3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
1O78A 2EJFC 1T5EA 4GZYC 3A8KE 3T53B 2A6EC 1LABA 3LNNA 3D4RA 1HPCA 3I72A 3T51B 1GUGA 3VR6A 4OO1H 3A8JE 1DD2A 4IFDH 1GUSA 1IW7D 3M7NA 3CRKC 2A69D 3VR5A 3I73A 1GJXA 4BA2I 4KN4C 1CTMA 2YYZA 1PMRA 3BG3A 1V8QA 2A6HD 2Q8IB 1Z7TA 2IT1A 2AWOA 3PUVA 3PUZA 4H44C 2NN6I 3GD7A 1IYVA 3BDOA 2A68D 1H9KA 4G7ZC 3SDZA 4DK0A 3TZUA 3QG1A 1Q1EA 1VF5C 1H9RA 2BDOA 1HCZA 1HTPA 2V4DA 1VF7A 1K8OA 3H94A 1SMYC 3DXJC 2O5JC 3QJYA 4IQZA 2R6GA 2EDGA 5JEAH 3I4LA 2K7VA 4KI0A 4OGQC 1CFMA 2KA7A 5K36G 4LK1C 1Y8NB 1OXTA 2A6ED 2B8GA 3N6RA 3T56B 3KLRA 2BE5D 4G7OC 2EJMA 3RLFA 3EQLC 3NE5B 3OPOA 3GQBA 1GHJA 3OOCA 1FYCA 2K32A 2F1MA 1H9MA 1E2WA 1HQMC 3A7LA 4BA1I 2JXMB 1YNJC 4DK1A 4OO1G 4IFDG 2BA0A 1Y8OB 3AB9A 1OXXK 3M4YA 4JK1C 3OW7A 4PV1C 3U9SA 1Y8PB 1Q90A 4JBWA 1DXMA 2D5DA 3A7AB 5C0XG 2NN6H 5A35A 5KNBA 1QJOA 3PV0A 2O5IC 1I6VC 1OXUA 1YNNC 2PNRC 4H0LC 4TQUS 1VCIA 1O7LA 3VR4A 3MXUA 4TKOB 4KMUC 3WDNA 5JEAG 1GUTA 2D2CC 1GUOA 1ZYRC 2AUJD 2L5TA 2LMCB 4HR7B 3CRLC 1IYUA 3IFTA 3M85A 1B9MA 1DCZA 1H9SA 1CI3M 1ZKOA 3FMCA 3LWUA 4XIGS 3VR2A 3VR3A 5KNDA 4KHZA 5BN5A 5BN4A 2E76C 2E75C 1GHKA 1LACA 1V43A 2E74C 1H9JA 1OXSC 3P20A 3ND8A 1E2VA 2D62A 3VA7A 2ZT9C 2DNEA 3IKJA 1BDOA 1EWHA 1GUNA 2CW0C 3MFYA 1OXVA 2DN8A 3QIAA 5KNCA 3W3AA 1VDZA 2B8FA 2BE5C 1Q12A 1Z6HA 1K8MA 1IW7C 1TKWB 2A69C 4G7HC 1G291 4DNRB 2AUKA 4L8JA 3HGBA 2QF7A 1Q1BA 2DNCA 1B9NA 2JE6I 3SE0A 3ND9A 2PCFB 1TU2B 5C0XH 2A6HC 2JEAI 5K36H 4LJZC 3FPPA 4KKUA 2JEBI 4H13C 2NN6G 4KKSA 4RCNA 1H9SB 2A68C 2EVBA 1ONLA 1A6XA 2EJGC 3L7ZC 5BN3A 3PUXA 3PUWA 1Y69U 4KKTA 3PUYA 1E2ZA 4DNTB 4I7ZC 4KN7C 3A8IE 4XTCS 2KCCA 3D31A 2PPBC 2K33A 2BA1A 1FR3A
chains in the Genus database with same CATH superfamily
4IPDA 4IOCA 4ORWA 1KT3A 1PZJD 1TXLA 1X56A 3PGZA 1IIUA 3BX7A 4EVOA 5CC4A 2RTEB 4A3LH 1GX9A 1BBXC 4A3FH 1I4UA 4IO9A 4GOPA 1AE3A 1K83B 3NBHA 3I17A 5IGFA 1GKHA 3SOTA 4JI0Q 4UDUC 5COYA 4JOIA 4O3XB 2JA5H 1LICA 2AT5X 1PH6A 2OEOA 2VFBA 3ULJA 1OEJA 1NUCA 2JGSA 2R7DA 4A3JB 1FELA 4RHRA 4DAMA 1LCWA 2K75A 3VYTA 4KHPL 1BSYA 2K7VA 4KI0A 1G91A 2L67A 1HUMA 2WWPA 4DF7A 2A6ED 3FLLA 5IYBH 3AKNA 4ZYSA 3M4QA 1AW7A 4A3DG 5G3LF 1M1KC 3EQLC 3OPOA 4MIUA 3KF6A 4C3JG 3VG6A 5LMNL 1ENFA 3ZJYC 3VDYA 1XYIA 1LYLA 3FKIH 2LKVA 4COTA 5CV9A 5CV6A 5HZ8A 4AIMA 1OSPO 3F2UA 2EY5A 3STBD 5DM63 1Y1WH 1KT4A 1IBKQ 2DJFC 1JWMD 4DAYB 3RN2A 4ORYA 3CQNA 4NP1A 1WI5A 2RCFA 4KTAA 4PV1C 5K5PA 1UYNX 1S5ED 3K57A 1DXMA 3I4MG 2MPMA 1R9TH 3DHQA 2OTLA 3KK7A 1RCVD 3R3OA 1I6VC 2AVIA 1D5MC 1L1OC 5IT9E 2Y32A 2HIVA 2EYFA 2EY6A 3VR4A 2IZEB 2OZQA 3R93A 1WFQA 3CWKA 1QUQB 3D9WA 1JWUD 3NEMA 1B70B 1F9RA 2WB1G 4N9TA 4NDXA 2ZJPA 1PRTB 5EGTA 2MUYA 1TWCB 2F0IA 1HFGA 3LWUA 3X3NA 3OE3A 3P6FA 5BN5A 3J81i 4IALA 5M3MG 4DQ3A 2R93B 3P20A 3BS1A 1VQOA 3OD9A 3RDMA 2PZTA 1EYDA 1CZWA 3H3VI 1AP0A 2Y0SE 2WFWA 1VYGA 1VQEA 4IAWA 4KY6A 1MBYA 1TWFB 3CPWA 4NPSA 3RNUA 1SWKA 3KQ0A 3STKA 4U8UO 4A60A 5IWAL 1SWDA 1H91A 3GTKH 1T5XD 2KTSA 2QF7A 1VMPA 4C3HH 3V05A 3KOJA 1JV4A 1Y9LA 3WJDA 2HZRA 2PCFB 2KBNA 1LTBD 3CCSA 1FJ1E 1Y52X 2GH7A 1Q7YC 1YBYA 3F1ZA 4KKUA 2B2TC 4O3ZA 1PVOA 4GRJA 1EOVA 1EFID 4OWWB 4A3DH 4R9WA 4HJ7A 1YZ6A 1VWLB 5EDCA 3OMGA 3H0GG 1K9MC 1N0SA 3MWYW 2IZHB 3KFHA 2LB6A 2QDLA 5JJKA 3U4ZA 2FT9A 2KJXA 1LABA 1HQRD 4XDXA 5CV7A 3UDIA 1YWBA 3BVMA 2RTJA 4YFPA 1DD2A 4FDBA 3DSZA 1YJNA 3T2WA 3CAMA 5B5FA 1GJXA 1N9MA 4KJOA 3PEDA 1J6QA 1KNAA 3HWDA 2IX0A 3WOVA 3RE6A 1SWTA 3KJOA 3QR8A 3I4MH 1W4TA 3TEHB 4POFA 3QWNA 1QVCA 2F3WA 4JW0A 1VQ5A 2UUAL 2ATWA 2A68D 2K62A 2WR6A 3SDZA 2HCIA 1Q46A 2K03A 2IFBA 1NR2A 3P6DA 4O3YA 3VYRA 3DXJC 3PQIA 4MEEA 4KT5A 2O2LD 2DY8A 1DGSA 3EBEA 3OHXC 3HFZB 1LT5D 4CKEA 3I4NB 1CBIA 1EPAA 4GETA 5IT9c 1VQ9A 4O4XA 3FEWX 1VQLA 2IZBA 1EY6A 1SNMA 3N6RA 4LF6L 1RL2A 2ENBA 2R61A 5M3MH 2PMZE 4GLVB 3CMAA 3SLTA 3U4VA 1DJRD 3F6ZB 3KDFA 4ML7B 3WJCA 1FGUA 1FYCA 3NTKA 2L1BA 1F9PA 1DF3A 4MVLA 4DK3C 2AT3X 2BDNA 2J4XA 1HBPA 3BRNA 2E2HH 3TZDA 3J7AV 2OL7A 2RTCB 1XXGA 1A63A 4LUOA 3S16B 2YTXA 2Y3FA 1U0XA 5IWAQ 1VQCA 4IUNA 2IZCB 3B2HA 1AE2A 4OELA 5A35A 5FO7B 3K58A 2OF8A 1QJOA 5IODA 2GC9A 4GN5A 2X4MA 3SK4A 4NXNQ 2RDFA 3H0GH 2CBRA 1YP7A 4Z6JA 4N7CA 2XWJB 2XTIA 2Z9HA 1JOQA 1RSUB 4K5VA 2JN3A 4O4SA 1B4MA 2SNMA 5FLMH 4CDDA 1MHWC 1VQBA 1LDQA 2JA5B 4J8QA 1AZQA 1BSQA 3SZHA 3VR2A 1GT4A 1WBIA 4FNFA 5IRUA 2G78A 1ASYA 1XJVA 4OXPA 3S9WA 4AH6A 1OXSC 3HOUG 5IP9G 3MBTA 4KD3A 3VA7A 5HA1A 3J81E 3GTGH 4INNA 4IPCA 3E9HA 2O62A 5JD2A 2RBMA 2Z1CA 3NADA 3QQ2A 2AKQA 3QIAA 2RCQA 3BZKA 2ICIA 4LF4L 2XKLA 1D3SA 1TKWB 4G7HC 1G291 2CM4A 4TRDA 1QWYA 3PK2A 3IFDA 2DNCA 4GGRA 1VQGA 3GTOH 4QGUA 1U17A 4JGLA 2Q2HA 2UUAQ 2B2VC 5K68A 2AL0X 4IUVA 1SWBA 1EQRA 1D1IA 4ON1A 2YU9H 3S1MB 1A6XA 1SREA 2B29A 3Q8DA 1SXXA 5H9LA 1VQ7A 5L8OA 1X3PA 4KN7C 4MVEA 4WJ3M 5K67A 2F0FA 1R9TB 3M7GA 4JI8L 4LF6Q 2EXDA 3PPTA 4U8UN 4CDEA 3T53B 4ODDA 4HIDA 5IO7A 2OTJA 4XMGA 3OIQA 3K8AA 1VQKA 4O1NA 3PDFA 4WORA 3QOLA 4A3BH 1X3FA 1RXKA 3I73A 3CKIB 1WTHA 1SWFA 1AZPA 3WYQA 4ZGUA 2KVMA 2IY5B 1DZ1A 1KAWA 3NR3A 3BX8A 3KUPA 1MM9A 2C9OA 1PBYA 2JOZA 2YMSA 3PH5A 5NUCA 2VB3X 2L0CA 3MC0B 1VMCA 2UYWA 3JQOA 1V1PB 1X6OA 3QG1A 1SJHD 1K8OA 4BX6A 1PH7A 2PO4A 1FJGQ 2OY5O 4ME5A 1SXWA 2QOMA 3EN2A 1JE5A 2L11A 4L5QA 5D47A 3UI2A 2OVDA 3FA7A 1CT1D 4DR6Q 1SWRA 3UEUA 4HIOA 4HCEA 1WTRA 2B3GA 5I6YA 1W6KA 3TMEA 2NVTH 4GNYA 4QIWE 2EJMA 3HOUH 2NTTA 4NV7A 3TGAA 4LWCA 2UXBL 3IAYA 3HG9A 2QOSC 2JA7G 5L8IA 1PMPA 2I0QA 1H9MA 1IJ8A 2WSJA 1E2WA 4K8IA 3BYYB 4O4OA 3LHNA 4C3JB 3NSWA 1SWJA 3J81c 4KD4A 2RTBB 1HA6A 1HY2A 4RMFA 4I3BA 4JK1C 2NYZD 3M3YB 3GTQH 2NB0A 4JOIC 2CBSA 1O7YA 1PH3A 4QF4A 4A1HA 1ZNDA 3FR5A 4WBKA 4P74A 2IJ0A 2ZXRA 2F73A 3CKGA 1LKEA 1VS0A 3A74A 3VE2A 1JOOA 4C1NI 2NZHA 3I4MB 1QY0A 1HBQA 3ITPA 4Z9CB 4UU3A 3RN5A 2L5TA 4HR7B 4L63B 3H3VC 4QCLA 5L3YA 2R92B 3IFTA 1XPUA 3KFIA 1H9SA 4XIGS 2XIWA 4QZTA 3L3OC 5EAYA 2E76C 5LKEA 4A3EG 2AMMX 2E74C 3FEPA 2WB1B 2NZ1D 4WFVA 3ND8A 4CJ1B 2K01A 3CMPA 1FDQA 3IKJA 4ODGA 4P2CB 4AYBG 2Y3EA 5CV5A 1WTQA 3EW1A 1D7QA 1XCAA 2HKDA 1IFCA 3JS1A 4RHSA 5KEEA 1JT8A 4B3ML 5I2XA 4XQJA 4QL5A 3T16A 4NMZA 1FEMA 1EU4A 4JCVE 3JC66 1J5EQ 1SRJA 2AH7X 1A18A 3FPPA 4LUVA 4DV4L 5GROA 4BY7G 4KKSA 4LMQD 2E2HB 1LNMA 5DAUA 1EWIA 3M4OH 2MWHA 4OMWA 4NYQA 4AZNA 5GAHC 1GT1A 2CKZB 1BF4A 2JU7A 2QDBA 1PRTD 4Y59A 5FLXE 1BO0A 2PNHA 2HT1A 1BWYA 1CHPD 2KEEA 3FPUB 1NSNS 2ZTEA 4L5TA 4BBRG 1S72A 3HKZB 1Y55X 5LHY1 2M9VA 2UXBQ 3G4SA 1B8EA 2BC3A 1NTGA 2F09A 4JI3Q 3EM0A 5EEEA 2LBAA 4DCBA 5H8TA 1TS2A 1LELA 5C6AA 3K5NA 2BS6A 3BG3A 2GTLM 2N93A 1I4HA 2FRSA 3UEVA 4RG1A 5HURA 1FD7D 1G8ZD 2BDOA 4K5XA 1HTPA 1XNRL 3G48A 4K0KL 2O5JC 4MVKA 2EQSA 4PSQA 1BCPB 2BSZA 1BUVT 5EQ0A 4OGQC 1WD0A 1TY2A 2FMCA 1BNZA 3MXPA 1DYQA 5K36G 1CHQD 1SWGA 3RKGA 1A2TA 4A76A 1X9NA 2X8FA 2OQKA 1R4PB 3C1EA 5AQ6A 1CQVA 1JQPA 1QWDA 1K8GA 1HMTA 5I2YA 2K6AA 3FDTA 4IUQA 4PMCA 5IYCG 1RBPA 2Q8RE 4TKHA 4C3IB 2JXMB 3P6EA 1M4VA 2F0MA 2MO1A 5GADC 1JZUA 4MVIA 4O42A 1E5PA 4YWLA 1ZEQX 4JI4L 3S2DB 1OXXK 2ALLX 2R7ZG 1HMSA 4JV5L 2AQ1B 2F0QA 1U4RA 3A56A 3WVMA 2ZAIA 1U4LA 4K19A 5EKKA 1CKOA 2KUMA 2NZOA 2IZGB 4ZH9A 1CA6A 2HIXA 4B3RQ 3PV0A 1OBPA 1WCMB 1OXUA 1YNNC 1QVFA 3RY1A 3UEXA 4IABA 2HHHL 1SRFA 4ZCKA 