB A;  5IO6 A;  1KL3 A;  2L68 A;  4DV2 L;  1TWH B;  4B3M L;  2NVQ H;  2R73 A;  3UDI A;  5I9P A;  2PI2 E;  1VMP A;  2P5Z X;  1RHP A;  4PNY A;  2FHN X;  2K03 A;  1EFI D;  2PO4 A;  4XT1 B;  4LQZ A;  3WJC A;  4BX6 B;  4BA2 I;  4CGY B;  1CZW A;  4N7D A;  3HOL A;  2BHV A;  4C3I B;  4XQN A;  3G71 A;  5M3F B;  4BXX H;  5ELF A;  3U4Z A;  2XKL A;  5T1I A;  1LFO A;  3JQO A;  4WHI A;  3O19 A;  4K5X A;  1SWO A;  2G79 A;  4B9X A;  3C1E A;  1ZKO A;  3BX8 A;  4X65 Q;  1VQP A;  1LIE A;  4QQB X;  2OY1 O;  1X71 A;  2I07 B;  1SWB A;  3HK1 A;  1F9Q A;  2DJG C;  2MNA A;  1D7Q A;  3ZW0 B;  1F9S A;  5HWZ A;  3MXN A;  1BOS A;  5LL6 X;  2SNS A;  2H5X A;  5IYB G;  1I6H H;  2R93 H;  3FA7 A;  3KF8 A;  1B4O A;  4NMZ A;  2OFM X;  4K5V A;  2EU7 X;  2HDL A;  1NNX A;  5M5W B;  3FLL A;  4ODD A;  1KHI A;  4BQU A;  4A3E B;  1K8A C;  1LCZ A;  3CCU A;  3MX7 A;  5JOB A;  3H3V H;  3VG5 A;  2IZK A;  2RTF B;  2RHQ B;  3DWA A;  4CDE C;  1Y52 X;  2DN8 A;  1K24 A;  5ISR A;  1KT7 A;  3FW4 A;  5D4A A;  4XYO A;  1VQK A;  4KC8 A;  3VE2 A;  4A60 A;  1SWS A;  2YTX A;  4NDX A;  1Q81 C;  2JA6 G;  4ZUJ A;  3WOE A;  1DZK A;  1SWF A;  1SRH A;  3L4R A;  1STP A;  4DR6 Q;  1XWE A;  5HAE A;  2KUM A;  4DNT B;  3FKI H;  1HNW L;  2PQE A;  1ZNL A;  5I6Y A;  1KC8 C;  3BRN A;  1AP0 A;  1FJ1 E;  2JEB I;  3FR5 A;  1I3Q B;  2G5L A;  1SYF A;  5EPK A;  1EW3 A;  3EIV A;  1SWU A;  1SMX A;  1ZEQ X;  2P8G A;  3CCR A;  3RY2 A;  4QUC A;  1W2B A;  2MP1 A;  1JJJ A;  4KC7 A;  3LGJ A;  4XIG S;  4GOP C;  3FEW X;  1ESF A;  4ZAI A;  2A6E C;  1VWN B;  2YTY A;  3KFU A;  1RXK A;  5H9N A;  1EU4 A;  4RWS C;  1RAV A;  1JOK A;  1A8V A;  2EYL A;  1DON A;  1G7N A;  3SDZ A;  4OS0 A;  4B55 A;  1LID A;  3JS1 A;  2B29 A;  4OMX A;  2K75 A;  2F0S A;  4X3S A;  4JI4 L;  1ICN A;  5C5L A;  4C1N K;  3PCO B;  4MVL A;  1KDB A;  4BCS A;  3I55 A;  4ZH6 A;  2E2J B;  3T16 A;  4DAY A;  1YUP A;  5DAU A;  2OYB O;  1QG5 A;  1V9P A;  2JP1 A;  2F0M A;  1ERX A;  1SRF A;  2NP1 A;  1O7Y A;  2ID0 A;  2AMM X;  5KIC A;  4IAX A;  5D8J A;  3HKZ G;  1RF2 D;  2NVX H;  2K5W A;  4U9C A;  2D5D A;  3DEP