3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
b'HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Unknown function
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
3VA7A 1H9SB 1CFMA 3CRKC 1K8MA 2AWOA 3PUZA 1HPCA 4L8JA 4JK1C 2BA0A 1OXTA 3BDOA 4G7ZC 1IW7C 2NN6G 3M85A 5BN5A 3MFYA 2A68D 1K8OA 1FYCA 1E2VA 1ONLA 4IQZA 1H9KA 4RCNA 1E2WA 1IYUA 1H9RA 1HTPA 3HGBA 3IFTA 3LWUA 2A69D 3M4YA 3RLFA 3L7ZC 2QF7A 1H9JA 1PMRA 3T51B 2K7VA 2PPBC 3ND8A 4OGQC 4BA2I 3PUVA 2JXMB 5JEAH 5C0XG 3BG3A 3MXUA 2CW0C 3FMCA 1LABA 3QJYA 5K36H 3OOCA 1H9SA 2KA7A 2L5TA 4DK0A 4DK1A 1I6VC 2A6HC 2F1MA 2YYZA 1G291 4LJZC 2K33A 5BN4A 2AUKA 3OPOA 4OO1G 1Y8NB 4PV1C 1DD2A 1Q90A 1H9MA 4KHZA 3VR5A 1Y8PB 2PNRC 3I72A 2LMCB 3W3AA 1GHKA 3A8IE 1EWHA 3A7AB 1CTMA 1IW7D 3PUWA 3IKJA 1YNJC 1HCZA 1OXVA 3TZUA 4IFDG 3VR2A 2EJMA 1Q1EA 1T5EA 1DXMA 2O5IC 2PCFB 2IT1A 1QJOA 3PUYA 3DXJC 3CRLC 4GZYC 2B8FA 1FR3A 3FPPA 1OXUA 3I73A 5BN3A 1O78A 1Q1BA 3P20A 2E74C 2Q8IB 3A8JE 2A6EC 2A6HD 2D62A 3A8KE 5A35A 4G7HC 2BA1A 2K32A 2EVBA 3AB9A 4XIGS 2EDGA 2O5JC 1Q12A 2B8GA 5JEAG 1GUSA 1TU2B 1BDOA 5K36G 3T53B 2BE5C 1V8QA 2R6GA 4TKOB 5KNBA 3LNNA 1Y69U 2JEBI 1B9MA 1IYVA 2JE6I 4BA1I 1GJXA 1Z7TA 2DN8A 3D4RA 3GD7A 3QG1A 1V43A 4TQUS 2D2CC 2DNEA 1GUTA 1TKWB 5KNCA 4KKUA 1GUGA 4H13C 1B9NA 1O7LA 2JEAI 4H0LC 1VDZA 2A6ED 3SE0A 3KLRA 4XTCS 2AUJD 4KN4C 3VR6A 2NN6I 3PV0A 3U9SA 3QIAA 4KI0A 1LACA 3H94A 3PUXA 3VR4A 2E76C 2V4DA 2BE5D 3I4LA 1CI3M 3A7LA 1VF5C 2D5DA 4KKTA 1Z6HA 2BDOA 2DNCA 3WDNA 3SDZA 4LK1C 1A6XA 2EJGC 4DNRB 4I7ZC 4G7OC 5C0XH 3EQLC 4KN7C 4HR7B 1E2ZA 1Y8OB 2A68C 1GUNA 3NE5B 4JBWA 1VF7A 1VCIA 3GQBA 1GUOA 3M7NA 2A69C 5KNDA 4OO1H 1HQMC 3ND9A 1OXSC 4KKSA 4H44C 2E75C 1SMYC 3N6RA 1OXXK 4KMUC 3T56B 2EJFC 2KCCA 3VR3A 4DNTB 2ZT9C 1GHJA 1DCZA 3OW7A 1ZYRC 3D31A 4IFDH 1YNNC 2NN6H 1ZKOA
chains in the Genus database with same CATH superfamily