4KMUC 5CMDA 5ELOA 5C3WA 1ERBA 1KRTA 1TWAB 1BSOA 4GNXC 4A3KG 1DCZA 1IW2A 1X8NA 4OO1I 2N49A 1RTOA 5FLXc 3B2IA 2OL6O 1I4RA 5HCCC 4X62Q 4EQNA 1I4PA 3S1NH 4OKAA 3SEBA 2VL6A 4PZ6A 3U58A 4JC0A 3S17B 3U0DA 2K5DA 1N34Q 2B2UA 1KL5A 4L5RC 2CM9A 4ALOA 2KCTA 3BU2A 3HOUB 4O0AA 5CE4A 4JYAL 4K5WA 3SXHA 2A69C 2KEDA 2B2TA 4DNRB 1SWNA 1UYOX 2OYBO 2ICEC 3OWFA 2RCTA 4JI1L 1SMXA 2OVEA 3BZDB 1M8AA 1TOUA 4OX9Q 3TRZA 1HNWQ 1X54A 4F8MA 1NE3A 5K36H 1B4OA 3NX1A 4DUZL 4CSBA 3CXCA 3NENA 2A2UA 4GZVA 1IKLA 3L7ZC 1HMRA 4DV3L 3CHBD 4DV7Q 1JB7A 4BOEA 1PBOA 5BVTA 1XTDA 1L0XB 2BA1A 2A5HA 3PSIA 4XYOA 2WAQE 5IYCH 3CQZH 3DMUA 4Y0QA 4DR4Q 3I55A 4FBVA 1VQAA 3MXNB 4HFOA 2NNQA 4Y5DA 3K6OA 4Z2PA 4RGMA 1EY0A 2ZJRA 4GOPB 1A8VA 1HUNA 2POAA 1PH9A 1VWOB 3ERQA 2R74A 5LMUL 4NXML 3DWPA 4JI4Q 1EEID 3OTOQ 5ISRA 2LXKA 2BHVA 1SAPA 2F0HA 1STGA 4DK0A 2N55A 5JOBA 3TZUA 1XPRA 4B9WA 2JA8H 1B56A 2OCEA 3D96A 1D1KA 1YEZA 5KYIA 1ALBA 4O49A 5EKIA 2NNDA 2CH4W 5EPQA 5GQOA 5B10O 1BBWA 1EYGA 5C5MA 1CFMA 4Y0RA 4A3KH 2F0JA 1SSOA 2JJQA 4MN3A 1VWDB 4BQUA 3KF8A 2QKIC 3MTSA 4RGTA 1H95A 3FA6A 3HWFA 4HJ5A 4YHHL 2X6GA 2F3IA 3AU7A 2UU9L 1GHJA 1IHZA 4CDEC 3S2HH 4FF1A 2QO5A 1EOTA 4ILWA 2G7BA 2K32A 1EIYB 3K5LA 4X3SA 3CBSA 3M4OB 4BA1I 3H6MA 1KQXA 3HOLA 3RZOH 5F2DA 3HOZB 1ESRA 4HMIA 2JA7B 1Y8OB 4JI2Q 1J8IA 1B53A 2X32A 2H1EA 2RSOA 2RTNB 1SMYD 1BOSA 2V1CC 4EXZA 3BDRA 4PQXA 4TJZA 4YKOA 5M5WB 2O5IC 5I4DA 3MA2B 2NWGA 1UZ2X 3O19A 5HCDC 2HUGA 5E1FA 1EEFD 2PNRC 4DUYQ 2F0DA 5AJCA 1TWGH 3W5OA 3C76X 3JSQA 1NJIC 4X3TA 2ZXOA 4NW4A 2Z0SA 5HWZA 1MIUA 1YHQA 2RKSA 3M85A 1KC8C 1KLUD 4ZK9B 1QY1A 1CI3M 4JI5Q 3B2JA 1I50H 3GDEA 2EYPA 2CQAA 2EY1A 4KHZA 3V2TA 4HAEA 1AQBA 1XNQL 1BBPA 5CV4A 1V1OA 4L1NA 5AJBA 3TGBA 2RN4A 4LQZA 4N7DA 2KECA 5DLQE 2A73B 2PYKA 4A4IA 1EWHA 1KNEA 3MFYA 1N7YA 3NELA 4A3EB 3EFXD 4KJNA 2B2VA 1WTWA 2ACOA 4TQ2A 4ZGFA 2NVXB 5C4JH 3L2PA 4YFRA 2WACA 5AFWA 1HNXL 1FTPA 4M6SA 1VQPA 5IGGA 1KT5A 5CGKA 3RZDH 4AYBB 1EIFA 3S5XA 1ML0D 1FNWA 2JEAI 4O4UA 2WAQG 4IOAA 3PH6A 2I5VO 2N8NA 1BEBA 4OHJA 3EIVA 1Y69U 1E2ZA 5EDBA 1ENAA 1GKAA 4EQ5A 4BY7B 1JJ2A 3KYHC 2ZTDA 2F0OA 2RTFB 2Q39A 4Y0SA 3D4RA 5CBAE 3I72A 2HYSA 4TNNA 3B6YA 3A8JE 3TREA 1IKEA 2ES2A 4DR1L 1GUSA 4EX5A 3E9IA 5J22A 1EUOA 1Y1WG 2OFMX 4BBRB 3I56A 2AF5A 3HP3A 3WZQA 1ZNEA 1VWQB 2F52A 1KTKA 1WJJA 1NP4A 2A6HD 2EXZA 3ZW1A 4DKAC 4FBOA 1KGLA 1Z47A 1SNQA 1FGBD 1YHAA 4EFGA 1C4QA 4BBSB 1H9KA 5IP7G 3RE5A 3AQQA 2V4DA 4IAXA 1N36L 4JO6A 3LX0A 5HBSA 2G79A 2QM9A 2CWPA 2R6GA 2EDGA 3G6JB 2Q2TA 4YH0A 1R4QB 2UXCQ 2A74C 3BYTB 3S1QB 2XNAC 3UDFA 4JNJA 2I5ZO 5EEDA 3UE0A 3FENA 5H9NA 1V1QA 2JYOA 4LUZA 3T1YL 2XGTA 2MM3A 5IRWA 1IBML 3OOCA 3ZW0B 4MISA 3V8UA 4U673 4B3TL 3X00A 4AW8A 4Z2VA 5FOBB 3A7LA 3BDCA 1XMOQ 3VYSA 1SWQA 4NLIA 5D65A 2L12A 3A5UA 2RTAA 2DUDA 4IFDG 1YP6A 1ICMA 3NUCA 3GV3A 4OONA 1WVLA 3U9SA 3SR1A 2VB2X 2A1AA 4C3HG 3J80L 4LF7Q 1SA8A 3KFGA 5B2AO 2GN5A 2D5DA 3GO5A 3RSWA 4IMOA 4YCUA 1Q8KA 4LFBL 3CC2A 1A0IA 3IL8A 2R7ZB 1MDCA 4PG3A 1BCPD 2BOSA 2C1SA 1YWDA 3OWEB 4Y52H 3CQRA 2CAMA 2B2WC 2F0NA 2Q2UA 1W5RA 3STNA 4G4KA 4DU9A 1OO9B 1SWAA 5FFHA 4FO2A 5LJBA 1IYUA 4X66L 4AQYL 4YFQA 4HMJA 4FXKC 4EEJA 4C5PA 1T9HA 1E06A 4B55A 4A3KB 1KQWA 1PH2A 4OEMA 2MP1A 2DNEA 1SXUA 4OS3A 2CW0C 4H7BA 2AQ2B 1OXVA 3K59A 3U9OA 2QCBA 1IW7C 5IP7H 2ZTCA 3CD6A 1MOYA 1VQHA 4L8JA 4NW2A 2PQAB 4HPBA 1E1OA 1O1VA 3GTJH 1NBWA 3PQUA 5C0XH 4M7MA 3VHIA 1N32L 3HWEA 3S15H 1RJTA 2NN6G 4RCNA 1G74A 4ZHFA 5HZ5A 4A3GB 2KENA 4B3SL 2EYOA 1RD9D 4DV2L 1P6PA 1STEA 5HGTA 1DZMA 1L6MA 3EW2A 3DM1A 2WINB 4A3MG 1K24A 1X65A 2EJFC 2E8GA 1F77A 3VG5A 1KZXA 1ET6A 3A55A 4C2MB 2R7FA 4O2DA 1S2PA 3FR2A 1TWGB 4IFDH 1EIHA 2OY1O 2E2DC 2MGSA 4B3TQ 3HOVG 2X34A 3VR5A 5J3BA 4DNEA 3U03A 1HQPA 3KVNA 4YCEA 2NVQH 2B2UC 3RDQA 1I50B 1TWHB 1SRUA 2E2JH 3NK9A 1VWIB 3S14H 1X3EA 4BXXG 2MO5A 1MJCA 4G7ZC 1RXJA 4NNSA 1A15A 1NDJA 1VWJB 4KHPQ 5LJEA 2HDLA 1JICA 3OJYC 3T6LA 3CCRA 3FR4A 4CV7A 3QJYA 4DR2L 1MX8A 5LKFA 3EA6A 3DUZA 1VQ6A 5FLMG 2SNSA 2YTVA 4CHTB 2RHSB 2B2YA 5C4JB 1OXTA 1EALA 4YGHA 2F01A 1E00A 3DTQA 3S60A 2IZAA 2P5ZX 1B3AA 1SE2A 5LMNQ 3PIPA 2H5XA 4AQYQ 3GTLB 2RQ0A 4QNIA 3PIOA 1N9WA 4DV6L 2P8GA 3KJPA 4DR3L 3X3MA 2RA6A 4DNIA 4ORXA 4KY7A 5HTDA 1SE3A 4GH7A 4QB4A 4GLXA 1F2YA 1VWBB 2BLGA 1SWSA 2FWVA 3RMHA 3TGCA 1Y1VB 5M3FB 1JYJA 4R0BA 4ARHA 3D0FA 4A3CG 4ORRA 2KHJA 3HOXB 2NN6H 1GM6A 1JJUA 4ORSA 4GKJL 2L5PA 4OMXA 1AFPA 4GNXA 1OBUA 1SYFA 1YNXA 2A8VA 1N32Q 2K5QA 4MHEA 4R8IA 1PTOB 3L4RA 1KOIA 3VG3A 4A3MH 5JEAG 2VNUD 1TIID 3SK8A 4DV2Q 2ID0A 1X55A 1VWNB 1L2FA 1ZNGA 1YNJD 1A3UA 1WD1A 3HOVH 1SLDB 1GHKA 2VUMH 4HJ8A 4A3BG 4F7XA 1NCVA 3OSOA 3OYYA 1LT4D 5EZ2A 2FJ2A 1LF7A 5K06A 4DV1L 4BXXH 2OF1A 4DGZA 3J7AF 3T1HL 3TBIB 3FIQA 1HNZL 1N9YA 3APWA 4IMNA 3W1GA 4A3FB 4QGWA 1X32A 4EGVA 1U18A 4DV0L 5IGCA 3SE0A 1SWPA 3IA8A 5F1EA 1TU2B 4DQ4A 4ULLA 2ALYB 3MXGA 4TLJA 2RTMA 2QCPX 2FTBA 5JVH3 3WJEA 2MHVA 3PMFA 3ERSX 1ONLA 2Y0SG 4Z2OA 2KD2A 1S5FD 3NQIA 3EYCA 1QB5D 4CKCA 3A8IE 2KCCA 1A3VA 3D31A 2WAQB 3HS0C 1W6JA 1T5EA 5FO9B 3A8KE 3FELA 4CGYB 2A6EC 1S40A 3ZW2A 3SAOA 1HPCA 2PW7A 4PZ8A 1BCPC 1HZ9A 1EPBA 3DEPA 5C3EG 3M7NA 4U8UM 3PQSA 4LW1A 2Q2PA 3PP6A 3GP7A 5CR3A 4DR3Q 2UXDL 4NLJA 2LKKA 4QZUA 3FKIB 5B11O 1ENCA 3MX7A 4YDAA 3FP9A 2IW3A 4A3CH 1KL9A 1Z7TA 2VY3A 2XRQD 5IOCA 2AWOA 1ML7A 3PIP3 3NXWA 3F9DA 4TKJA 1MGSA 1Y1WB 3BDOA 4QGVA 4EQPA 3STBC 1BVSA 3RD4A 1DZPA 4DAYA 5AEOA 3PIO3 2FS7A 2FS6A 5D8JA 1YIJA 1ICNA 3O2YA 2I46A 4ZCBA 1DM0B 3ZZVA 5JEAH 2M4LA 1EFWA 4LK1C 1Y9TA 2RTLA 1IKJA 4EDEA 2LS01 4R4IA 1BRPA 1HJPA 3L9AX 1STNA 3CCQA 1QUQA 1S5BD 1AVEA 1EQVA 3AEVA 3S15B 1SXTA 2RVLA 2D9UA 1TOWA 4F88A 4BVMA 1FNUA 3WJBA 1VQ8A 1LO5D 5C3XA 4BGFA 1JC7A 5B3MO 3MFGA 1M90C 3D6CA 2RTDB 1S5DD 4MZ9A 2A13A 4I95A 5EJWA 4A93H 3ZWEA 4DFAA 1CBQA 1E02A 1CKNB 5BR8L 3T1HQ 1L1OB 2JQOA 4A3IG 2WQ9A 2AHOB 1WOCA 5LJGA 1EXSA 3WZOA 1MK5A 1MSGA 1ZXTA 4ZRZA 1EU3A 1BRQA 1QABE 4GJVA 4YBPA 5IY0A 3CMEA 3GTKB 4TQUS 2E2IH 4HCSA 5C44G 4C3HB 1VCIA 4CPHB 2N78A 1E24A 1OBQA 4GNWA 4TKOB 5ELBA 1S5CD 2GTLO 5D14A 2AKWB 1LIFA 3S14B 1GUTA 2AUJD 4C1NK 3M9BA 2AQ3B 4I6SA 4P72A 4A3DB 1B9MA 1SNCA 4OS8A 2K1BA 5HGQA 1HHVA 3CCMA 3PO2G 1DF8A 5C3EH 4FGIB 3N91A 1SYDA 2ASNX 3P75A 1WTVA 1QE6A 1TR5A 3L0OA 2Z8LA 1PH1A 2ZT9C 3LV4A 2K5HA 4LF4Q 2HZQA 1G2TA 3SGIA 3TQYA 2JA9A 4DPGA 3EBWA 1GM5A 1DONA 3WOFA 1B9NA 1LTGD 2ANSA 1ZYRD 2N3SA 4DN4M 3Q0AA 4R4QA 2WP8J 3NBIA 3T2XA 5C4HA 2A68C 3VHHA 3K0YA 4JI8Q 1EWCA 1B44D 1II3A 4YCVA 2OVAA 1RXHA 3BU9A 1RIPA 1GO3E 1L0WA 1PZID 5C5LA 1TS5A 2WKCA 5M3MB 5BYPA 4IB6A 4ID6A 3J81j 3E3XA 3CRKC 3GTMH 3W2DA 1MI2A 3TZSA 4BA2I 2HQLA 2IHFA 3H3VH 1D8LA 1C8CA 4UPAA 1LTRD 4A3IH 1PH5A 3SLJA 2BH8A 1SNPA 1E1TA 1IL2A 1PHJA 4JHQA 2F0LA 1SFOH 1STBA 3T6FA 3ZQ3A 4CPFA 2SDFA 4UP8A 5C44H 3AMUA 2BS5A 3DM3A 4GGZA 1Q1EA 1VWHB 4ZJ0A 1GT3A 2K23A 4FYDA 3O13A 1PV4A 2A3FX 3I4LA 2MF6A 3PECA 2WKDA 2KA7A 3PO3H 3H0GB 3PO2H 1SY0A 3AFQA 2K28A 3URYA 3OW2A 3KLRA 3CF5A 1SLFB 4NKLA 1C0AA 1JIWI 2ZAGA 1LV9A 5I9OA 2KTDA 3NQKA 1BXTA 4HWMA 3HWGA 2UUCL 2RTGB 1QNUA 1LIEA 2RTIB 4HIMA 4A8ZA 2IZIA 2SEBD 1MUPA 4YGZA 3J80E 1YI2A 1SNOA 4XQNA 3WJGA 1SWHA 3GTGB 4YKMA 4YCHA 3KFFA 3E0JA 1NQNA 2ZXPA 5D48A 2RF4A 5D4AA 1VWPB 1JJXA 1O7IA 2B2WA 