A;  4P72 A;  1M4V A;  1IL2 A;  5EJW A;  1NC9 A;  4I3C A;  4ZH9 A;  1PRT C;  3QKG A;  4QB4 A;  1V43 A;  1XMQ Q;  3FEN A;  4PMB A;  2GTL O;  1SXT A;  4JK1 C;  4IAW A;  1KZW A;  5HCE C;  2ALY B;  1BVS A;  1EQR A;  2J0T D;  1Y1V H;  1KRS A;  2HIV A;  3NPP A;  4G7H C;  1R0U A;  4KH8 A;  1U9R A;  4MHE A;  3MBT A;  1SEB D;  3MXN B;  4X65 L;  3WJB A;  5C6A A;  3HWD A;  1QUQ A;  3KF8 B;  2V4D A;  5IGE A;  2PNR C;  2R7F A;  1E02 A;  3S1M B;  3WJF A;  5BN4 A;  3BDL A;  3FA8 A;  4HPD A;  5C4Z A;  3KDF A;  4IUQ A;  2OVA A;  3HGB A;  2YU9 B;  4Y59 A;  1SMP I;  5HZ8 A;  4BBR G;  1CA5 A;  1WVL A;  2EJM A;  1HTL D;  4PZ8 A;  4U46 A;  1D1K A;  4X62 Q;  4CPF A;  4A3L G;  4LKP A;  1MSH A;  4BY7 G;  1V1O A;  4WRD A;  3V2T A;  3MXU A;  3HWE A;  1C0A A;  4R1J A;  3T2X A;  5C4X G;  1VWA B;  1E5P A;  1O1U A;  3Q23 A;  1X8U A;  4ORR A;  4ORS A;  1LT6 D;  4OL7 A;  2AHO B;  4IB6 A;  4GJS A;  3OIP A;  2YMS A;  2ZAG A;  5L3Y A;  1Q1B A;  1OXV A;  5E4W C;  3PDF A;  1T8V A;  4JBW A;  1PHJ A;  5I9O A;  3AU7 A;  1BLR A;  4I7A A;  3KBX A;  1OTC A;  2I0Q A;  2UYW A;  4DR6 L;  1VWC B;  1IYJ B;  4QYP A;  4G57 A;  1N8R C;  1QY0 A;  2AWN A;  3S2H H;  2WSJ A;  2EYM A;  4YGG A;  4YHH Q;  3LNN A;  3CP0 A;  2QO6 A;  4YWL A;  4DAP A;  2R56 A;  5HCC C;  1RXH A;  3S1N H;  3P02 A;  4LKT A;  5EED A;  3ULJ A;  1MDC A;  2OL6 O;  2A5C A;  3PQU A;  1CSQ A;  1K9M C;  3ZW1 A;  3DUZ A;  2NND A;  4ID6 A;  2VDF A;  3BVM A;  4LAA A;  2GJ5 A;  2RTG B;  1KLU D;  3I56 A;  3GTP B;  1SN8 A;  2EZV A;  2Z1C A;  2EYH A;  5C0X G;  2WR6 A;  4DAY B;  3PSI A;  4GDZ A;  3WYP A;  2QCB A;  1PYB A;  1KLG D;  2L1B A;  2N88 A;  3TP5 A;  2F0O A;  3VR5 A;  3NX1 A;  1EEI D;  5C0X I;  2KHS A;  2ZT9 C;  1JT8 A;  5HY6 A;  1CM9 A;  2OQK A;  4CDD C;  5J39 A;  4A3B B;  1SY3 A;  4ZCB A;  4DU9 A;  4IFD G;  5IO5 A;  3PIP A;  1FNW A;  3NHH A;  2OFB A;  2EOT A;  1EUO A;  2F4V Q;  1U0X A;  2RF4 A;  4HPB A;  4YDB A;  3GTL H;  4IFD I;  3KOJ A;  3L9A X;  2DGY A;  1O7I A;  4BA1 I;  2VUM G;  1EY4 A;  1V8Q A;  3EJI A;  3KFH A;  5FLX L;  2FMM A;  1STG A;  3URY A;  5KEE A;  