1HR0Q 4FXDA 1SWHA 2E5LL 1YWAA 2GTFX 4TJZA 2DJGA 5FLXE 1RKNA 4IMNA 5IWAQ 4G7ZC 1XMOQ 1RL2A 3GTPH 3X00A 1OEEA 1VWHB 1QWYA 5DG4A 3M3YH 1N34L 1SSOA 4ZH9A 4K2KA 1QWDA 2C35B 2K5QA 4LWCA 1JT8A 1JQPA 1SWCA 3C77X 2QF7A 1PMRA 1HZBA 2K7VA 2YTYA 1MBYA 3MXNB 1ZNKA 3FMCA 4A3EH 2DJFC 3FR5A 2FHTA 4DV3L 1W6FA 1KLGD 3NUCA 2OY5O 2EYMA 1TWHH 1L6MA 1Y8NB 4DV6Q 4QRLA 4A3EG 1KQWA 4ES7A 1XXGA 4BQUA 1IXRA 3GP7A 1Y8PB 1VQPA 3TP5A 5FOBB 1ZNHA 4HMJA 3KFUA 2SOBA 1A8VA 4HN7A 2NVXH 3CWKA 4CDEA 2M2LA 3FDCA 2UXBL 1HCZA 2SDFA 1VWAB 1EQTA 3E9HA 2F03A 2IT1A 3DWQA 1MJEA 1VWNB 4TVAB 1E24A 4LF6Q 2RTJA 2H1EA 4Q0FA 3S2HH 4ZHHA 2EXZA 3S15B 2C4IA 2MJ8A 3G48A 1PV4A 4LFBQ 1YP7A 1EOVA 5HZ6A 2D62A 2EOTA 2PI2A 1FL0A 5C3EH 2KCMA 4QL5A 2E2HB 2IZLB 2O5JC 1D1KA 3F6ZB 3FHWA 4AYBE 4P72A 5M3MH 4DAMA 1YHQA 1FJGL 4ORWA 4CKCA 3KBGA 3MXPA 4YWLA 3SOTA 4K5VA 3HOVH 3J80L 4FBVA 4FGIB 5M3MG 4FDBA 3MFGA 4QJFA 4WFN3 4ALPA 1E02A 1Z7TA 3D4RA 3GD7A 1QVGA 4IB6A 3HOVG 4GLVB 2F0FA 3ZW0A 3FA6A 3HOXH 2PZWA 4H13C 1LM0A 1AVDA 1ML0D 3WVMA 5LMNQ 1IKMA 3KZAA 1R4QB 4KN4C 5GAHC 3CMEA 1XX8A 2X46A 3R2IA 4A3FB 3IL8A 1Y14B 3ZUOA 4NYRA 4YHHQ 1EL0A 5A2QE 2JW1A 4NW4A 5FFHA 1IBMQ 3UE1A 3VHIA 1TXLA 4Z2OA 2LXJA 2N55A 2KUMA 3S1RB 1GT5A 1TOWA 4B3SQ 3CC4A 2X8FA 1TWCH 5IYBH 4XXEA 1VQOA 1EYCA 2EYPA 1A6XA 3O22A 1CJ5A 1LT4D 4YCEA 3RLOA 4A93B 3TDQA 1PRTB 3D97A 4M8AA 4ME5A 1KC8C 1KOIA 5FLXL 1GUOA 4KJOA 2A69C 4O4OA 3ULPA 1YUPA 3WZOA 4MHEA 5TSSA 4DAYB 2K52A 5HURA 2RDGA 1T9HA 1NBWA 4MN3A 2JK8A 5D3IB 3F2CA 4OKAA 4WHIA 3RZYA 1NCVA 1LTSD 2PNHA 2CWAA 1IFCA 4QGXA 3ELZA 2WEXA 2FKGA 4J1MA 3TMEA 5I6YA 2ACOA 5HCCC 4CSBA 5HGQA 4IUVA 1LUZA 3MBTA 2FMCA 4ZR2A 5B11O 1PZKD 2QCBA 5DLQE 3SEBA 1VWFB 1VMPA 2PW7A 4CDDC 2OTLA 1ADLA 1N0SA 3VG5A 4MTNA 4PZ6A 1E2WA 3M4YA 4B3TQ 3T1DA 3K6OA 1XPOA 2ES2A 2RTOB 1SXXA 1QVCA 3CCQA 2HYSA 2UU9L 1LABA 4CDFC 5BR8Q 1KDBA 4X66L 1Q7YC 1I3QB 4MVKA 4O3ZA 1A3UA 1SLDB 1S3OA 3CQRA 5LJEA 2NNDA 1KT5A 