2IZFB 1I4XA 4ZUJA 5M5XH 3Q22A 4WJWA 4BX7B 4GDAA 5EBDA 3Q24A 2VS1A 3GTOB 4LFAL 2IZJA 1E2TA 1KXOA 5KICA 3NBXX 2B2YC 4YY3L 1NBXA 2Q4NA 4J15A 3GV6A 4GN4B 2UUBL 2XSCA 2YU9B 1GUWA 4LKPA 1U5KA 3UEWA 1ZKOA 1ASZA 4J1MA 2NBFA 1KL3A 4WHIA 2FMMA 4A75A 1XMQL 1OTCA 1JOKA 1GX8A 2RHQB 4JBMA 1SNDA 5L8NA 3CR6A 4K8JA 1HR0W 3P6GA 1I3QH 5GAEC 4B3MQ 5KNCA 4X65L 3F8AA 2NVYH 3ULLA 2PW5A 1EW3A 4RWSC 2RA4A 3JAML 3CCJA 4A3BB 1E0BA 3DWQA 1SRIA 4BX5B 1D2BA 4WJ4A 1UNSA 1Q1BA 2JA8G 1OEKA 4DV4Q 2X8SA 4FXDA 2L15A 2FGSA 2EOTA 3RWXA 2EY2A 2CQOA 1XPOA 1EIOA 2EVBA 1V1PA 1I4QA 1PTOD 2RD7C 3ZUIA 3D3RA 1F2MA 1QQSA 1MSHA 2L9HA 3WXQA 1SWOA 1TS3A 2Y0SB 2M2LA 1LUQA 2RTOB 5HA0A 2KHIA 1SE4A 4UY8C 2E2IB 3MVFA 3TP6A 4ZHDA 1CBSA 1QFVA 1B8AA 5EBCA 4GKCA 1G51A 2NVTB 3RR5A 2X6LA 2IWHA 1D2UA 2VQFL 3H91A 1W6FA 2IZLB 1IYJB 2ZM6L 4LZVA 3F8TA 4IPHA 1SLJA 3J80c 2Q8IB 3SK5A 2IT1A 4YWKA 1XNRQ 5CHKA 4K0KQ 2A5CA 2HD3A 1LM0A 4N8X1 1VF5C 1H9RA 4CJ0B 4UP7A 3RBYA 4HSVA 3GTQB 3Q6SA 4IQZA 2L55A 3K5OA 1QZHA 3FW4A 5F6BA 3K0XA 1AELA 1EY5A 4GGTA 3NP8A 3MHBA 1WYDA 4QJFA 5FKAC 2VQEL 1PH4A 3TSSA 4G7OC 4RUUA 4DR7L 1N43A 2I07B 3CC7A 4YMYA 1STSB 2XWBB 2R93G 1VQMA 3NBHB 1K83H 1ZNLA 4KCAA 4F87A 1I5FA 4HPCA 1HR0L 4JV5Q 2PZUA 4KC8A 1STHA 1LCVA 3FRPB 5EPJA 5JVG3 3S1RH 3QO2A 4A3JH 1VWCB 2JMBA 1SWEA 4R4TA 4GUZA 1Z9FA 4I9RA 4YVBA 3GTMB 1PTSA 2HHHQ 5D45A 1KT6A 4FXGC 1PRTF 2PMZB 2X69A 4IUPA 3RDOA 5LJKA 4A3IB 1O7LA 3VGWA 2MQHA 3KF6B 1PZKD 4RH6A 3C1FA 4M1UB 2ZJQA 1KL4A 3NWTA 1SE8A 1LPJA 2RTKA 5C44B 2CZUA 1SYEA 3FMCA 1KLGD 3FA9A 3NPOA 5ELFA 4PJ2A 3HOWG 1G5WA 2K50A 3K5MA 1Q86C 1SRHA 1JCKB 2XVSA 1PRTC 5G3LD 2OFBA 4HEDA 2KQ3A 2MJIA 2X8TA 4DA2A 4IURA 4JYAQ 3ULPA 5JJZA 4EKVA 2ZM6Q 2JW1A 3MEFA 5IO5A 4JI1Q 1YVCA 1K8MA 1VWEB 1VQFA 4S3SA 1SYBA 1GXAA 2IL8A 4Z27A 1ZNHA 1EQTA 1SN8A 4UHVA 3EMMA 4DUZQ 4HPAA 4Y0PA 3KLSX 2D0OA 1CSPA 5FO8B 4IB8A 3EC5A 2ZSCA 1N8RC 4BJ8A 3MM0A 3OIPA 4DV3Q 1STYA 3Q23A 1IZ6A 3B2LA 1TWCH 1GD7A 2WPUA 4ID2A 5JAVA 1VWAB 2CHBD 1SLEB 3AYHB 2GTFX 4APVA 4CBVA 4Q5VA 3C78X 2ASBA 3PCOB 2QGQA 2R93H 1P8LA 3HK1A 1CM9A 4P75A 1ESFA 5ELEA 2L68A 3WBGA 2VQEQ 1ZRYA 1DZKA 4XMEA 4I7AA 3F2CA 3T51B 3VR6A 1C9OA 1ICWA 4CPIA 5FENA 1IFBA 4QAEA 1TWFH 1SR3A 1MKHA 4L6TB 3D4WA 3I8ZA 5LMUQ 4IB7A 4NXMQ 3TDQA 3LGJA 4Q0FA 2F0PA 1C7YA 4QGXA 2DJGA 3ELXA 1QG7A 4QRLA 2LA7A 3PUZA 2K5VA 1QY2A 4V0BA 2HLVA 2A19A 3GD7A 2WEWA 4PMWA 4JI0L 3NPPA 1HCZA 3P6HA 2JA6G 1HZCA 5E4WC 5EPLA 2NVYB 2AMCB 2RDGA 2MJ8A 3B2KA 1P16A 2W2AA 1LUZA 4YHHQ 1E22A 2WV6D 3WJFA 2Z4IA 2R73A 5J1ZA 3HOWH 2B8GA 4WRDA 2UU9Q 1L0YB 1CBRA 1EZ8A 3D8GA 1IL8A 3DLLA 5LL6X 2IX1A 5BVSA 4AYHA 1PTOC 1T0VA 1I6HH 2C5CA 4OO1G 5IGEA 4JBJA 2HNXA 5DG4A 2LSSA 1ILPA 2PI3O 3S1NB 2L4NA 4KC7A 3T13A 1N33L 1KHIA 4JBWA 4RKLA 1IBKL 2BH2A 1BM5A 2DM5A 5B27A 4OS0A 1GVPA 1CA5A 5C0XG 1YUPA 4FVMA 1CQFA 1CKMA 4IUUA 4QIWB 1LIBA 3AKMA 1JMZA 3ONAB 4B9XA 1LTID 3I3CA 1K8AC 1I05A 3KDFB 3WDNA 2OY8A 1LTTD 2JP1A 2KCNA 2O4XA 3UDGA 3C77X 4GK9A 1XNQQ 2DGYA 1RF2D 2Q8TA 5KNDA 1U4MA 1YWAA 5BN4A 2AT8X 1JWSD 1VQDA 1I04A 3EVQA 1G85A 2NTSA 1DV9A 1PFMA 2F0EA 4D6BA 1KAAA 3CQZB 1YITA 4JI6L 2JU3A 1HXZA 3S16H 4NP5A 1HNXQ 3HKZE 3OMCA 2OXPA 3R8BA 3MXNA 4OELB 5M5YH 1VYOA 5FLXL 3U9PC 1Z6HA 4BBOA 4MNOA 4QUCA 4LAAA 4FQBB 1X8UA 3AUMO 2JA6H 3VE1A 1FL0A 1SEBD 2JEBI 4H13C 1GT5A 2FFKB 1IXRA 1K73C 4JBKA 5HAEA 2JA8B 5BN3A 3S1RB 3FMZA 3CKFA 2MFIA 2PPBC 1S44A 2JN4A 4ALBA 4JVZA 1HZAA 4GZYC 3DEOA 5L37A 4DR1Q 2GVAA 2VXWA 1JMXA 1B7YB 3UDXA 4OO1H 1N4JA 1GOZA 4HIKA 5CORA 1SWUA 3S2HB 1STRB 3F2BA 5LL6S 2YYZA 3J7A5 4WFUA 3RZOB 2K4KA 4NV8A 2FXQA 1UE7A 1KDAA 1VQJA 4H44C 1N36Q 1N33Q 4R1JA 5A2QL 3RDUA 1TVXA 2ACPX 1NMGA 3SVMA 3S1MH 4YIJA 3CP0A 2TSSA 3QOJA 1PYWD 1SMYC 2F3VA 2EYJA 3KZAA 4QQBX 4X3UA 2R92G 1UE5A 1EY9A 3T1YQ 1SROA 4GDZA 1LT3D 2G9HD 1IBMQ 1RHPA 2CVRA 2BE5D 2XN9C 2B39A 2HQEA 5IIFA 3GQBA 2VUMG 2F4VL 2MNAA 1PYBA 5IRAA 4OWXB 3RDXA 1Y14B 4DK1A 5C4ZA 3FIDA 4JI6Q 1ADLA 3FA8A 2KT4B 4KH8A 4B08A 3VPJE 2R56A 4BX6B 1AVDA 4CK4A 4IJLA 1Q90A 3E5SA 1D5XC 4LFBQ 2VFCA 5EPKA 1JQYD 3A7AB 3WZPA 1SYCA 4TSSA 2F03A 1QG5A 4H02A 3J7YW 1PYSB 1PLFA 3RZDB 4YWMA 1LTAD 1CUKA 4NXNL 2VDFA 3UE1A 3VU1A 4X66Q 2NUCA 4O9SA 3D95A 1O8VA 2HCCA 4K2LA 5I6WA 1Q3LA 1UUPA 3RY2A 3I70A 2HMBA 1F2LA 4PNYA 3HKZG 2G5LA 5D3DA 5HY6A 2E75C 4DXGA 2J0TD 1FNVA 4C3JH 4L3RA 5KHPA 1S7DA 3TP8A 3SHLA 4BS9A 3JAME 4BY1G 1I06A 2Q2MA 3NP1A 3NTHA 3HOWB 3LTWA 2PQEA 3M3YH 4HJ9A 5J39A 5KGUA 2GVBA 3IFBA 1VQIA 2I5MX 3IRBA 1U9RA 3CCLA 1NMFA 3OBLA 2YV5A 2KW1A 1Q81C 1KDCA 2CCZA 1I6HB 5B29A 2A6HC 3K7UC 5FK9C 1AH9A 4B3SQ 1KRSA 2LBVA 1H9SB 2R92H 4ZKCB 1X71A 1QVGA 2L9CA 3APVA 4KKTA 1RODA 3ZUOA 4I3DA 1QNKA 1O7ZA 4RA8A 3BZCA 1PH8A 2RTPB 1D6EC 1KFFA 3SK6A 3E6ZX 1HH2P 2OL8O 4ABNA 3Q6LA 3BDLA 3KBXA 5H9AA 3HZXA 3U50C 2GA4B 4C3IG 2F4VQ 2CH4A 2EIFA 3VG2A 3WYPA 1CK1A 1K0RA 3I0AA 2YTYA 4A93G 4GLAC 3ZW0A 1PFNA 2OQ0A 2WIIB 1V8QA 4LNQA 3PUVA 1BCPF 1HRJA 1JYDA 3D4DA 2RSNA 1PFBA 1IYVA 4YDBA 1EY7A 1PDQA 3A54A 4DR2Q 5HCEC 1EY8A 1WCMG 2DY7A 2CFMA 1T68X 1KDBA 3H94A 1D5ZC 4CDFA 1Q82C 1WTXA 1BJ7A 4KV6A 5M5YB 1FJGL 3QB3A 1X8QA 2FKGA 4MIRA 1DC9A 5CYUA 1DZJA 2F0UA 3S24A 2JA6B 4AZMA 1SY2A 5D3IB 1Q8IA 3O22A 5F2BA 4DR6L 2WQAE 5F58A 3RLFA 3NE5B 4DV6Q 2YG2A 3G6EA 4BY1H 3I7FA 2WUTA 3HRZC 3C46A 4OWTB 2EU7X 1Y0GA 3M4PA 2EYHA 4OL7A 4L5SA 4CDCC 4ME3A 3E0EA 2RCNA 2F0TA 3VYUA 5JPNC 3JAMc 2DJGC 3P02A 3C2PA 2NP1A 1JR0D 5H1SE 4DV5L 4GKJQ 2IZKA 1VWFB 1YIVA 4O3WA 3WZNA 3ZI8A 2QA4A 1TXYA 1A57A 3T1DA 1B2TA 1G7NA 2OFRX 4ZFXA 3KBGA 4DR5L 2PQAA 1WUBA 3FYFA 3GTJB 2E4JA 3S26A 3MXUA 1JJJA 4AYBE 1XKIA 2C1QA 1JB3A 5DEHA 4PZ7A 2LFOA 5IO6A 3J80i 2FHTA 1FENA 3VR3A 5GAGC 1ERXA 3MZ5A 1QILA 2EE1A 4M8AA 3K81C 1KZWA 4C3IH 1TQOA 3SZIA 1A3TA 3CW2C 1K3BA 1LACA 2R3ZA 4K6LA 4K6DA 4XMHA 3P24A 4DV1Q 2D62A 3S2DH 1YJWA 1AEXA 2PI2A 1OPAA 5C0NA 1F9QA 3SZJA 4K2KA 3CC4A 1HNZQ 4RKBA 1BDOA 1MEPA 1FVIA 1JBHA 3APXA 3F2DA 3W3AA 2EPBA 4YCWA 5FQ6E 2BE5C 1GXDC 5HTEA 4N9PA 2D0PA 2W2FA 1YNND 4DV0Q 1EUJA 2AUKA 1WCMH 1PEEA 3HGBA 2NVQB 3FDCA 5C0XJ 2K52A 2RQXA 5E4XA 2JE6I 3GTPH 3ND9A 1VQNA 2E2JB 3D97A 4RFBA 4X64L 4NB3A 3ELZA 5HZ6A 1TWAH 1J5EL 3VA5A 1X3QA 1A2UA 2LXJA 3PO3G 1B50A 2EJGC 3EROA 1EQDA 1X8OA 1CSQA 1YJ9A 3BY0A 2E5LL 4QUFA 1FR3A 2QO4A 2HDMA 1JJGA 3I90A 2FR3A 4HN7A 1VWMB 5HZQA 3MG5A 4ZHHA 1C48A 1PXUA 3S17H 4P73A 4IFDJ 2QEJC 4DAVA 2UXDQ 4K14A 1GX3A 1SXYA 3HOZG 5IP9H 2A69D 2VZAA 2AT6X 1VWKB 4YGGA 1DFVA 2B63G 4J6HA 1B3QA 4JI3L 4QYNA 5H9KA 1TT2A 2EYLA 1OEEA 2PY1A 4R4OA 4CKBA 2TMPA 4KK7A 1KD1C 4GD9A 1R0UA 4GOPC 1SDFA 1SYGA 4HTHA 1XWEA 4DV5Q 3PF5A 2FHNX 5E7NA 4AZPA 1RSTB 1HTLD 1HA5A 1NNXA 1ILQA 1QCBD 5ELCA 1MJEA 4DR5Q 4MTKA 4HJAA 1SY3A 4I60A 1F2ZA 2OWOA 3BLGA 4GU8A 3T56B 2RTRB 4ZR2A 4GN3B 3VHMA 5JR8A 2J7ZA 1F9SA 4A3MB 1RLBE 4CJ2C 4LF8L 4XQQA 2GJ5A 3GAQA 3VG4A 1W2BA 5C4XG 2F1MA 3NHHA 2FR2A 2X46A 1HQMC 4LF9L 5JJIA 2JU8A 1BR9A 4XXEA 1X89A 3HOVB 1YNJC 1HFNA 3BU1A 4MTNA 2VUMB 4I3CA 5BR8Q 3BVZA 1LLRD 3K7AH 5FJ8G 1VWRB 1B1ZA 1AB0A 2C4IA 4PMBA 1RKNA 5IXGA 3RZYA 3G71A 3HOYG 1EYCA 2I5LX 1IBLL 2Z6KA 3KF8B 2SOBA 1CRBA 1UE6A 2OVSA 2I5HA 2Q9SA 1PM1X 4B3RL 2QO6A 4X64Q 3NX2A 3MEHA 4LFCL 3PF4A 4RAUC 1BQQT 1EQQA 1W3SA 2IX3A 3BSZE 3CRLC 1K28A 5IT9L 1CJ5A 