2E2H H;  1EPB A;  4AZR A;  3CPF A;  4DV7 Q;  2AT5 X;  1XMQ L;  4Z28 A;  1QUQ B;  3JAM i;  5IP7 G;  1PFB A;  3A8I E;  4GN5 A;  3B6Y A;  3PMF A;  1UE6 A;  3KDF B;  4PQX A;  2GC9 A;  1KZX A;  1VQC A;  2EY2 A;  1SA8 A;  5IRW A;  1YWD A;  4DR4 Q;  2K05 A;  4KY6 A;  5ELD A;  3B2L A;  4A3M B;  2K5V A;  2NYZ D;  5KNC A;  5E1F A;  1VWI B;  4KT5 A;  2WB1 B;  5BYP A;  1IW2 A;  3G7L A;  5M5Y B;  1TWA H;  4BBS G;  2JU7 A;  2PZT A;  2R61 A;  3RR5 A;  3BDC A;  5KID A;  3EA6 A;  2EE1 A;  1JWS D;  1A18 A;  1PLF A;  4HPA A;  4X62 L;  3I4N B;  1YIJ A;  2QA4 A;  4YGZ A;  1HQP A;  3QJY A;  3UEW A;  1XMO L;  1FGB D;  4C3H G;  1AW7 A;  1Z24 A;  5F2B A;  1JJ2 A;  4BWG B;  3E6Z X;  2MM3 A;  1ML0 D;  2K1B A;  5M3M H;  1DZM A;  1KDA A;  3DM3 A;  5IOD A;  4HJ5 A;  1HHV A;  1HZC A;  1SYB A;  2VL6 A;  3JC6 6;  4ZHD A;  5IYB H;  2B2T C;  3SK6 A;  1GXD C;  4GDA A;  3TEH B;  3RLO A;  4EXZ A;  1X8P A;  1WTO A;  5IT9 c;  2AVI A;  4EEJ A;  4ZRZ A;  1YEZ A;  5IOC A;  4IOC A;  4KKS A;  3VR6 A;  3J80 E;  1MIU A;  1U4L A;  5EKL A;  2UXB Q;  2FWV A;  4YHH L;  3ZW1 B;  3HOX G;  1XTC D;  3VA5 A;  2N55 A;  2Z4I A;  1YHB A;  4YKO A;  1T5E A;  3LWU A;  1SND A;  1DJR D;  3S2D H;  1LNM A;  4M8A A;  3O22 A;  5M5X H;  1SWH A;  3SK5 A;  3GTJ B;  3CMA A;  3HOY G;  3EVQ A;  5IO7 A;  1HNZ Q;  2A5B A;  3Q24 A;  2X8F A;  2Y32 A;  2K01 A;  2WAQ G;  4AH6 A;  1SY0 A;  5JEA H;  5LJE A;  1PXU A;  1M8A A;  2NB0 A;  1VWL B;  3MEH A;  2E4J A;  4U8U N;  4LFA Q;  3MM0 A;  2G8C O;  1ET9 A;  2OY5 O;  1JCK B;  5C0N A;  3NEN A;  4O4X A;  3HS0 C;  3PUZ A;  4X3U A;  2KEE A;  4CJ2 C;  5GAE C;  5LMN W;  2JA5 B;  4OIK A;  4PG3 A;  1STN A;  2HHH Q;  1JB7 A;  4LF4 Q;  1X3P A;  5CV5 A;  1S72 A;  1ZNH A;  1NJI C;  4QGV A;  4KI0 A;  1MBY A;  3U9O A;  2F0Q A;  1UE1 A;  1HZB A;  2C9O A;  1W6F A;  1FR3 A;  2WKC A;  1SLG B;  2W2A A;  5IXG A;  1ENA A;  2AMC B;  1E0B A;  2EY1 A;  3HOZ G;  1ENF A;  1FNU A;  2F0T A;  4O3Y A;  1NMF A;  1SE3 A;  2ES2 A;  1BBW A;  2L5T A;  5D48 A;  2A6H D;  3T1Y Q;  2XGT A;  1JE4 A;  1CUK A;  3I73 A;  3VYS A;  5H8T A;  4L8J A;  