2RHQB 2XWBB 5J1ZA 3PUWA 2K01A 3S16B 4IFDG 4OMXA 3WJBA 3RN5A 1EIIA 5F58A 1ML7A 2IZAA 4MEEA 3T6LA 3BVMA 1EEID 3BYTB 5EQ0A 2AF5A 3G71A 1JZUA 4L6TB 4JI4L 1MD2D 2PYKA 3CRLC 5JJKA 2B8FA 4LMQD 1BEBA 3I73A 1FE3A 4MVIA 2PO4A 2MO0A 4TSSA 3TZDA 3A74A 3M4OH 4C3HG 1X9NA 1MDCA 5FJ8H 1C0AA 3FKIH 3NPPA 3B6YA 4G7HC 3C78X 1SYCA 2Y3FA 4GE1A 3CCVA 3T1HL 1CT1D 1BCPF 4BBOA 4DQ3A 3PIO3 4DV7L 1Y1VB 1VWQB 3CP0A 4GU8A 1N36Q 1DOKA 1X54A 3U58A 2VUMG 3NQTA 1HQPA 1ZNDA 1STBA 1N34Q 1L2FA 2KD2A 5KEEA 2HDMA 5A2QL 4LF9L 3KOJA 5CV4A 4DV2L 3MTSA 3C1EA 5FENA 3F8AA 4FBRA 4MNOA 1LIBA 4O3YA 1TXYA 5FQ7E 5KNCA 3I4NH 5M3FH 4DV3Q 4QIWE 2WIIB 1RDPD 4DK3C 1FGUA 2XWJB 5M5YB 2N49A 2R73A 2GTLO 1YBYA 3FA8A 2RTIB 3K3LA 1KTKA 3GTKH 2RA6A 4WJ4A 2HZQA 2Y0SG 4Y0QA 3EA6A 2MFIA 1S72A 3KF8B 1JOKA 1W2BA 4IJHA 1SRIA 2EJGC 1PDQA 5EKKA 3X3NA 3LTWA 4I3DA 4XMFA 4OX9L 2Q2IA 2B2UA 3TREA 4PMCA 1GUNA 4HCSA 4ORSA 1EI5A 4DNEA 4O3WA 2BS5A 1YJNA 4OIJA 4LFCQ 4AYBB 3GTLB 4GKCA 2WWPA 2WEWA 3E6ZX 3SK6A 1GOZA 1G85A 3WWVA 1SNPA 3G6EA 1N32Q 4WFUA 1L1OC 1CFMA 3OBLA 2AQ2B 3PO2H 2BA0A 1OXTA 3FEKA 1FENA 3OMCA 3PH6A 4NV7A 4Y7NH 4GRJA 5EZ2A 2I0QA 1NY4A 3MFYA 1T5XD 3LV4A 3L3OC 4A3KH 5IYDG 4JHQA 3PO2G 1P8LA 1JC7A 1PRTF 3EFXD 3K80C 1F2YA 4IPCA 3OTOQ 2JXMB 3G6JB 4F8MA 2UUBL 4YCUA 3TS2A 2DY8A 2GTLN 4A1HA 2ALLX 4DK0A 2VB3X 4NPSA 2CAMA 4A4IA 3OJYC 2K33A 1YNND 2WB1G 3OPOA 4IPGA 4APVA 1IBLQ 2F4VL 1AZQA 2NVYB 4DUZL 5LKEA 1PHJA 1JJJA 1CSPA 2I5ZO 2OY8A 4GLAC 1C48A 2LMCB 3QR8A 2UXCQ 1NQMA 2JU7A 2EU7X 5F7GA 1GM6A 2JN3A 2XSCA 3IKJA 3VA5A 1EW3A 2OXPA 3Q22A 2ASBA 3K59A 3STKA 2RCQA 4HPAA 1HQRD 5IT9c 4O4XA 4HPBA 3UEWA 2MP1A 4CHTB 4U8UM 3FR2A 1QVFA 4YCHA 3CQZH 1LO5D 4BBRB 2A13A 3AFQA 2R7FA 2FFKB 1Q82C 1WTPA 3S1NB 3PCOB 1STAA 4FO2A 4AZNA 1KIXA 4A1YA 4O0AA 5CR3A 3VG4A 1WTRA 3SK8A 1VPRA 3MZ5A 1SE3A 3APWA 4PQXA 1JICA 3J7AF 1GJXA 1RXJA 4I7AA 1HNZQ 4ZH6A 1LYLA 2UZ2A 4GGRA 4L5SA 4RKBA 