3DWAA 4TVAB 4TKBA 2Q2IA 3HEJA 3NQ9A 2E5LQ 3BS2A 3A0JA 4XMFA 1JE4A 3HOZH 5ELNA 1H9JA 2B63H 1LDOA 3KLSA 2JA7H 1E2VA 4IPGA 4IN3A 2Z4HA 4ORUA 2PI2E 4X62L 1OPBA 1V9PA 4D6AA 3BVGA 5CSEA 1UWVA 2DN8A 1NP1A 3TN2A 3ZYYX 1VDZA 2RTHB 5M5WH 4GKKL 1Q12A 4U46A 4BY1B 1K0SA 2F0SA 1N34L 1EY4A 1JJCB 4X6AH 4BBSG 4UAIA 3Q34A 2A2GA 1BBUA 2BT9A 3V96A 2QMIA 4XT1B 3RDSA 2RTQB 4P71A 3H09A 4U9CA 4I65A 3CPFA 4LJZC 4Y7NH 4AZOA 2XRSD 1G2SA 5T1IA 4OX9L 3TP7A 2A8GA 4LZUA 1HNWL 3H3IA 1J9OA 3PUXA 3PUWA 1AN8A 3S5VA 1UAPA 5BVQA 3R2TA 3CCVA 5C4XH 4DV7L 1A3YA 1O78A 1KQSA 2LFNA 2AWNA 4HSPA 1STAA 3HKSA 3LNNA 4LF8Q 1BLRA 5FQ7E 4A3EH 2JSOA 4DR4L 1U4PA 4NNTA 2GTLN 5FJ8H 2NVXH 4LF9Q 2FLJA 1LFOA 4ZH6A 4GE1A 5A2QE 1CTMA 1Z24A 1PMRA 2DJFA 4DK6C 5I9PA 3HOYH 1SRGA 4A3JG 3H15A 4GJSA 1G6PA 4A93B 1AVGI 4IBAA 2FHLA 3OTOL 3SLOA 4ZAIA 1RAVA 3FEKA 4X3KA 5JEAJ 1CKNA 2MHDA 1RDPD 1IBLQ 1SBBB 1TY0A 1L1OA 3CCEA 1GKAB 3KFUA 5AJ3L 4BY7H 3WWVA 1X3GA 4WFN3 3I2ZA 4JPBW 1MX7A 2OF9A 1Y8NB 4EQAC 1I94L 4V190 4LFCQ 1XTCD 1I9HA 1LTLA 1KIXA 4N8FA 4CPHA 2G5DA 1A62A 3GTPB 2AT0X 4RGOS 1B0OA 4GS3A 2UUCQ 4OIJA 2NNEA 4BBRH 4UU2A 3EJIA 3HTYA 5IYDG 1U0LA 1EIGA 5C3EB 2QEXA 3ZW1B 4ZUIA 4XMCA 5IGBA 1VWGB 1LTSD 3CU7A 2A5BA 3N52A 4FF4A 4ZKBB 4JG2A 5KIDA 2BA0A 4BBSH 1WTPA 4POGA 4KY5A 3EBKA 3OW7A 5T1GA 4GKKQ 1QFTA 1PA6A 4JI2L 4FF2A 3VG7A 1DOLA 5C0XI 1X8PA 3HPEA 4LFAQ 3RLNA 2RDHA 4H0LC 4CDFC 4YY3Q 3S1QH 2WEXA 4U3QA 4A3GG 2UUBQ 1JORA 4DUYL 3APUA 2IZDB 2IPKD 3FW5A 1TS4A 3R2IA 4YBUA 1GUOA 1ZYRC 2K05A 5KIXA 1YHBA 2F0GA 1XMQQ 5IE8A 2QW7A 4ZLTF 3HOEA 1KT7A 3P7JA 2Z6BA 5F6ZA 5E3FA 4ZHGA 4CDDC 1GGLA 4JI5L 1EYAA 1V43A 2G9DA 3KLWA 4QMGA 4IFDI 2FINB 2N88A 4A1YA 1ACDA 1I4GA 2KOLA 4X65Q 3T4AC 1GUNA 1NR4A 2JK8A 1T8VA 1BKBA 4AZQA 2B8FA 2QILA 4KIIA 3J81L 2R7ZH 1VQ4A 5M9OA 4LF5L 4ZHCA 5LJHA 4JI7L 4OIKA 3NWSA 2CWAA 3RUZA 3J7ZC 1SFOB 5HZ9A 1TW4A 4EQOA 1I78A 1SMPI 3K7AB 4UP9A 1SWCA 1HZBA 5AJ3Q 3AEHA 3TS2A 4HPDA 3PUYA 3K3LA 1WTOA 3P6CA 4I7ZC 4XTCS 2W2BA 1I94Q 3WOEA 3PO3B 1NY4A 4G57A 1SY1A 1ZNKA 1XX8A 3E3CA 4IUTA 4OEMB 4RCOA 5DM73 5IYDH 3PO2B 2CW0D 2VQFQ 1EL0A 1CZGA 1K3BC 1G6ZA 5B5GA 1GUGA 1S4ZA 4BWGB 1IW7D 1QOHA 2K5WA 4KN4C 1MD2D 3FVQA 4U68A 4C56C 5F7GA 1O1UA 5FQ8E 4E6IA 3NQTA 1Y1VG 5M3FG 1HQQA 4KHVA 5DNFA 1FE3A 3TF6A 2NN6I 3HOXG 3MVVA 2B63B 3I4NG 3LWEA 4XMDA 4A3GH 1JMCA 1QZGA 3TP5A 1VF7A 1PFSA 4KLKA 1STPA 3TS0A 5EKLA 3BJUA 5M5XB 1UEAB 4FBRA 4BX7A 4DR7Q 2H4OA 3STMX 4IJHA 3CBCA 5KRUA 2UXCL 4C2MH 4R4CA 3GE2A 3D6WA 5CV8A 1UREA 4Y7NB 2F0VA 1HXLA 3QKGA 5DPQA 2PZWA 5FAZA 1UE1A 5LJCA 2IHEA 1HR0Q 4CDCA 1ET9A 1LIDA 5TSSA 4ES7A 2CZTA 1TWHH 1DOMA 2FKJA 3ER0A 3AFPA 4A3LG 1HXYD 2M00A 5C4XB 1XMOL 5CYBA 3AB9A 4IB9A 3M4YA 4A3FG 4XYQA 3MAQA 2EZVA 1S3OA 1Y8PB 1LT6D 1I3QB 2BCOA 1PTOF 4BCSA 2A0AA 3C3LA 5KNBA 3NQ3A 4LF5Q 2VW9A 4LF7L 2K5NA 4QQ1A 1NGLA 2JA5G 2UZ2A 1E3PA 5LJDA 4ZQ3A 4JI7Q 4BX5A 1NAPA 3I91A 2X56A 3UAQA 1SWLA 3G7LA 4NYRA 1NC9A 3FHWA 3HOYB 1UEBA 2C35B 2D2CC 2LMCB 2OY7A 1ICFB 4FP5D 2OT2A 4IZ8A 3GTLH 1HN2A 4DAPA 1SJED 3P1HA 1RTNA 4R8NA 1EZ6A 5IYBG 3W1BA 1DOKA 1KABA 4XT3B 1TVQA 5JPMC 1VYFA 1EIIA 5JJLA 4DXFA 1VPRA 2X55A 5CBEE 5LMNW 3K80C 1LCZA 2K04A 1YWCA 2G8CO 2WB1E 4AZRA 5IGDA 2KHSA 1Y1VH 5M3FH 1MVGA 2OFAA 3FKIG 2EYMA 2XSTA 1O80A 5KYLA 3HOXH 1IKMA 1K3RA 3I4NH 1E7ZA 2F0KA 3NTIA 3ICEA 3RLOA 2X45A 4GNXB 1EI5A 1A2DA 2K14A 4RGNA 2F0WA 4FF3A 1PTOH 4RUNA 2Z6KC 1KXLA 4Z28A 2LY7A 3G7XA 4QY7A 3A5ZB 1SLGB 2MO0A 4LKTA 1NQMA 3JAMi 3I4OA 4ALPA 1Y53X 5ELDA 4QYPA 4DNTB 2F4IA 3CCUA 4IRWA 4CPEA 2K33A 2KCMA 4I9SA
chains in the Genus database with same CATH topology
4ORWA 1KT3A 1PZJD 1TXLA 1IIUA 3BX7A 4EVOA 5CC4A 1GX9A 1BBXC 1I4UA 1K83B 3NBHA 3I17A 5IGFA 3SOTA 4UDUC 5COYA 4O3XB 1LICA 2AT5X 2OEOA 1OEJA 1NUCA 4A3JB 1FELA 4RHRA 3VYTA 1BSYA 2K7VA 4KI0A 1G91A 2L67A 1HUMA 2WWPA 4DF7A 2A6ED 3FLLA 3AKNA 4ZYSA 1AW7A 5G3LF 3EQLC 3OPOA 4MIUA 4C3JG 3VG6A 1ENFA 1XYIA 4COTA 2LKVA 5CV9A 5CV6A 5HZ8A 3F2UA 2EY5A 5DM63 1KT4A 1JWMD 4ORYA 3CQNA 4NP1A 4KTAA 5K5PA 4PV1C 1S5ED 3K57A 1DXMA 2MPMA 3DHQA 3KK7A 1RCVD 3R3OA 1I6VC 1D5MC 5IT9E 2EYFA 2EY6A 3VR4A 2OZQA 3R93A 3CWKA 1JWUD 1F9RA 4N9TA 4NDXA 1PRTB 5EGTA 2MUYA 1TWCB 2F0IA 1HFGA 3LWUA 3X3NA 3OE3A 3P6FA 5BN5A 4IALA 4DQ3A 2R93B 3P20A 3BS1A 3OD9A 2PZTA 1EYDA 1CZWA 1AP0A 1VYGA 4IAWA 4KY6A 1MBYA 1TWFB 3STKA 3KQ0A 4A60A 4U8UO 1H91A 1T5XD 2KTSA 2QF7A 1VMPA 3V05A 1JV4A 1Y9LA 2HZRA 2PCFB 1LTBD 4KKUA 2B2TC 4O3ZA 4GRJA 1EFID 5EDCA 4R9WA 3OMGA 1N0SA 3MWYW 3KFHA 2LB6A 2FT9A 2KJXA 1LABA 1HQRD 4XDXA 5CV7A 1YWBA 4YFPA 3BVMA 1DD2A 3DSZA 1GJXA 4KJOA 3PEDA 1KNAA 3HWDA 2IX0A 3WOVA 3QWNA 2F3WA 2A68D 2K62A 2WR6A 3SDZA 2HCIA 2K03A 2IFBA 1NR2A 3P6DA 4O3YA 3VYRA 3DXJC 4KT5A 2O2LD 2DY8A 4GETA 3OHXC 1LT5D 4CKEA 3I4NB 1CBIA 1EPAA 4O4XA 3FEWX 1EY6A 1SNMA 3N6RA 2ENBA 2R61A 3WJCA 1DJRD 3F6ZB 4ML7B 1FYCA 3NTKA 2L1BA 1F9PA 1DF3A 4MVLA 2AT3X 2BDNA 2J4XA 1HBPA 3BRNA 3TZDA 3J7AV 1XXGA 3S16B 1U0XA 4IUNA 3B2HA 5A35A 5FO7B 3K58A 1QJOA 5IODA 2GC9A 3SK4A 2RDFA 2CBRA 1YP7A 4N7CA 2XWJB 1JOQA 2JN3A 4K5VA 4O4SA 1B4MA 2SNMA 2JA5B 4J8QA 1AZQA 1BSQA 3VR2A 1GT4A 4FNFA 2G78A 3S9WA 1OXSC 3MBTA 4KD3A 3VA7A 5HA1A 3J81E 4INNA 2O62A 2RBMA 2Z1CA 3NADA 2AKQA 3QIAA 2RCQA 2ICIA 2XKLA 1D3SA 1TKWB 4G7HC 1G291 2CM4A 4TRDA 1QWYA 3IFDA 2DNCA 1U17A 4JGLA 2B2VC 2AL0X 4IUVA 1D1IA 4ON1A 3S1MB 1A6XA 1SXXA 5H9LA 5L8OA 1X3PA 4KN7C 4MVEA 2F0FA 1R9TB 3M7GA 3PPTA 4U8UN 3T53B 4ODDA 5IO7A 4XMGA 3OIQA 4O1NA 4WORA 3QOLA 3I73A 3CKIB 1AZPA 4ZGUA 2KVMA 1DZ1A 3NR3A 3BX8A 3KUPA 2YMSA 2C9OA 3PH5A 2JOZA 5NUCA 2VB3X 2L0CA 3MC0B 1VMCA 3JQOA 1V1PB 3QG1A 1SJHD 1K8OA 2PO4A 4ME5A 1SXWA 2L11A 5D47A 3UI2A 2OVDA 3FA7A 1CT1D 3UEUA 4HCEA 1WTRA 5I6YA 1W6KA 3TMEA 4GNYA 2EJMA 2NTTA 3TGAA 3IAYA 3HG9A 2QOSC 5L8IA 1PMPA 1H9MA 2WSJA 1E2WA 4K8IA 3BYYB 4O4OA 3LHNA 4C3JB 3NSWA 4KD4A 1HA6A 4I3BA 4JK1C 2NYZD 3M3YB 2NB0A 2CBSA 1O7YA 4QF4A 4A1HA 1ZNDA 3FR5A 4WBKA 2IJ0A 2ZXRA 2F73A 1LKEA 3VE2A 1JOOA 4C1NI 3I4MB 1QY0A 1HBQA 3ITPA 4Z9CB 4UU3A 2L5TA 4HR7B 4L63B 3H3VC 4QCLA 2R92B 3IFTA 3KFIA 1H9SA 4XIGS 2XIWA 4QZTA 3L3OC 2E76C 5LKEA 2AMMX 2E74C 3FEPA 2WB1B 2NZ1D 4WFVA 3ND8A 4CJ1B 2K01A 3CMPA 1FDQA 3IKJA 4ODGA 4P2CB 5CV5A 1WTQA 1XCAA 1IFCA 3JS1A 4RHSA 5KEEA 5I2XA 4XQJA 3T16A 4NMZA 1FEMA 1EU4A 2AH7X 1A18A 3FPPA 4KKSA 4LMQD 2E2HB 1LNMA 5DAUA 2MWHA 4OMWA 4NYQA 4AZNA 1GT1A 1BF4A 2JU7A 2QDBA 1PRTD 5FLXE 1BO0A 1BWYA 1CHPD 2KEEA 3FPUB 1NSNS 3HKZB 5LHY1 2M9VA 1B8EA 2F09A 3EM0A 5EEEA 2LBAA 5H8TA 1TS2A 5C6AA 3K5NA 2BS6A 3BG3A 2GTLM 2N93A 1I4HA 2FRSA 3UEVA 5HURA 1FD7D 1G8ZD 2BDOA 4K5XA 1HTPA 2O5JC 4MVKA 4PSQA 1BCPB 1BUVT 5EQ0A 4OGQC 1WD0A 1TY2A 2FMCA 1BNZA 3MXPA 1DYQA 5K36G 1CHQD 3RKGA 1A2TA 2X8FA 1R4PB 3C1EA 5AQ6A 1CQVA 1QWDA 1HMTA 5I2YA 2K6AA 3FDTA 4IUQA 4PMCA 1RBPA 2Q8RE 4TKHA 4C3IB 2JXMB 3P6EA 1M4VA 2F0MA 1JZUA 4MVIA 4O42A 1E5PA 1ZEQX 3S2DB 1OXXK 2ALLX 1HMSA 2AQ1B 2F0QA 1U4RA 3A56A 3WVMA 2ZAIA 1U4LA 4K19A 5EKKA 2KUMA 4ZH9A 1CA6A 3PV0A 1OBPA 1WCMB 1OXUA 1YNNC 3UEXA 4IABA 4KMUC 5CMDA 5C3WA 1ERBA 1TWAB 1BSOA 1IW2A 1DCZA 1X8NA 4OO1I 1RTOA 3B2IA 1I4RA 5HCCC 4EQNA 1I4PA 3SEBA 3S17B 3U0DA 2K5DA 2B2UA 2CM9A 4ALOA 3HOUB 5CE4A 4K5WA 3SXHA 2A69C 2KEDA 2B2TA 4DNRB 2ICEC 3OWFA 2RCTA 2OVEA 