1W6J A;  4DV7 L;  4OKA A;  3CMP A;  3UAQ A;  3M3Y H;  1GKA A;  3HKZ E;  4IAL A;  4XQJ A;  3LTW A;  4U3Q A;  1LT3 D;  4HMI A;  2G9H D;  4JV5 Q;  1TS4 A;  3KK7 A;  4GLV B;  3VG4 A;  5CV4 A;  2A8V A;  4O3W A;  4ILW A;  3U58 A;  1S5D D;  1TR5 A;  3N52 A;  1GM5 A;  3NR3 A;  3H09 A;  2XVS A;  2PI2 A;  3CHB D;  1IYV A;  3CD6 A;  4JI5 Q;  4TLJ A;  2WII B;  3CW2 C;  3RKG A;  2B63 H;  1QFV A;  4IB7 A;  4N9P A;  4A93 B;  1HXZ A;  4AQY L;  1UYO X;  5LJG A;  3CCL A;  5AEO A;  3ER0 A;  1ASY A;  2ENB A;  1I6V C;  3T13 A;  4LZV A;  4MIS A;  1B4M A;  3Q6L A;  2QIL A;  2KVM A;  2DJG A;  1CI3 M;  4YDA A;  1Y14 B;  2E5L L;  4AZO A;  4ZHH A;  2GTF X;  4CKB A;  3NWT A;  5I2X A;  1N32 Q;  3GTK H;  4HCS A;  1UE5 A;  3E5S A;  4DA2 A;  1QNU A;  2Z4H A;  5K5P A;  5NUC A;  4IRW A;  2CHB D;  2BE5 D;  2AQ3 B;  1YNJ D;  4LF5 Q;  2HCC A;  3Q0A A;  1SRU A;  1SNQ A;  2AF5 A;  5LJD A;  1A0I A;  1IHZ A;  1KD1 C;  1LTT D;  1STB A;  1OEK A;  2KHI A;  4OWX B;  1VWE B;  4CDE A;  2HIX A;  2CAM A;  4FF3 A;  1Y1W B;  4G7O C;  3VYU A;  5IWA Q;  1D6E C;  2D2C C;  3EBK A;  1Y9T A;  3AEV A;  3DM1 A;  3BZK A;  3CME A;  1VPR A;  4A3F G;  4Y7N H;  1UAP A;  1RSU B;  2F0P A;  2A1A A;  4RG1 A;  4YBP A;  4IUR A;  4A3J G;  1LTL A;  2F3I A;  2Q39 A;  5IGD A;  4ORX A;  2RCN A;  1B56 A;  4ZYS A;  1HNZ L;  5IRA A;  4Y5D A;  1Q90 A;  2OEO A;  3ERQ A;  2RCT A;  1MJE A;  1CKN A;  1BEB A;  5CE4 A;  2K5N A;  3P24 A;  4LFA L;  3GTM H;  1ICW A;  1GOZ A;  1L6M A;  3VA7 A;  2K23 A;  5ELE A;  4A3G H;  2DY7 A;  1KXL A;  2Y0S B;  4PMC A;  4GOP A;  2HHH L;  4LF4 L;  1SWK A;  1CFM A;  1CHQ D;  3S1Q B;  2KED A;  1V1P B;  2WFW A;  4DF7 A;  3WVM A;  4GZV A;  1EFW A;  1GKA B;  5C0X H;  1JQP A;  5D65 A;  1EUJ A;  3S15 B;  1HMR A;  1LCW A;  1I4U A;  3J81 j;  3VR4 A;  5C4J H;  2F0H A;  3P7J A;  3P6G A;  2HZQ A;  3T1Y L;  4CPI A;  4KHP L;  5JR8 A;  1HPC A;  4DV6 L;  4ABN A;  3J81 L;  4NLJ A;  1VQ5 A;  4BXX G;  5COY A;  1VWO B;  2X34 A;  2E2D C;  3R2I A;  4WJ3 M;  1PH7 A;  3S24 A;  3RNU A;  1PH4 A;  4JV5 L;  2NZ1 D;  5G3L D;  2RTB B;  1WOC A;  4KMU C;  5CV9 