5FLMH 4LZVA 2KCTA 2PMZE 3OHXC 2F0GA 1QZGA 4RH6A 4R4TA 2UU9Q 1ERBA 4O3XB 2SNMA 3BU2A 3Q8DA 4WORA 1R9TH 1QY1A 4X66Q 3FW5A 3U03A 4DK6C 2EYFA 4JI7L 1T68X 4IFDJ 2RKSA 2JA6G 4P71A 3IA8A 3HOZB 1HNWQ 3EMMA 3I4MB 3GTQH 3NSWA 3KBXA 2B2YC 3WJGA 2KHIA 3OWFA 3O19A 3A7LA 4QUFA 1MM9A 3RUZA 1YI2A 2EIFA 5EPLA 3MX7A 1Y1VG 3N91A 4IN3A 3G7XA 1SLEB 4C2MH 1CHPD 3CD6A 4UHVA 1XKIA 5EDBA 2R93H 3EN2A 1DYQA 4IUUA 2HIXA 3SK5A 3F2BA 1G2SA 4X3UA 4M6SA 5C4JB 1KL4A 4YWMA 2AQ1B 1I6HB 4NNSA 1SLJA 2AHOB 1SEBD 4Z6JA 5J39A 1ACDA 2AT6X 1B4OA 3GTMB 1SWLA 1LT6D 4DR6Q 4DV7Q 3ERQA 4DNTB 1GHJA 3OYYA 5CV5A 5CV9A 4CJ0B 4X65L 2E2JB 2EYJA 3JAME 1BLRA 1YHAA 4AZPA 1K8MA 3I70A 4ME3A 1EPAA 1HPCA 4LF9Q 5LJKA 4DV2Q 2BLGA 3L9AX 3HEJA 3BDOA 1IW7C 1F2ZA 2B2WA 1WVLA 3HOUB 2IZHB 2SEBD 3ITPA 2W2FA 5KRUA 1ICNA 2OT2A 1NMGA 4R9WA 4QIWB 3TN2A 2HUGA 1EZ8A 4A3DH 4L3RA 4O9SA 1QE6A 3E9IA 3UDGA 1KL3A 3BG3A 2WUTA 1L1OB 4A3DG 4LKTA 4QAEA 5JD2A 4CPEA 1BOSA 1WTOA 3P75A 1Q90A 1IKJA 2AT0X 1PBOA 3T1YL 4Y59A 3W3AA 3BVGA 2QOSC 4OX9Q 1TR5A 1CZGA 4CV7A 4YDAA 1IKEA 4GKKQ 2F0LA 1KT4A 2MPMA 1Y1WB 4GZYC 3MEHA 4P73A 5FQ8E 3RSWA 2R7ZB 2H4OA 1X71A 2E74C 1FJ1E 3R93A 2KECA 2AT3X 1F9PA 2L9HA 2G7BA 2BOSA 1KZXA 1HA5A 2OTJA 2K5HA 3TSSA 1BBXC 2B8GA 1DZKA 1WBIA 3Q34A 3PH5A 2BE5C 1XCAA 5M5XH 4BXXG 1YNXA 1E5PA 2RCFA 4IPDA 4ZHCA 5D47A 1GO3E 1W3SA 3NQKA 5HTDA 2F0WA 4YDBA 1SLGB 1QFVA 1V43A 4DUZQ 2UUBQ 2F0PA 5HA0A 4ZKBB 2X34A 5HZQA 3PDFA 4OWXB 4H0LC 2RA4A 5D65A 2ICIA 3TZSA 3FVQA 2RHSB 2IZBA 2F4VQ 1S5CD 2HQEA 3QIAA 5HY6A 4BBRG 3HP3A 2M00A 1MJCA 1V1QA 2QKIC 2VQFQ 3I0AA 4EQAC 4DV4L 1JCKB 1EOTA 2G8CO 3LGJA 1IIUA 1O7ZA 2ZXOA 3S14B 5AJ3L 3G7LA 4G57A 2KT4B 1QNUA 1EWIA 3I2ZA 4RWSC 1PYSB 2OL7A 1LTRD 2ASNX 5H9AA 4JI1L 3JAML 3AYHB 3A0JA 3H0GH 1EY0A 2KHJA 3K5MA 3NP8A 2Y32A 2A2UA 2UUAL 1A2DA 4FQBB 4QZUA 2JA5G 3FEPA 2A19A 5C44H 4CKEA 1VYGA 1J8IA 1PVOA 2CHBD 4H44C 1SY0A 1E7ZA 2KENA 1OXXK 2RCTA 