3BZDB 1M8AA 1TOUA 4F8MA 5K36H 1B4OA 3NX1A 4CSBA 2A2UA 4GZVA 1IKLA 3L7ZC 1HMRA 3CHBD 4BOEA 1PBOA 5BVTA 1L0XB 2BA1A 4XYOA 2A5HA 3DMUA 4Y0QA 4FBVA 4HFOA 2NNQA 3K6OA 4RGMA 1EY0A 1HUNA 2POAA 3ERQA 2R74A 3DWPA 1EEID 5ISRA 2BHVA 1SAPA 2F0HA 1STGA 4DK0A 2N55A 5JOBA 3TZUA 4B9WA 1B56A 3D96A 1D1KA 5KYIA 1ALBA 4O49A 5EKIA 2NNDA 5EPQA 4Y0RA 5C5MA 1CFMA 2F0JA 1SSOA 4BQUA 4MN3A 3KF8A 2QKIC 3MTSA 4RGTA 3FA6A 3HWFA 2X6GA 3AU7A 1GHJA 1IHZA 4FF1A 2QO5A 1EOTA 4ILWA 2G7BA 2K32A 3K5LA 4X3SA 3CBSA 3M4OB 4BA1I 3H6MA 1KQXA 3HOLA 5F2DA 3HOZB 1ESRA 4HMIA 2JA7B 1Y8OB 1J8IA 1B53A 2H1EA 2RSOA 1SMYD 1BOSA 4EXZA 3BDRA 4PQXA 4TJZA 4YKOA 5M5WB 2O5IC 5I4DA 3MA2B 2NWGA 1UZ2X 3O19A 5HCDC 2HUGA 5E1FA 1EEFD 2PNRC 2F0DA 5AJCA 3C76X 3JSQA 4X3TA 2ZXOA 4NW4A 5HWZA 2RKSA 3M85A 1KLUD 4ZK9B 1QY1A 1CI3M 3B2JA 2EYPA 2CQAA 2EY1A 4KHZA 3V2TA 4HAEA 1AQBA 1BBPA 5CV4A 1V1OA 4L1NA 5AJBA 3TGBA 2RN4A 4LQZA 4N7DA 2KECA 2A73B 2PYKA 1EWHA 1KNEA 3MFYA 4A3EB 3EFXD 4KJNA 2B2VA 1WTWA 2ACOA 4TQ2A 4ZGFA 2NVXB 4YFRA 2WACA 5AFWA 1FTPA 4M6SA 5IGGA 1KT5A 5CGKA 4AYBB 3S5XA 1ML0D 1FNWA 2JEAI 4O4UA 3PH6A 1BEBA 4OHJA 1Y69U 1E2ZA 5EDBA 1ENAA 1GKAA 4BY7B 2F0OA 2Q39A 4Y0SA 3D4RA 5CBAE 3I72A 2HYSA 4TNNA 1IKEA 3A8JE 1GUSA 5J22A 1EUOA 2OFMX 4BBRB 3HP3A 1ZNEA 1KTKA 1NP4A 2A6HD 2EXZA 3ZW1A 4FBOA 1KGLA 1Z47A 1SNQA 1FGBD 4EFGA 1C4QA 4BBSB 1H9KA 4IAXA 2V4DA 3LX0A 5HBSA 2G79A 2QM9A 2R6GA 2EDGA 3G6JB 4YH0A 1R4QB 2A74C 3BYTB 3S1QB 2XNAC 5EEDA 3FENA 5H9NA 2JYOA 2MM3A 3OOCA 3ZW0B 4MISA 3V8UA 4U673 4AW8A 5FOBB 3A7LA 3BDCA 3VYSA 4NLIA 5D65A 2L12A 4IFDG 1YP6A 1ICMA 3NUCA 3GV3A 1WVLA 3U9SA 3SR1A 2VB2X 4C3HG 3J80L 1SA8A 3KFGA 2D5DA 3GO5A 3RSWA 4IMOA 1MDCA 2R7ZB 3IL8A 1BCPD 2BOSA 1YWDA 3OWEB 3CQRA 2B2WC 2F0NA 3STNA 4G4KA 4DU9A 1OO9B 5FFHA 4FO2A 5LJBA 1IYUA 4YFQA 4HMJA 4FXKC 4EEJA 1E06A 4A3KB 1KQWA 2MP1A 2DNEA 1SXUA 4OS3A 2CW0C 4H7BA 2AQ2B 1OXVA 3K59A 3U9OA 1IW7C 4NW2A 4L8JA 4HPBA 1O1VA 3PQUA 5C0XH 4M7MA 3HWEA 1RJTA 2NN6G 4RCNA 1G74A 4ZHFA 4A3GB 2EYOA 1RD9D 1P6PA 1STEA 5HGTA 1DZMA 1L6MA 3DM1A 2WINB 2EJFC 1F77A 3VG5A 1KZXA 1ET6A 3A55A 4C2MB 1S2PA 3FR2A 1TWGB 4IFDH 1EIHA 2E2DC 2MGSA 3VR5A 3U03A 1HQPA 4YCEA 2B2UC 1I50B 1TWHB 3NK9A 2MO5A 4G7ZC 4NNSA 1A15A 5LJEA 2HDLA 1JICA 3OJYC 4CV7A 3FR4A 3QJYA 1MX8A 5LKFA 3EA6A 3DUZA 2SNSA 4CHTB 2B2YA 5C4JB 1OXTA 1EALA 4YGHA 1E00A 3DTQA 3S60A 1B3AA 1SE2A 3GTLB 2RQ0A 4QNIA 2P8GA 3X3MA 2RA6A 4ORXA 4KY7A 5HTDA 1SE3A 4GH7A 4QB4A 1F2YA 2BLGA 2FWVA 3RMHA 3TGCA 1Y1VB 5M3FB 1JYJA 4R0BA 4ARHA 4ORRA 3HOXB 2NN6H 1GM6A 4ORSA 2L5PA 4OMXA 1AFPA 1OBUA 1SYFA 3L4RA 2K5QA 4MHEA 4R8IA 1PTOB 1KOIA 3VG3A 5JEAG 2VNUD 1TIID 3SK8A 2ID0A 1ZNGA 1YNJD 1A3UA 1WD1A 1GHKA 4F7XA 1NCVA 3OSOA 1LT4D 5EZ2A 2FJ2A 1LF7A 5K06A 2OF1A 4DGZA 3J7AF 3TBIB 3FIQA 3APWA 4IMNA 4A3FB 4QGWA 1X32A 4EGVA 1U18A 5IGCA 3SE0A 3IA8A 5F1EA 1TU2B 4DQ4A 4ULLA 3MXGA 4TLJA 2QCPX 2FTBA 5JVH3 3WJEA 2MHVA 3PMFA 1ONLA 2KD2A 1S5FD 3NQIA 3EYCA 1QB5D 4CKCA 3A8IE 2KCCA 1A3VA 3D31A 2WAQB 3HS0C 1W6JA 1T5EA 5FO9B 3A8KE 3FELA 4CGYB 2A6EC 3ZW2A 3SAOA 1HPCA 2PW7A 1BCPC 1EPBA 3DEPA 3M7NA 4U8UM 3PQSA 2Q2PA 3PP6A 3GP7A 5CR3A 4NLJA 2LKKA 4QZUA 3FKIB 1ENCA 3MX7A 4YDAA 2IW3A 1Z7TA 2XRQD 5IOCA 1ML7A 2AWOA 3PIP3 3NXWA 3F9DA 4TKJA 1MGSA 1Y1WB 3BDOA 4QGVA 4EQPA 3RD4A 1DZPA 4DAYA 5AEOA 3PIO3 2FS7A 2FS6A 5D8JA 1ICNA 3O2YA 2I46A 4ZCBA 1DM0B 3ZZVA 5JEAH 2M4LA 4LK1C 1Y9TA 1IKJA 4EDEA 2LS01 1BRPA 3L9AX 1STNA 1S5BD 1EQVA 3S15B 1SXTA 2RVLA 2D9UA 1TOWA 4F88A 4BVMA 1FNUA 3WJBA 1LO5D 5C3XA 1JC7A 3MFGA 3D6CA 1S5DD 2A13A 4I95A 5EJWA 3ZWEA 4DFAA 1CBQA 1E02A 2WQ9A 5LJGA 1EXSA 1MSGA 1ZXTA 4ZRZA 1EU3A 1BRQA 1QABE 4YBPA 3GTKB 4TQUS 4HCSA 4C3HB 1VCIA 1OBQA 4GNWA 4TKOB 5ELBA 1S5CD 2GTLO 5D14A 1LIFA 3S14B 1GUTA 2AUJD 4C1NK 4I6SA 2AQ3B 4A3DB 1SNCA 1B9MA 4OS8A 2K1BA 1HHVA 4FGIB 3N91A 1SYDA 2ASNX 3P75A 1WTVA 1QE6A 1TR5A 2Z8LA 2ZT9C 3LV4A 2HZQA 1G2TA 3EBWA 1DONA 3WOFA 1B9NA 1LTGD 2ANSA 1ZYRD 4DN4M 3Q0AA 2WP8J 3NBIA 5C4HA 2A68C 3K0YA 1EWCA 1B44D 1II3A 2OVAA 3BU9A 1PZID 5C5LA 1TS5A 2WKCA 5M3MB 5BYPA 4IB6A 4ID6A 3CRKC 3W2DA 1MI2A 3TZSA 4BA2I 1C8CA 1LTRD 1SNPA 2F0LA 1STBA 3ZQ3A 2SDFA 3AMUA 2BS5A 1Q1EA 4ZJ0A 1GT3A 2K23A 4FYDA 3O13A 2A3FX 3PECA 3I4LA 2WKDA 2KA7A 3H0GB 1SY0A 2K28A 3URYA 3KLRA 4NKLA 1JIWI 2ZAGA 1LV9A 5I9OA 2KTDA 3NQKA 1BXTA 4HWMA 3HWGA 1QNUA 1LIEA 4A8ZA 2SEBD 1MUPA 4YGZA 3J80E 1SNOA 4XQNA 3WJGA 3GTGB 4YKMA 4YCHA 3KFFA 3E0JA 2ZXPA 5D48A 5D4AA 1JJXA 2B2WA 1I4XA 4ZUJA 3Q22A 4WJWA 5EBDA 3Q24A 3GTOB 1KXOA 5KICA 3NBXX 2B2YC 2Q4NA 3GV6A 2XSCA 2YU9B 1GUWA 4LKPA 3UEWA 1ZKOA 4J1MA 2NBFA 4WHIA 2FMMA 1JOKA 1GX8A 1SNDA 5L8NA 3CR6A 4K8JA 3P6GA 1G5WA 5KNCA 3F8AA 2PW5A 1EW3A 4RWSC 2RA4A 3JAML 4A3BB 1E0BA 3DWQA 1D2BA 1UNSA 1Q1BA 1OEKA 2X8SA 4FXDA 2EOTA 3RWXA 2EY2A 1EIOA 2EVBA 1V1PA 1I4QA 1PTOD 2RD7C 3ZUIA 3D3RA 1F2MA 1QQSA 1MSHA 2L9HA 3WXQA 1TS3A 2Y0SB 2M2LA 5HA0A 1SE4A 5HZ5A 2E2IB 3MVFA 3TP6A 4ZHDA 1CBSA 1QFVA 5EBCA 4GKCA 2NVTB 2X6LA 2IWHA 1D2UA 3H91A 4LZVA 2Q8IB 3SK5A 2IT1A 1VF5C 1H9RA 4CJ0B 3RBYA 4HSVA 3GTQB 3Q6SA 4IQZA 2L55A 3K5OA 3FW4A 5F6BA 1AELA 1EY5A 3NP8A 3MHBA 4RUUA 5FKAC 4G7OC 3TSSA 2I07B 4YMYA 2XWBB 1ZNLA 4KCAA 4F87A 4HPCA 2PZUA 4KC8A 1STHA 3FRPB 5EPJA 5JVG3 3QO2A 2JMBA 4I9RA 3GTMB 5D45A 1KT6A 4FXGC 1PRTF 2PMZB 2X69A 4IUPA 5LJKA 4A3IB 1O7LA 1PZKD 4RH6A 3C1FA 4M1UB 3NWTA 1LPJA 5C44B 2CZUA 1SYEA 3FMCA 1KLGD 3FA9A 3NPOA 5ELFA 4PJ2A 3K5MA 1JCKB 2XVSA 1PRTC 5G3LD 4HEDA 2KQ3A 2MJIA 2X8TA 4DA2A 4IURA 5JJZA 2JW1A 5IO5A 1K8MA 4S3SA 1SYBA 1GXAA 2IL8A 1ZNHA 1EQTA 3EMMA 4HPAA 4Y0PA 3KLSX 5FO8B 4IB8A 3OIPA 1STYA 3Q23A 3B2LA 4ID2A 5JAVA 2CHBD 2GTFX 4CBVA 4Q5VA 3C78X 3HK1A 1CM9A 1ESFA 5ELEA 2L68A 3WBGA 3WJDA 1ZRYA 1DZKA 4XMEA 3T51B 3VR6A 1ICWA 5FENA 1IFBA 4QAEA 4L6TB 3D4WA 3I8ZA 4IB7A 3TDQA 4Q0FA 2F0PA 4QGXA 3ELXA 1QG7A 4QRLA 2LA7A 3PUZA 1QY2A 4V0BA 2HLVA 3GD7A 2WEWA 4PMWA 3NPPA 1HCZA 3P6HA 5E4WC 5EPLA 2NVYB 2RDGA 2MJ8A 3B2KA 2W2AA 3WJFA 2WV6D 2Z4IA 2R73A 5J1ZA 2B8GA 4WRDA 1L0YB 1CBRA 1EZ8A 3D8GA 1IL8A 5LL6X 2IX1A 5BVSA 4AYHA 1PTOC 1T0VA 2C5CA 4OO1G 5IGEA 2HNXA 5DG4A 1ILPA 3S1NB 2L4NA 4KC7A 3T13A 4JBWA 4RKLA 1BM5A 2DM5A 5B27A 4OS0A 1CA5A 5C0XG 1YUPA 4FVMA 1CQFA 4IUUA 3AKMA 4QIWB 1LIBA 3ONAB 4B9XA 1LTID 3I3CA 1I05A 3WDNA 1LTTD 2JP1A 2KCNA 2O4XA 3C77X 4GK9A 1RF2D 2Q8TA 5KNDA 1U4MA 1YWAA 5BN4A 2AT8X 1JWSD 1I04A 3EVQA 1G85A 2NTSA 1DV9A 1PFMA 2F0EA 4D6BA 1KAAA 3CQZB 2JU3A 4NP5A 3R8BA 3OMCA 2OXPA 3U9PC 3MXNA 5FLXL 1Z6HA 4QUCA 4LAAA 4FQBB 1X8UA 3VE1A 1SEBD 2JEBI 4H13C 1GT5A 2FFKB 5HAEA 2JA8B 5BN3A 3S1RB 3FMZA 2PPBC 1S44A 4ALBA 4GZYC 3DEOA 2VXWA 4OO1H 1GOZA 5CORA 3S2HB 5LL6S 2YYZA 4WFUA 3RZOB 1KDAA 4H44C 5A2QL 1TVXA 2ACPX 3SVMA 4YIJA 3QOJA 2TSSA 1PYWD 1SMYC 2F3VA 2EYJA 3KZAA 4X3UA 1EY9A 4GDZA 1LT3D 2G9HD 1RHPA 2CVRA 2BE5D 2XN9C 2B39A 2HQEA 5IIFA 3GQBA 4DK1A 5C4ZA 1ADLA 3FA8A 2KT4B 4KH8A 4B08A 3VPJE 2R56A 4CK4A 1Q90A 3E5SA 1D5XC 5EPKA 1JQYD 3A7AB 1SYCA 4TSSA 2F03A 1QG5A 3J7YW 1PLFA 3RZDB 1LTAD 3VU1A 2NUCA 4O9SA 3D95A 1O8VA 5I6WA 2HCCA 4K2LA 1Q3LA 1UUPA 3I70A 2HMBA 1F2LA 4PNYA 5D3DA 2E75C 4DXGA 2J0TD 1FNVA 4L3RA 5KHPA 1S7DA 3TP8A 3SHLA 4BS9A 3JAME 1I06A 2Q2MA 3NP1A 3NTHA 3HOWB 2PQEA 5J39A 5KGUA 3IFBA 1U9RA 3OBLA 2KW1A 1KDCA 1I6HB 5B29A 