A;  2XTI A;  4I95 A;  2JN4 A;  2VUM H;  1VQJ A;  4ZCK A;  1GD7 A;  1WI5 A;  1C8C A;  3T51 B;  4JBJ A;  1TS5 A;  4JOI A;  4NV8 A;  4JI5 L;  4U67 3;  1II3 A;  1I50 B;  2Z9H A;  5CV8 A;  2QO5 A;  5IP7 H;  2WIN B;  4FF2 A;  3BU9 A;  5EQ0 A;  2R93 G;  4A3I B;  1PMR A;  1LTR D;  4TNN A;  3VG6 A;  3MA2 B;  3P1H A;  2JW1 A;  1AEL A;  3PED A;  4DUY Q;  2A2G A;  3F8T A;  2X6G A;  2JA7 B;  1GGL A;  4GUZ A;  2AL0 X;  1KQS A;  3IFD A;  1HMS A;  1N32 L;  1DOK A;  1G6Z A;  1SWJ A;  3TF6 A;  4BBS H;  1YNN D;  1S3O A;  3RUZ A;  1FL0 A;  2JA9 A;  3D6W A;  1HR0 Q;  4LF5 L;  3SLJ A;  3M4Y A;  1WTX A;  2EVB A;  3ZI8 A;  3OTO Q;  1NBX A;  4CPH B;  4FNF A;  3FKI G;  3P20 A;  2RCF A;  4LFC L;  4EVO A;  5IWA L;  5L37 A;  3CU7 A;  1GVP A;  3K5M A;  2FKG A;  1UUP A;  2F73 A;  1YIV A;  4DV5 Q;  3CXC A;  3K58 A;  1CKN B;  5G3L F;  4ZLT F;  1OBU A;  1GT4 A;  3T6F A;  1S7D A;  3VU1 A;  1D5M C;  1E24 A;  3M4O B;  1X6O A;  1E06 A;  2C4I A;  5KYL A;  1X54 A;  4LMQ D;  4GOP B;  5DG4 A;  1I4R A;  4DN4 M;  1ZNE A;  3S16 B;  1MKH A;  3K0Y A;  2OCE A;  1YI2 A;  3HOX H;  3VHM A;  3I4M H;  4GK9 A;  3WZO A;  2CBR A;  2HDM A;  1R9T H;  3TGA A;  2UZ2 A;  1X56 A;  1PZK D;  1LCV A;  1MX8 A;  2A19 A;  3NK9 A;  3CC7 A;  4CKE A;  2IFB A;  3B2H A;  1STR B;  3K7A B;  2OZQ A;  1TVX A;  1KDC A;  4L63 B;  1SWD A;  1TS2 A;  3PQI A;  4C5P A;  3FA6 A;  3BYY B;  2ZSC A;  3K5O A;  2JU8 A;  1DD2 A;  4GS3 A;  4EDE A;  1ZND A;  1TXY A;  4HN7 A;  4A3D G;  4K19 A;  3WZP A;  3MVV A;  2BDN A;  1TWG B;  4IN3 A;  3F2D A;  3MHB A;  1STH A;  1V1Q A;  1XNR Q;  2KHJ A;  1ENC A;  5EPL A;  5D14 A;  4KY7 A;  1PBY A;  4GNY A;  4DV0 Q;  1Y1V G;  3HWG A;  1SWE A;  2AH7 X;  3E9I A;  5K68 A;  1CTM A;  3L7Z C;  2AQ2 B;  1X3E A;  4HPC A;  2QCP X;  2A6H C;  2KEC A;  3HKS A;  2XIW A;  3FYF A;  5BR8 L;  1SY1 A;  1QY1 A;  4BX5 A;  3PIO 3;  2N93 A;  3SGI A;  4JCV E;  1I9H A;  4DK0 A;  4NXM Q;  3STK A;  1ICF B;  1JJU A;  2VQF Q;  1OEJ A;  4ZHF A;  3CKF A;  4UP8 A;  2B8G A;  1EY5 A;  3EBE A;  4I9S A;  4Z2V A;  1CZG A;  4DR1 Q;  3TGB A;  3GP7 A;  2F3V A;  1Q3L