1QB5D 2YTXA 1XYIA 1SLFB 4FF2A 2QEJC 4NXNL 4HAEA 4R4OA 1BRQA 2QGQA 2R61A 1Q46A 3K8AA 4BBSH 2QW7A 1KRSA 2Z1CA 2WKDA 4IB8A 2JA8H 2ZM6L 1JWUD 4J6HA 3P02A 4DAYA 4HMIA 4DAPA 4IOCA 5B27A 3HGBA 3D4DA 3D6WA 3T51B 4QUCA 3W1BA 2G78A 2F0JA 3U4ZA 1VQMA 5C0XG 4BGFA 2KHSA 5EBCA 2MQHA 4XMGA 4BY1H 2JU8A 3BDLA 1S7DA 2L5TA 4O2DA 4A3LH 4KC7A 2YYZA 4A3EB 4ODDA 4JBMA 1HUMA 4A8ZA 1WTXA 1O1VA 1TWHB 1O7IA 3OW2A 4ORRA 1KNEA 3UDXA 3VDYA 3A7AB 2Y0SE 1X8NA 3GAQA 4QGWA 1NR2A 2R3ZA 3I56A 1FNUA 2CH4W 2OVEA 4KH8A 2YU9H 2NVXB 3BU1A 4HCEA 3DM3A 3RMHA 2M4LA 4XT3B 2F0DA 3NEMA 4BWGB 3ER0A 4KHPL 4ZYSA 2AQ3B 3TS0A 4UU3A 3GE2A 3WJFA 1I4QA 1KFFA 1WTQA 1PFMA 3QKGA 4MIUA 2A6HD 2JOZA 4ORUA 4X65Q 1JJXA 3ZI8A 4B3ML 5HZ9A 5HCEC 1OSPO 1CKOA 1Q12A 1JE5A 3J81j 1OTCA 1VQKA 3LHNA 3NP1A 1ICMA 3JS1A 1V8QA 4UP7A 5M3MB 1KL9A 2OY7A 2NZOA 3ULLA 1KZWA 1SNOA 4KIIA 4K6DA 2QDBA 3HOVB 1DF3A 1U17A 4DKAC 1N4JA 5E3FA 2D2CC 5AEOA 1K73C 1HFNA 4GNYA 1S5FD 2A6ED 4K6LA 4IBAA 1GT3A 4XTCS 1RLBE 2XNAC 5IGBA 2R7ZG 3KYHC 4HSVA 2CZTA 4JI0Q 2O2LD 1G8ZD 3SK4A 2WB1E 3PQIA 3VR4A 1HNXQ 1RODA 5GADC 3FW4A 3EBEA 3Q6SA 3URYA 1VF5C 1NR4A 1WTHA 4JI8L 4IUNA 3AQQA 1XMQL 2NUCA 3KDFB 1RHPA 5T1GA 4DNRB 1K3BA 2PI3O 1TWCB 3KF6B 4RAUC 5EKLA 1BBPA 4BX5B 5LJBA 1GT4A 3ULJA 1CBQA 1GVPA 1VWDB 1W5RA 3RDMA 2VW9A 1I50B 4JYAL 1ICFB 3PMFA 1ILPA 2ZTDA 2VQEQ 1SXUA 1Y55X 1FNWA 2KCCA 3VR3A 2WFWA 3KF8A 3J80E 5C3WA 4XQJA 2IZIA 5AQ6A 5C4HA 3M7GA 5CSEA 1QY0A 5CV6A 1H9SB 2VFCA 2FMMA 2HDLA 2WINB 4YBPA 2F3WA 3CKIB 4WBKA 4C3JG 1O8VA 3SHLA 3NADA 4DCBA 1SWGA 1Y9TA 3T13A 5BN5A 2QO4A 1K8OA 1KABA 4RCNA 1LICA 3VR6A 1DD2A 1STHA 3FDTA 5COYA 3RE6A 1SY3A 3ND8A 3ICEA 2L12A 2NVTH 2QM9A 4U9CA 1LCZA 4NYQA 1K0SA 1STEA 1SAPA 2O4XA 2HCIA 5JR8A 2PPBC 1B0OA 1I6VC 3CBSA 4QNIA 1ZYRD 2A0AA 2E2DC 4OO1G 1EQRA 2WQ9A 3B2LA 4YFQA 1X65A 1VQBA 2RTDB 1H9MA 4KHZA 4L63B 4KY6A 3HPEA 2WR6A 3E0EA 4HJ9A 4KD3A 4FP5D 1CTMA 3APXA 3GV3A 