2A6HC 5FK9C 2LBVA 1H9SB 4ZKCB 1X71A 2L9CA 3APVA 4KKTA 1RODA 3ZUOA 4I3DA 1QNKA 1O7ZA 4RA8A 1D6EC 3SK6A 3E6ZX 4ABNA 3Q6LA 3BDLA 3KBXA 5H9AA 3HZXA 2GA4B 4C3IG 3VG2A 1CK1A 3I0AA 3ZW0A 1PFNA 2WIIB 1V8QA 3PUVA 1BCPF 1HRJA 1JYDA 3D4DA 2RSNA 1PFBA 1IYVA 4YDBA 1EY7A 1PDQA 3A54A 5HCEC 1EY8A 2DY7A 1T68X 1KDBA 3H94A 1D5ZC 1WTXA 1BJ7A 4KV6A 5M5YB 1X8QA 3QB3A 4MIRA 1DC9A 5CYUA 1DZJA 2F0UA 2JA6B 4AZMA 1SY2A 5D3IB 1Q8IA 3O22A 2WQAE 5F58A 3RLFA 3NE5B 2YG2A 2WUTA 3HRZC 3C46A 2EU7X 4OL7A 2EYHA 3P02A 2F0TA 3VYUA 5JPNC 3C2PA 2NP1A 1JR0D 1YIVA 4O3WA 3ZI8A 1A57A 3T1DA 1B2TA 1G7NA 2OFRX 4ZFXA 3KBGA 3FYFA 3GTJB 2E4JA 3S26A 3MXUA 1JJJA 1XKIA 1JB3A 5DEHA 2LFOA 5IO6A 2FHTA 1FENA 3VR3A 1ERXA 3MZ5A 1QILA 2EE1A 4M8AA 1KZWA 1TQOA 1A3TA 1LACA 2R3ZA 4K6LA 4K6DA 4XMHA 3P24A 2D62A 1OPAA 1AEXA 5C0NA 1F9QA 4K2KA 4RKBA 1BDOA 1JBHA 3APXA 3W3AA 2EPBA 5FQ6E 2BE5C 1GXDC 5HTEA 4N9PA 2W2FA 1YNND 2AUKA 1PEEA 3HGBA 2NVQB 5C0XJ 2RQXA 5E4XA 2JE6I 3ND9A 2E2JB 3D97A 4RFBA 3ELZA 5HZ6A 3VA5A 1X3QA 1A2UA 1B50A 2EJGC 3EROA 1EQDA 1X8OA 3BY0A 4QUFA 1FR3A 2QO4A 2HDMA 3I90A 2FR3A 4HN7A 5HZQA 4ZHHA 1C48A 1PXUA 4IFDJ 2QEJC 4DAVA 4K14A 1SXYA 2AT6X 2A69D 4YGGA 1DFVA 4J6HA 4QYNA 5H9KA 1TT2A 2EYLA 1OEEA 2PY1A 4CKBA 2TMPA 4KK7A 1R0UA 1SDFA 1SYGA 4HTHA 1XWEA 4AZPA 1HTLD 1HA5A 1QCBD 1ILQA 5ELCA 1SY3A 1F2ZA 3BLGA 4GU8A 3T56B 4ZR2A 5JR8A 2J7ZA 1F9SA 4A3MB 1RLBE 4CJ2C 2GJ5A 4XQQA 3GAQA 3VG4A 2F1MA 3NHHA 2FR2A 2X46A 1HQMC 2JU8A 1BR9A 4XXEA 1X89A 3HOVB 1YNJC 1HFNA 3BU1A 2VUMB 4I3CA 3BVZA 1LLRD 1B1ZA 1AB0A 4PMBA 1RKNA 3RZYA 1EYCA 2SOBA 1CRBA 2OVSA 2Q9SA 1PM1X 2QO6A 3NX2A 3MEHA 4RAUC 1BQQT 2IX3A 3BSZE 3CRLC 5IT9L 1CJ5A 3DWAA 4TKBA 3HEJA 3NQ9A 3BS2A 4XMFA 1JE4A 1H9JA 3KLSA 1E2VA 4IN3A 2Z4HA 4ORUA 1OPBA 4D6AA 3BVGA 2DN8A 1NP1A 3TN2A 3ZYYX 1VDZA 1Q12A 4BY1B 2F0SA 1EY4A 4UAIA 2A2GA 2BT9A 3V96A 2QMIA 4XT1B 3H09A 4U9CA 4I65A 4LJZC 4AZOA 2XRSD 1G2SA 5T1IA 3TP7A 4LZUA 3H3IA 1J9OA 3PUXA 3PUWA 1AN8A 3S5VA 1UAPA 5BVQA 3R2TA 1A3YA 1O78A 2LFNA 2AWNA 4HSPA 1STAA 3LNNA 1BLRA 5FQ7E 2JSOA 1U4PA 4NNTA 2GTLN 2FLJA 1LFOA 4ZH6A 4GE1A 5A2QE 1CTMA 1Z24A 1PMRA 5I9PA 4A93B 1AVGI 4IBAA 4ZAIA 3FEKA 4X3KA 5JEAJ 2MHDA 1RDPD 1SBBB 1TY0A 1GKAB 4WFN3 4EQAC 1MX7A 1Y8NB 4V190 1XTCD 3GTPB 2AT0X 4RGOS 1B0OA 4OIJA 2NNEA 4UU2A 3EJIA 3HTYA 1EIGA 5C3EB 3ZW1B 4ZUIA 4XMCA 5IGBA 1LTSD 3CU7A 3N52A 4FF4A 4ZKBB 5KIDA 2BA0A 1WTPA 4KY5A 3EBKA 3OW7A 5T1GA 1QFTA 4FF2A 3VG7A 1DOLA 5C0XI 1X8PA 2RDHA 4H0LC 2WEXA 4U3QA 1JORA 4YBUA 3APUA 3FW5A 2IPKD 1TS4A 3R2IA 1GUOA 1ZYRC 2K05A 5KIXA 2F0GA 4ZLTF 3HOEA 1KT7A 3P7JA 5F6ZA 5E3FA 4ZHGA 1GGLA 4IFDI 1EYAA 1V43A 2G9DA 4QMGA 2FINB 2N88A 4A1YA 1ACDA 1I4GA 2KOLA 3T4AC 1GUNA 1NR4A 1T8VA 4AZQA 2B8FA 2QILA 4KIIA 3J81L 5M9OA 4ZHCA 5LJHA 4OIKA 3NWSA 3RUZA 1SFOB 5HZ9A 1TW4A 4EQOA 1SMPI 3K7AB 4HPDA 3PUYA 3K3LA 1WTOA 3P6CA 4I7ZC 4XTCS 2W2BA 3WOEA 3PO3B 4G57A 1SY1A 1ZNKA 1XX8A 3E3CA 4IUTA 4RCOA 5DM73 1EL0A 3PO2B 2CW0D 1CZGA 1G6ZA 1GUGA 1S4ZA 4BWGB 1IW7D 1QOHA 2K5WA 4KN4C 1MD2D 3FVQA 4U68A 4C56C 5F7GA 1O1UA 5FQ8E 4E6IA 3NQTA 4KHVA 5DNFA 1FE3A 3TF6A 2NN6I 3MVVA 2B63B 4XMDA 3LWEA 3TP5A 1VF7A 5EKLA 5M5XB 1UEAB 4FBRA 2H4OA 3STMX 3CBCA 5KRUA 3GE2A 3D6WA 5CV8A 1UREA 4Y7NB 2F0VA 5DPQA 3QKGA 5FAZA 2PZWA 5LJCA 1ET9A 1LIDA 5TSSA 4ES7A 2CZTA 1DOMA 1HXYD 2M00A 5C4XB 5CYBA 3AB9A 4IB9A 3M4YA 4XYQA 3MAQA 2EZVA 1Y8PB 1LT6D 1I3QB 2BCOA 1PTOF 2A0AA 3C3LA 5KNBA 3NQ3A 4QQ1A 1NGLA 5LJDA 4ZQ3A 1NAPA 3I91A 3UAQA 3G7LA 4NYRA 3HOYB 2D2CC 2LMCB 4IZ8A 4FP5D 2OT2A 1HN2A 4DAPA 1SJED 3P1HA 1RTNA 4R8NA 1EZ6A 1DOKA 1KABA 4XT3B 1TVQA 5JPMC 1VYFA 1EIIA 4DXFA 1VPRA 5CBEE 2K04A 1YWCA 4AZRA 5IGDA 2KHSA 1MVGA 2EYMA 2XSTA 1O80A 5KYLA 1IKMA 2F0KA 3NTIA 2X45A 1EI5A 1A2DA 4RGNA 2F0WA 4FF3A 1PTOH 4RUNA 2LY7A 3G7XA 4LKTA 4QYPA 5ELDA 4DNTB 2F4IA 2K33A 4I9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O78 A;  2EJF C;  1T5E A;  4GZY C;  3A8K E;  3T53 B;  2A6E C;  1LAB A;  3LNN A;  3D4R A;  1HPC A;  3I72 A;  3T51 B;  1GUG A;  3VR6 A;  4OO1 H;  3A8J E;  1DD2 A;  4IFD H;  1GUS A;  1IW7 D;  3M7N A;  3CRK C;  2A69 D;  3VR5 A;  3I73 A;  1GJX A;  4BA2 I;  4KN4 C;  1CTM A;  2YYZ A;  1PMR A;  3BG3 A;  1V8Q A;  2A6H D;  2Q8I B;  1Z7T A;  2IT1 A;  2AWO A;  3PUV A;  3PUZ A;  4H44 C;  2NN6 I;  3GD7 A;  1IYV A;  3BDO A;  2A68 D;  1H9K A;  4G7Z C;  3SDZ A;  4DK0 A;  3TZU A;  3QG1 A;  1Q1E A;  1VF5 C;  1H9R A;  2BDO A;  1HCZ A;  1HTP A;  2V4D A;  1VF7 A;  1K8O A;  3H94 A;  1SMY C;  3DXJ C;  2O5J C;  3QJY A;  4IQZ A;  2R6G A;  2EDG A;  5JEA H;  3I4L A;  2K7V A;  4KI0 A;  4OGQ C;  1CFM A;  2KA7 A;  5K36 G;  4LK1 C;  1Y8N B;  1OXT A;  2A6E D;  2B8G A;  3N6R A;  3T56 B;  3KLR A;  2BE5 D;  4G7O C;  2EJM A;  3RLF A;  3EQL C;  3NE5 B;  3OPO A;  3GQB A;  1GHJ A;  3OOC A;  1FYC A;  2K32 A;  2F1M A;  1H9M A;  1E2W A;  1HQM C;  3A7L A;  4BA1 I;  2JXM B;  1YNJ C;  4DK1 A;  4OO1 G;  4IFD G;  2BA0 A;  1Y8O B;  3AB9 A;  1OXX K;  3M4Y A;  4JK1 C;  3OW7 A;  4PV1 C;  3U9S A;  1Y8P B;  1Q90 A;  4JBW A;  1DXM A;  2D5D A;  3A7A B;  5C0X G;  2NN6 H;  5A35 A;  5KNB A;  1QJO A;  3PV0 A;  2O5I C;  1I6V C;  1OXU A;  1YNN C;  2PNR C;  4H0L C;  4TQU S;  1VCI A;  1O7L A;  3VR4 A;  3MXU A;  4TKO B;  4KMU C;  3WDN A;  5JEA G;  1GUT A;  2D2C C;  1GUO A;  1ZYR C;  2AUJ D;  2L5T A;  2LMC B;  4HR7 B;  3CRL C;  1IYU A;  3IFT A;  3M85 A;  1B9M A;  1DCZ A;  1H9S A;  1CI3 M;  1ZKO A;  3FMC A;  3LWU A;  4XIG S;  3VR2 A;  3VR3 A;  5KND A;  4KHZ A;  5BN5 A;  5BN4 A;  2E76 C;  2E75 C;  1GHK A;  1LAC A;  1V43 A;  2E74 C;  1H9J A;  1OXS C;  3P20 A;  3ND8 A;  1E2V A;  2D62 A;  3VA7 A;  2ZT9 C;  2DNE A;  3IKJ A;  1BDO A;  1EWH A;  1GUN A;  2CW0 C;  3MFY A;  1OXV A;  2DN8 A;  3QIA A;  5KNC A;  3W3A A;  1VDZ A;  2B8F A;  2BE5 C;  1Q12 A;  1Z6H A;  1K8M A;  1IW7 C;  1TKW B;  2A69 C;  4G7H C;  1G29 1;  4DNR B;  2AUK A;  4L8J A;  3HGB A;  2QF7 A;  1Q1B A;  2DNC A;  1B9N A;  2JE6 I;  3SE0 A;  3ND9 A;  2PCF B;  1TU2 B;  5C0X H;  2A6H C;  2JEA I;  5K36 H;  4LJZ C;  3FPP A;  4KKU A;  2JEB I;  4H13 C;  2NN6 G;  4KKS A;  4RCN A;  1H9S B;  2A68 C;  2EVB A;  1ONL A;  1A6X A;  2EJG C;  3L7Z C;  5BN3 A;  3PUX A;  3PUW A;  1Y69 U;  4KKT A;  3PUY A;  1E2Z A;  4DNT B;  4I7Z C;  4KN7 C;  3A8I E;  4XTC S;  2KCC A;  3D31 A;  2PPB C;  2K33 A;  2BA1 A;  1FR3 A; 
#chains in the Genus database with same CATH topology