A;  5K06 A;  3WWV A;  5GAD C;  2IZH B;  1EY9 A;  3L0O A;  4LUV A;  3S5X A;  2IY5 B;  1ESR A;  3D97 A;  2IZL B;  1J8I A;  1KT6 A;  2QEX A;  5DLQ E;  3VHI A;  1DFV A;  1HR0 L;  2N78 A;  2LY7 A;  1WYD A;  4OMW A;  4HJ8 A;  1HMT A;  1A2T A;  1LTA D;  4LF7 Q;  1B44 D;  2NZH A;  3QOL A;  4R4C A;  4YIJ A;  3OTO L;  3ZW0 A;  4WFV A;  1BSY A;  4C2M B;  2W2F A;  4ZGF A;  2B2T A;  3A56 A;  4DV5 L;  1C48 A;  1HA6 A;  3CBS A;  3C46 A;  3HOV G;  3PO3 B;  1LPJ A;  3P6D A;  1CSP A;  3BU2 A;  2BE5 C;  3W1G A;  1YNJ C;  5H1S E;  3FW5 A;  2Q2M A;  2WV6 D;  3AMU A;  3PPT A;  2VW9 A;  2GTL M;  5HZ6 A;  1L2F A;  3D3R A;  3GTQ B;  3ZZV A;  1FYC A;  1GKH A;  3CPW A;  1YWB A;  4IAB A;  2DNC A;  2IZJ A;  4C3J H;  5CMD A;  1MX7 A;  1WBI A;  1K83 H;  1VQ9 A;  3HOU B;  4A3F H;  3FEK A;  1JWU D;  4IOA A;  2ICE C;  1K3R A;  3OW7 A;  4WBK A;  2R92 H;  1QWY A;  4CKC A;  2X69 A;  5ELO A;  1MVG A;  2BT9 A;  3QQ2 A;  2LFO A;  1L0X B;  4A3K H;  5CHK A;  4IJH A;  2M4L A;  3ZJY C;  4QRL A;  4CJ1 B;  4EQN A;  2PW7 A;  4GGR A;  3DWQ A;  3X00 A;  3GTG H;  2RTR B;  3PH5 A;  4LUO A;  4MVK A;  1BRQ A;  2I5M X;  1T5X D;  3G48 A;  1RL2 A;  4RFB A;  3RZO H;  1SXY A;  2FS7 A;  3STM X;  4DK3 C;  2HKD A;  2KQ3 A;  2HLV A;  4XMD A;  3RDU A;  3R93 A;  1SWL A;  3K80 C;  1FGU A;  1H9R A;  2HYS A;  1TWF B;  2H4O A;  2F0E A;  1XNR L;  1SRE A;  3BU1 A;  1N9M A;  4V0B A;  2E76 C;  2MJI A;  4DV0 L;  4BX5 B;  2A0A A;  1VQA A;  1HCZ A;  3KJO A;  1LTG D;  1N34 Q;  3ICE A;  4ZUI A;  3RY1 A;  4ODG A;  2FT9 A;  1NMG A;  2RDG A;  4WFN 3;  4ME3 A;  4N8F A;  2G78 A;  5EKK A;  1Q1E A;  4LFB L;  1S5F D;  4HJ9 A;  1XPO A;  4FYD A;  1Y53 X;  1LUZ A;  3M9B A;  2A69 D;  1GUG A;  2LXJ A;  1CBR A;  3JAM c;  2A5H A;  1BF4 A;  1SLJ A;  1K28 A;  4FDB A;  4Z9C B;  4IJL A;  2RQX A;  4BY1 G;  4NXM L;  2R6G A;  2A74 C;  1U18 A;  3KBG A;  3MVF A;  1ZYR D;  4LK1 C;  2A3F X;  1PH9 A;  2RBM A;  1STE A;  4JNJ A;  1BO0 A;  2MHV A;  4I60 A;  4DR1 L;  4QIW E;  3BS2 A;  1I4H A;  1BUV T;  5CC4 A;  4AYB G;  1CBS A;  1KRT A;  4L3R A;  5M3M G;  3NEM A;  4HSV A;  2VZA A;  