 4IPD A;  4IOC A;  4ORW A;  1KT3 A;  1PZJ D;  1TXL A;  1X56 A;  3PGZ A;  1IIU A;  3BX7 A;  4EVO A;  5CC4 A;  2RTE B;  4A3L H;  1GX9 A;  1BBX C;  4A3F H;  1I4U A;  4IO9 A;  4GOP A;  1AE3 A;  1K83 B;  3NBH A;  3I17 A;  5IGF A;  1GKH A;  3SOT A;  4JI0 Q;  4UDU C;  5COY A;  4JOI A;  4O3X B;  2JA5 H;  1LIC A;  2AT5 X;  1PH6 A;  2OEO A;  2VFB A;  3ULJ A;  1OEJ A;  1NUC A;  2JGS A;  2R7D A;  4A3J B;  1FEL A;  4RHR A;  4DAM A;  1LCW A;  2K75 A;  3VYT A;  4KHP L;  1BSY A;  2K7V A;  4KI0 A;  1G91 A;  2L67 A;  1HUM A;  2WWP A;  4DF7 A;  2A6E D;  3FLL A;  5IYB H;  3AKN A;  4ZYS A;  3M4Q A;  1AW7 A;  4A3D G;  5G3L F;  1M1K C;  3EQL C;  3OPO A;  4MIU A;  3KF6 A;  4C3J G;  3VG6 A;  5LMN L;  1ENF A;  3ZJY C;  3VDY A;  1XYI A;  1LYL A;  3FKI H;  2LKV A;  4COT A;  5CV9 A;  5CV6 A;  5HZ8 A;  4AIM A;  1OSP O;  3F2U A;  2EY5 A;  3STB D;  5DM6 3;  1Y1W H;  1KT4 A;  1IBK Q;  2DJF C;  1JWM D;  4DAY B;  3RN2 A;  4ORY A;  3CQN A;  4NP1 A;  1WI5 A;  2RCF A;  4KTA A;  4PV1 C;  5K5P A;  1UYN X;  1S5E D;  3K57 A;  1DXM A;  3I4M G;  2MPM A;  1R9T H;  3DHQ A;  2OTL A;  3KK7 A;  1RCV D;  3R3O A;  1I6V C;  2AVI A;  1D5M C;  1L1O C;  5IT9 E;  2Y32 A;  2HIV A;  2EYF A;  2EY6 A;  3VR4 A;  2IZE B;  2OZQ A;  3R93 A;  1WFQ A;  3CWK A;  1QUQ B;  3D9W A;  1JWU D;  3NEM A;  1B70 B;  1F9R A;  2WB1 G;  4N9T A;  4NDX A;  2ZJP A;  1PRT B;  5EGT A;  2MUY A;  1TWC B;  2F0I A;  1HFG A;  3LWU A;  3X3N A;  3OE3 A;  3P6F A;  5BN5 A;  3J81 i;  4IAL A;  5M3M G;  4DQ3 A;  2R93 B;  3P20 A;  3BS1 A;  1VQO A;  3OD9 A;  3RDM A;  2PZT A;  1EYD A;  1CZW A;  3H3V I;  1AP0 A;  2Y0S E;  2WFW A;  1VYG A;  1VQE A;  4IAW A;  4KY6 A;  1MBY A;  1TWF B;  3CPW A;  4NPS A;  3RNU A;  1SWK A;  3KQ0 A;  3STK A;  4U8U O;  4A60 A;  5IWA L;  1SWD A;  1H91 A;  3GTK H;  1T5X D;  2KTS A;  2QF7 A;  1VMP A;  4C3H H;  3V05 A;  3KOJ A;  1JV4 A;  1Y9L A;  3WJD A;  2HZR A;  2PCF B;  2KBN A;  1LTB D;  3CCS A;  1FJ1 E;  1Y52 X;  2GH7 A;  1Q7Y C;  1YBY A;  3F1Z A;  4KKU A;  2B2T C;  4O3Z A;  1PVO A;  4GRJ A;  1EOV A;  1EFI D;  4OWW B;  4A3D H;  4R9W A;  4HJ7 A;  1YZ6 A;  1VWL B;  5EDC A;  3OMG A;  3H0G G;  1K9M C;  1N0S A;  3MWY W;  2IZH B;  3KFH A;  2LB6 A;  2QDL A;  5JJK A;  3U4Z A;  2FT9 A;  2KJX A;  1LAB A;  1HQR D;  4XDX A;  5CV7 A;  3UDI A;  1YWB A;  3BVM A;  2RTJ A;  4YFP A;  1DD2 A;  4FDB A;  3DSZ A;  1YJN A;  3T2W A;  3CAM A;  5B5F A;  1GJX A;  1N9M A;  4KJO A;  3PED A;  1J6Q A;  1KNA A;  3HWD A;  2IX0 A;  3WOV A;  3RE6 A;  1SWT A;  3KJO A;  3QR8 A;  3I4M H;  1W4T A;  3TEH B;  4POF A;  3QWN A;  1QVC A;  2F3W A;  4JW0 A;  1VQ5 A;  2UUA L;  2ATW A;  2A68 D;  2K62 A;  2WR6 A;  3SDZ A;  2HCI A;  1Q46 A;  2K03 A;  2IFB A;  1NR2 A;  3P6D A;  4O3Y A;  3VYR A;  3DXJ C;  3PQI A;  4MEE A;  4KT5 A;  2O2L D;  2DY8 A;  1DGS A;  3EBE A;  3OHX C;  3HFZ B;  1LT5 D;  4CKE A;  3I4N B;  1CBI A;  1EPA A;  4GET A;  5IT9 c;  1VQ9 A;  4O4X A;  3FEW X;  1VQL A;  2IZB A;  1EY6 A;  1SNM A;  3N6R A;  4LF6 L;  1RL2 A;  2ENB A;  2R61 A;  5M3M H;  2PMZ E;  4GLV B;  3CMA A;  3SLT A;  3U4V A;  1DJR D;  3F6Z B;  3KDF A;  4ML7 B;  3WJC A;  1FGU A;  1FYC A;  3NTK A;  2L1B A;  1F9P A;  1DF3 A;  4MVL A;  4DK3 C;  2AT3 X;  2BDN A;  2J4X A;  1HBP A;  3BRN A;  2E2H H;  3TZD A;  3J7A V;  2OL7 A;  2RTC B;  1XXG A;  1A63 A;  4LUO A;  3S16 B;  2YTX A;  2Y3F A;  1U0X A;  5IWA Q;  1VQC A;  4IUN A;  2IZC B;  3B2H A;  1AE2 A;  4OEL A;  5A35 A;  5FO7 B;  3K58 A;  2OF8 A;  1QJO A;  5IOD A;  2GC9 A;  4GN5 A;  2X4M A;  3SK4 A;  4NXN Q;  2RDF A;  3H0G H;  2CBR A;  1YP7 A;  4Z6J A;  4N7C A;  2XWJ B;  2XTI A;  2Z9H A;  1JOQ A;  1RSU B;  4K5V A;  2JN3 A;  4O4S A;  1B4M A;  2SNM A;  5FLM H;  4CDD A;  1MHW C;  1VQB A;  1LDQ A;  2JA5 B;  4J8Q A;  1AZQ A;  1BSQ A;  3SZH A;  3VR2 A;  1GT4 A;  1WBI A;  4FNF A;  5IRU A;  2G78 A;  1ASY A;  1XJV A;  4OXP A;  3S9W A;  4AH6 A;  1OXS C;  3HOU G;  5IP9 G;  3MBT A;  4KD3 A;  3VA7 A;  5HA1 A;  3J81 E;  3GTG H;  4INN A;  4IPC A;  3E9H A;  2O62 A;  5JD2 A;  2RBM A;  2Z1C A;  3NAD A;  3QQ2 A;  2AKQ A;  3QIA A;  2RCQ A;  3BZK A;  2ICI A;  4LF4 L;  2XKL A;  1D3S A;  1TKW B;  4G7H C;  1G29 1;  2CM4 A;  4TRD A;  1QWY A;  3PK2 A;  3IFD A;  2DNC A;  4GGR A;  1VQG A;  3GTO H;  4QGU A;  1U17 A;  4JGL A;  2Q2H A;  2UUA Q;  2B2V C;  5K68 A;  2AL0 X;  4IUV A;  1SWB A;  1EQR A;  1D1I A;  4ON1 A;  2YU9 H;  3S1M B;  1A6X A;  1SRE A;  2B29 A;  3Q8D A;  1SXX A;  5H9L A;  1VQ7 A;  5L8O A;  1X3P A;  4KN7 C;  4MVE A;  4WJ3 M;  5K67 A;  2F0F A;  1R9T B;  3M7G A;  4JI8 L;  4LF6 Q;  2EXD A;  3PPT A;  4U8U N;  4CDE A;  3T53 B;  4ODD A;  4HID A;  5IO7 A;  2OTJ A;  4XMG A;  3OIQ A;  3K8A A;  1VQK A;  4O1N A;  3PDF A;  4WOR A;  3QOL A;  4A3B H;  1X3F A;  1RXK A;  3I73 A;  3CKI B;  1WTH A;  1SWF A;  1AZP A;  3WYQ A;  4ZGU A;  2KVM A;  2IY5 B;  1DZ1 A;  1KAW A;  3NR3 A;  3BX8 A;  3KUP A;  1MM9 A;  2C9O A;  1PBY A;  2JOZ A;  2YMS A;  3PH5 A;  5NUC A;  2VB3 X;  2L0C A;  3MC0 B;  1VMC A;  2UYW A;  3JQO A;  1V1P B;  1X6O A;  3QG1 A;  1SJH D;  1K8O A;  4BX6 A;  1PH7 A;  2PO4 A;  1FJG Q;  2OY5 O;  4ME5 A;  1SXW A;  2QOM A;  3EN2 A;  1JE5 A;  2L11 A;  4L5Q A;  5D47 A;  3UI2 A;  2OVD A;  3FA7 A;  1CT1 D;  4DR6 Q;  1SWR A;  3UEU A;  4HIO A;  4HCE A;  1WTR A;  2B3G A;  5I6Y A;  1W6K A;  3TME A;  2NVT H;  4GNY A;  4QIW E;  2EJM A;  3HOU H;  2NTT A;  4NV7 A;  3TGA A;  4LWC A;  2UXB L;  3IAY A;  3HG9 A;  2QOS C;  2JA7 G;  5L8I A;  1PMP A;  2I0Q A;  1H9M A;  1IJ8 A;  2WSJ A;  1E2W A;  4K8I A;  3BYY B;  4O4O A;  3LHN A;  4C3J B;  3NSW A;  1SWJ A;  3J81 c;  4KD4 A;  2RTB B;  1HA6 A;  1HY2 A;  4RMF A;  4I3B A;  4JK1 C;  2NYZ D;  3M3Y B;  3GTQ H;  2NB0 A;  4JOI C;  2CBS A;  1O7Y A;  1PH3 A;  4QF4 A;  4A1H A;  1ZND A;  3FR5 A;  4WBK A;  4P74 A;  2IJ0 A;  2ZXR A;  2F73 A;  3CKG A;  1LKE A;  1VS0 A;  3A74 A;  3VE2 A;  1JOO A;  4C1N I;  2NZH A;  3I4M B;  1QY0 A;  1HBQ A;  3ITP A;  4Z9C B;  4UU3 A;  3RN5 A;  2L5T A;  4HR7 B;  4L63 B;  3H3V C;  4QCL A;  5L3Y A;  2R92 B;  3IFT A;  1XPU A;  3KFI A;  1H9S A;  4XIG S;  2XIW A;  4QZT A;  3L3O C;  5EAY A;  2E76 C;  5LKE A;  4A3E G;  2AMM X;  2E74 C;  3FEP A;  2WB1 B;  2NZ1 D;  4WFV A;  3ND8 A;  4CJ1 B;  2K01 A;  3CMP A;  1FDQ A;  3IKJ A;  4ODG A;  4P2C B;  4AYB G;  2Y3E A;  5CV5 A;  1WTQ A;  3EW1 A;  1D7Q A;  1XCA A;  2HKD A;  1IFC A;  3JS1 A;  4RHS A;  5KEE A;  1JT8 A;  4B3M L;  5I2X A;  4XQJ A;  4QL5 A;  3T16 A;  4NMZ A;  1FEM A;  1EU4 A;  4JCV E;  3JC6 6;  1J5E Q;  1SRJ A;  2AH7 X;  1A18 A;  3FPP A;  4LUV A;  4DV4 L;  5GRO A;  4BY7 G;  4KKS A;  4LMQ D;  2E2H B;  1LNM A;  5DAU A;  1EWI A;  3M4O H;  2MWH A;  4OMW A;  4NYQ A;  4AZN A;  5GAH C;  1GT1 A;  2CKZ B;  1BF4 A;  2JU7 A;  2QDB A;  1PRT D;  4Y59 A;  5FLX E;  1BO0 A;  2PNH A;  2HT1 A;  1BWY A;  1CHP D;  2KEE A;  3FPU B;  1NSN S;  2ZTE A;  4L5T A;  4BBR G;  1S72 A;  3HKZ B;  1Y55 X;  5LHY 1;  2M9V A;  2UXB Q;  3G4S A;  1B8E A;  2BC3 A;  1NTG A;  2F09 A;  4JI3 Q;  3EM0 A;  5EEE A;  2LBA A;  4DCB A;  5H8T A;  1TS2 A;  1LEL A;  5C6A A;  3K5N A;  2BS6 A;  3BG3 A;  2GTL M;  2N93 A;  1I4H A;  2FRS A;  3UEV A;  4RG1 A;  5HUR A;  1FD7 D;  1G8Z D;  2BDO A;  4K5X A;  1HTP A;  1XNR L;  3G48 A;  4K0K L;  2O5J C;  4MVK A;  2EQS A;  4PSQ A;  1BCP B;  2BSZ A;  1BUV T;  5EQ0 A;  4OGQ C;  1WD0 A;  1TY2 A;  2FMC A;  1BNZ A;  3MXP A;  1DYQ A;  5K36 G;  1CHQ D;  1SWG A;  3RKG A;  1A2T A;  4A76 A;  1X9N A;  2X8F A;  2OQK A;  1R4P B;  3C1E A;  5AQ6 A;  1CQV A;  1JQP A;  1QWD A;  1K8G A;  1HMT A;  5I2Y A;  2K6A A;  3FDT A;  4IUQ A;  4PMC A;  5IYC G;  1RBP A;  2Q8R E;  4TKH A;  4C3I B;  2JXM B;  3P6E A;  1M4V A;  2F0M A;  2MO1 A;  5GAD C;  1JZU A;  4MVI A;  4O42 A;  1E5P A;  4YWL A;  1ZEQ X;  4JI4 L;  3S2D B;  1OXX K;  2ALL X;  2R7Z G;  1HMS A;  4JV5 L;  2AQ1 B;  2F0Q A;  1U4R A;  3A56 A;  3WVM A;  2ZAI A;  1U4L A;  4K19 A;  5EKK A;  1CKO A;  2KUM A;  2NZO A;  2IZG B;  4ZH9 A;  1CA6 A;  2HIX A;  4B3R Q;  3PV0 A;  1OBP A;  1WCM B;  1OXU A;  1YNN C;  1QVF A;  3RY1 A;  3UEX A;  4IAB A;  2HHH L;  1SRF A;  4ZCK A;  4KMU C;  5CMD A;  5ELO A;  5C3W A;  1ERB A;  1KRT A;  1TWA B;  1BSO A;  4GNX C;  4A3K G;  1DCZ A;  1IW2 A;  1X8N A;  4OO1 I;  2N49 A;  1RTO A;  5FLX c;  3B2I A;  2OL6 O;  1I4R A;  5HCC C;  4X62 Q;  4EQN A;  1I4P A;  3S1N H;  4OKA A;  3SEB A;  2VL6 A;  4PZ6 A;  3U58 A;  4JC0 A;  3S17 B;  3U0D A;  2K5D A;  1N34 Q;  2B2U A;  1KL5 A;  4L5R C;  2CM9 A;  4ALO A;  2KCT A;  3BU2 A;  3HOU B;  4O0A A;  5CE4 A;  4JYA L;  4K5W A;  3SXH A;  2A69 C;  2KED A;  2B2T A;  4DNR B;  1SWN A;  1UYO X;  2OYB O;  2ICE C;  3OWF A;  2RCT A;  4JI1 L;  1SMX A;  2OVE A;  3BZD B;  1M8A A;  1TOU A;  4OX9 Q;  3TRZ A;  1HNW Q;  1X54 A;  4F8M A;  1NE3 A;  5K36 H;  1B4O A;  3NX1 A;  4DUZ L;  4CSB A;  3CXC A;  3NEN A;  2A2U A;  4GZV A;  1IKL A;  3L7Z C;  1HMR A;  4DV3 L;  3CHB D;  4DV7 Q;  1JB7 A;  4BOE A;  1PBO A;  5BVT A;  1XTD A;  1L0X B;  2BA1 A;  2A5H A;  3PSI A;  4XYO A;  2WAQ E;  5IYC H;  3CQZ H;  3DMU A;  4Y0Q A;  4DR4 Q;  3I55 A;  4FBV A;  1VQA A;  3MXN B;  4HFO A;  2NNQ A;  4Y5D A;  3K6O A;  4Z2P A;  4RGM A;  1EY0 A;  2ZJR A;  4GOP B;  1A8V A;  1HUN A;  2POA A;  1PH9 A;  1VWO B;  3ERQ A;  2R74 A;  5LMU L;  4NXM L;  3DWP A;  4JI4 Q;  1EEI D;  3OTO Q;  5ISR A;  2LXK A;  2BHV A;  1SAP A;  2F0H A;  1STG A;  4DK0 A;  2N55 A;  5JOB A;  3TZU A;  1XPR A;  4B9W A;  2JA8 H;  1B56 A;  2OCE A;  3D96 A;  1D1K A;  1YEZ A;  5KYI A;  1ALB A;  4O49 A;  5EKI A;  2NND A;  2CH4 W;  5EPQ A;  5GQO A;  5B10 O;  1BBW A;  1EYG A;  5C5M A;  1CFM A;  4Y0R A;  4A3K H;  2F0J A;  1SSO A;  2JJQ A;  4MN3 A;  1VWD B;  4BQU A;  3KF8 A;  2QKI C;  3MTS A;  4RGT A;  1H95 A;  3FA6 A;  3HWF A;  4HJ5 A;  4YHH L;  2X6G A;  2F3I A;  3AU7 A;  2UU9 L;  1GHJ A;  1IHZ A;  4CDE C;  3S2H H;  4FF1 A;  2QO5 A;  1EOT A;  4ILW A;  2G7B A;  2K32 A;  1EIY B;  3K5L A;  4X3S A;  3CBS A;  3M4O B;  4BA1 I;  3H6M A;  1KQX A;  3HOL A;  3RZO H;  5F2D A;  3HOZ B;  1ESR A;  4HMI A;  2JA7 B;  1Y8O B;  4JI2 Q;  1J8I A;  1B53 A;  2X32 A;  2H1E A;  2RSO A;  2RTN B;  1SMY D;  1BOS A;  2V1C C;  4EXZ A;  3BDR A;  4PQX A;  4TJZ A;  4YKO A;  5M5W B;  2O5I C;  5I4D A;  3MA2 B;  2NWG A;  1UZ2 X;  3O19 A;  5HCD C;  2HUG A;  5E1F A;  1EEF D;  2PNR C;  4DUY Q;  2F0D A;  5AJC A;  1TWG H;  3W5O A;  3C76 X;  3JSQ A;  1NJI C;  4X3T A;  2ZXO A;  4NW4 A;  2Z0S A;  5HWZ A;  1MIU A;  1YHQ A;  2RKS A;  3M85 A;  1KC8 C;  1KLU D;  4ZK9 B;  1QY1 A;  1CI3 M;  4JI5 Q;  3B2J A;  1I50 H;  3GDE A;  2EYP A;  2CQA A;  2EY1 A;  4KHZ A;  3V2T A;  4HAE A;  1AQB A;  1XNQ L;  1BBP A;  5CV4 A;  1V1O A;  4L1N A;  5AJB A;  3TGB A;  2RN4 A;  4LQZ A;  4N7D A;  2KEC A;  5DLQ E;  2A73 B;  2PYK A;  4A4I A;  1EWH A;  1KNE A;  3MFY A;  1N7Y A;  3NEL A;  4A3E B;  3EFX D;  4KJN A;  2B2V A;  1WTW A;  2ACO A;  4TQ2 A;  4ZGF A;  2NVX B;  5C4J H;  3L2P A;  4YFR A;  2WAC A;  5AFW A;  1HNX L;  1FTP A;  4M6S A;  1VQP A;  5IGG A;  1KT5 A;  5CGK A;  3RZD H;  4AYB B;  1EIF A;  3S5X A;  1ML0 D;  1FNW A;  2JEA I;  4O4U A;  2WAQ G;  4IOA A;  3PH6 A;  2I5V O;  2N8N A;  1BEB A;  4OHJ A;  3EIV A;  1Y69 U;  1E2Z A;  5EDB A;  1ENA A;  1GKA A;  4EQ5 A;  4BY7 B;  1JJ2 A;  3KYH C;  2ZTD A;  2F0O A;  2RTF B;  2Q39 A;  4Y0S A;  3D4R A;  5CBA E;  3I72 A;  2HYS A;  4TNN A;  3B6Y A;  3A8J E;  3TRE A;  1IKE A;  2ES2 A;  4DR1 L;  1GUS A;  4EX5 A;  3E9I A;  5J22 A;  1EUO A;  1Y1W G;  2OFM X;  4BBR B;  3I56 A;  2AF5 A;  3HP3 A;  3WZQ A;  1ZNE A;  1VWQ B;  2F52 A;  1KTK A;  1WJJ A;  1NP4 A;  2A6H D;  2EXZ A;  3ZW1 A;  4DKA C;  4FBO A;  1KGL A;  1Z47 A;  1SNQ A;  1FGB D;  1YHA A;  4EFG A;  1C4Q A;  4BBS B;  1H9K A;  5IP7 G;  3RE5 A;  3AQQ A;  2V4D A;  4IAX A;  1N36 L;  4JO6 A;  3LX0 A;  5HBS A;  2G79 A;  2QM9 A;  2CWP A;  2R6G A;  2EDG A;  3G6J B;  2Q2T A;  4YH0 A;  1R4Q B;  2UXC Q;  2A74 C;  3BYT B;  3S1Q B;  2XNA C;  3UDF A;  4JNJ A;  2I5Z O;  5EED A;  3UE0 A;  3FEN A;  5H9N A;  1V1Q A;  2JYO A;  4LUZ A;  3T1Y L;  2XGT A;  2MM3 A;  5IRW A;  1IBM L;  3OOC A;  3ZW0 B;  4MIS A;  3V8U A;  4U67 3;  4B3T L;  3X00 A;  4AW8 A;  4Z2V A;  5FOB B;  3A7L A;  3BDC A;  1XMO Q;  3VYS A;  1SWQ A;  4NLI A;  5D65 A;  2L12 A;  3A5U A;  2RTA A;  2DUD A;  4IFD G;  1YP6 A;  1ICM A;  3NUC A;  3GV3 A;  4OON A;  1WVL A;  3U9S A;  3SR1 A;  2VB2 X;  2A1A A;  4C3H G;  3J80 L;  4LF7 Q;  1SA8 A;  3KFG A;  5B2A O;  2GN5 A;  2D5D A;  3GO5 A;  3RSW A;  4IMO A;  4YCU A;  1Q8K A;  4LFB L;  3CC2 A;  1A0I A;  3IL8 A;  2R7Z B;  1MDC A;  4PG3 A;  1BCP D;  2BOS A;  2C1S A;  1YWD A;  3OWE B;  4Y52 H;  3CQR A;  2CAM A;  2B2W C;  2F0N A;  2Q2U A;  1W5R A;  3STN A;  4G4K A;  4DU9 A;  1OO9 B;  1SWA A;  5FFH A;  4FO2 A;  5LJB A;  1IYU A;  4X66 L;  4AQY L;  4YFQ A;  4HMJ A;  4FXK C;  4EEJ A;  4C5P A;  1T9H A;  1E06 A;  4B55 A;  4A3K B;  1KQW A;  1PH2 A;  4OEM A;  2MP1 A;  2DNE A;  1SXU A;  4OS3 A;  2CW0 C;  4H7B A;  2AQ2 B;  1OXV A;  3K59 A;  3U9O A;  2QCB A;  1IW7 C;  5IP7 H;  2ZTC A;  3CD6 A;  1MOY A;  1VQH A;  4L8J A;  4NW2 A;  2PQA B;  4HPB A;  1E1O A;  1O1V A;  3GTJ H;  1NBW A;  3PQU A;  5C0X H;  4M7M A;  3VHI A;  1N32 L;  3HWE A;  3S15 H;  1RJT A;  2NN6 G;  4RCN A;  1G74 A;  4ZHF A;  5HZ5 A;  4A3G B;  2KEN A;  4B3S L;  2EYO A;  1RD9 D;  4DV2 L;  1P6P A;  1STE A;  5HGT A;  1DZM A;  1L6M A;  3EW2 A;  3DM1 A;  2WIN B;  4A3M G;  1K24 A;  1X65 A;  2EJF C;  2E8G A;  1F77 A;  3VG5 A;  1KZX A;  1ET6 A;  3A55 A;  4C2M B;  2R7F A;  4O2D A;  1S2P A;  3FR2 A;  1TWG B;  4IFD H;  1EIH A;  2OY1 O;  2E2D C;  2MGS A;  4B3T Q;  3HOV G;  2X34 A;  3VR5 A;  5J3B A;  4DNE A;  3U03 A;  1HQP A;  3KVN A;  4YCE A;  2NVQ H;  2B2U C;  3RDQ A;  1I50 B;  1TWH B;  1SRU A;  2E2J H;  3NK9 A;  1VWI B;  3S14 H;  1X3E A;  4BXX G;  2MO5 A;  1MJC A;  4G7Z C;  1RXJ A;  4NNS A;  1A15 A;  1NDJ A;  1VWJ B;  4KHP Q;  5LJE A;  2HDL A;  1JIC A;  3OJY C;  3T6L A;  3CCR A;  3FR4 A;  4CV7 A;  3QJY A;  4DR2 L;  1MX8 A;  5LKF A;  3EA6 A;  3DUZ A;  1VQ6 A;  5FLM G;  2SNS A;  2YTV A;  4CHT B;  2RHS B;  2B2Y A;  5C4J B;  1OXT A;  1EAL A;  4YGH A;  2F01 A;  1E00 A;  3DTQ A;  3S60 A;  2IZA A;  2P5Z X;  1B3A A;  1SE2 A;  5LMN Q;  3PIP A;  2H5X A;  4AQY Q;  3GTL B;  2RQ0 A;  4QNI A;  3PIO A;  1N9W A;  4DV6 L;  2P8G A;  3KJP A;  4DR3 L;  3X3M A;  2RA6 A;  4DNI A;  4ORX A;  4KY7 A;  5HTD A;  1SE3 A;  4GH7 A;  4QB4 A;  4GLX A;  1F2Y A;  1VWB B;  2BLG A;  1SWS A;  2FWV A;  3RMH A;  3TGC A;  1Y1V B;  5M3F B;  1JYJ A;  4R0B A;  4ARH A;  3D0F A;  4A3C G;  4ORR A;  2KHJ A;  3HOX B;  2NN6 H;  1GM6 A;  1JJU A;  4ORS A;  4GKJ L;  2L5P A;  4OMX A;  1AFP A;  4GNX A;  1OBU A;  1SYF A;  1YNX A;  2A8V A;  1N32 Q;  2K5Q A;  4MHE A;  4R8I A;  1PTO B;  3L4R A;  1KOI A;  3VG3 A;  4A3M H;  5JEA G;  2VNU D;  1TII D;  3SK8 A;  4DV2 Q;  2ID0 A;  1X55 A;  1VWN B;  1L2F A;  1ZNG A;  1YNJ D;  1A3U A;  1WD1 A;  3HOV H;  1SLD B;  1GHK A;  2VUM H;  4HJ8 A;  4A3B G;  4F7X A;  1NCV A;  3OSO A;  3OYY A;  1LT4 D;  5EZ2 A;  2FJ2 A;  1LF7 A;  5K06 A;  4DV1 L;  4BXX H;  2OF1 A;  4DGZ A;  3J7A F;  3T1H L;  3TBI B;  3