4JBM A;  1NQM A;  5HTE A;  1S4Z A;  1UE7 A;  3I7F A;  4PMW A;  4QMG A;  1AZQ A;  3WJD A;  1I4G A;  5M3F G;  4HSP A;  1NY4 A;  2RHS B;  4IUV A;  3NTK A;  1N33 Q;  4YFR A;  2PZW A;  3CF5 A;  3NQK A;  2WUT A;  4DAM A;  5LJK A;  1JJX A;  3WBG A;  4LF7 L;  1IKM A;  4HJ7 A;  1GX9 A;  1YZ6 A;  3PUX A;  2NNQ A;  3E9H A;  4KLK A;  5JD2 A;  1BSQ A;  1IZ6 A;  3HOW H;  2GH7 A;  4NP1 A;  4Y0S A;  1Q82 C;  1F2Y A;  2RTO B;  2ZTC A;  3K6O A;  2EJF C;  5IT9 E;  1VWG B;  2QMI A;  1YNN C;  1GO3 E;  3KLS A;  1B3Q A;  3K59 A;  1LAB A;  1WD0 A;  4ORY A;  1YJN A;  2UUA Q;  3ULP A;  1B2T A;  2IHF A;  2Z6B A;  1JOQ A;  5IRU A;  2JA6 B;  1GUN A;  1N4J A;  2GTL N;  4A3E G;  1HZ9 A;  4ULL A;  3IA8 A;  1DYQ A;  3OMC A;  4F7X A;  5JEA G;  4A75 A;  1HRJ A;  3S1R B;  1BKB A;  2JA8 B;  3CCV A;  2LS0 1;  3U9P C;  3DLL A;  4JO6 A;  2NN6 H;  3SHL A;  1N36 Q;  1PEE A;  3MG5 A;  2IX1 A;  1G74 A;  3DSZ A;  2PZU A;  1I5F A;  2SDF A;  4A3C G;  1AQB A;  3RE5 A;  2Q8T A;  2F4I A;  1UEA B;  4UY8 C;  1VQL A;  1TW4 A;  1VWQ B;  4LW1 A;  2B3G A;  1K0R A;  3P6C A;  1QVG A;  2FGS A;  2ASB A;  4POF A;  1WJJ A;  4G7Z C;  1LIC A;  3S26 A;  3RN5 A;  3B2J A;  2B2W A;  3BX7 A;  1R4Q B;  3BS1 A;  2MWH A;  1GHJ A;  2K7V A;  2M9V A;  4F8M A;  3ITP A;  5L8O A;  2EYO A;  1VWK B;  2BS5 A;  2FHL A;  1PDQ A;  2RCQ A;  1LLR D;  3LHN A;  1N34 L;  5AJB A;  4EQO A;  1ALB A;  3R8B A;  4A8Z A;  2E8G A;  2NVY H;  3T56 B;  4A3D H;  5IY0 A;  2GA4 B;  5LMU Q;  1K0S A;  1BJ7 A;  2LBV A;  1LIB A;  4GJV A;  5A2Q L;  4GU8 A;  3VPJ E;  2TMP A;  3J81 i;  2OF8 A;  2R7Z H;  4JOI C;  5IGF A;  2B63 G;  1TT2 A;  4H13 C;  4L5Q A;  4DQ3 A;  2OL8 O;  1DZ1 A;  5D47 A;  3FR4 A;  4OGQ C;  4IB8 A;  3I0A A;  3CQR A;  4A1Y A;  4MNO A;  4YY3 Q;  4ALO A;  1PTO D;  2MGS A;  3GTO B;  2RA6 A;  1EOV A;  2EPB A;  1B8A A;  1NR2 A;  1Y0G A;  1PTO B;  2FFK B;  4BBR B;  1BQQ T;  1N33 L;  2H1E A;  5C3E H;  3NQ9 A;  3CC2 A;  3W2D A;  4GLX A;  3AYH B;  1XXG A;  5J22 A;  5C0X J;  4BY7 B;  3FR2 A;  3E0E A;  1VYO A;  3OW2 A;  2MJ8 A;  1YHQ A;  2B2U A;  5C4X B;  1TQO A;  3RLN A;  1