3A5UA 3N52A 3CC7A 1KAWA 2BH2A 2B39A 2G9HD 2O5IC 3R3OA 4FNFA 3L4RA 4ID6A 4EDEA 3NBIA 1C4QA 4ID2A 2QMIA 4C3HB 2R56A 4NXNQ 1YEZA 3D8GA 2RTLA 2AKQA 3A8KE 4GNXC 4DR3L 2HZRA 3CCEA 1JJUA 2IHEA 2Z0SA 1SRGA 3M4OB 3P7JA 5GAEC 2ACPX 2LS01 1W6JA 2RTRB 1EWCA 2VUMB 2GVAA 2F0VA 4DR7Q 1GUSA 1KQSA 1I06A 1M90C 1JB3A 1STNA 2PY1A 1HJPA 3BLGA 1YNJD 2Z8LA 1I4UA 3NQ9A 3PSIA 1Y52X 4BA1I 3NENA 2JA9A 1EYAA 5LJDA 4LFAL 2DNEA 2W2AA 5F2DA 4KKUA 2XTIA 3AFPA 1LT5D 1TS4A 3SZIA 3HOWH 1LACA 3O13A 4EFGA 3PUXA 2BCOA 2Y0SB 2WAQG 2DGYA 5D14A 1NTGA 3NXWA 5EKIA 2DNCA 4XYQA 5C3EG 2BC3A 1A15A 4RUNA 2N3SA 2EYHA 1BF4A 2YG2A 1PH3A 1M8AA 3K7AH 2OFAA 2B2VA 2WV6D 4K2LA 4IMOA 4HR7B 1E2ZA 4UP8A 1S5DD 4PMWA 1IW2A 5CHKA 3HG9A 4WRDA 1I4PA 2K04A 1VCIA 4F7XA 2K5VA 1HQMC 3J7YW 1SWKA 4WJWA 2RTAA 3JAMi 4B3MQ 2IWHA 1PH1A 5HWZA 2V1CC 2UYWA 3CKGA 1TS5A 1PYWD 2J4XA 1F77A 1GM5A 2Q2UA 2RTGB 1BCPD 3CF5A 3HOXG 3D31A 3RWXA 1YNNC 1WUBA 2RTMA 3K5LA 2NN6H 5E4XA 1CQVA 2FR2A 3VE1A 1UE1A 3U4VA 5EEDA 1X3GA 5IY0A 1DZ1A 1D3SA 1RIPA 1X3EA 2NN6G 3RBYA 3PO2B 1UYOX 3M85A 2FRSA 3DEOA 1E2VA 2RBMA 4EQPA 3L0OA 1KNAA 2GN5A 2Z6KA 5IYBG 2CQOA 2NVQH 4A3KB 3K81C 3FIDA 4O4UA 3MXUA 2MO1A 5D3DA 3S2DB 1X3FA 2RSOA 1HA6A 3HS0C 1YWCA 2WB1B 4EX5A 4DV5L 2LA7A 5IRUA 2FLJA 1E22A 3WJEA 3KLSA 4J8QA 3P6CA 4JI8Q 2IX1A 1QUQB 5FKAC 1IJ8A 1JBHA 4DF7A 3UEUA 4QZTA 3BS1A 3PEDA 1S5ED 1SYGA 3QB3A 3A5ZB 1IBKL 1NNXA 1SRHA 5B2AO 3UEXA 1L1OA 2OQKA 1QILA 3GTOH 2G5DA 5HGTA 1HMTA 2IL8A 4ILWA 1OPBA 5IP9H 2ID0A 4GN4B 4C56C 1Y0GA 2E2IB 3EJIA 3S1QH 2VL6A 1DZJA 4GJSA 2K32A 4QQBX 4XIGS 1PLFA 2LB6A 1VWPB 3WZNA 1WYDA 3STBD 5I9OA 1SR3A 2HQLA 4DUYL 3VHMA 1PTSA 1H91A 1PTOF 4TQ2A 5IT9L 4Z27A 1EXSA 5LJHA 3EVQA 5KNBA 3NBHB 3H3VH 5I4DA 1B9MA 3J81c 2OVSA 1NC9A 2ATWA 1PRTD 2ZAGA 3ELXA 5GROA 4GNXB 2RN4A 4NMZA 3RDOA 1TQOA 1VQ7A 1OBPA 4IPHA 5LKFA 5ELBA 1PYBA 1SJHD 3KLRA 4CDEC 2JA6B 2BS6A 1R9TB 2IHFA 3HRZC 5G3LF 4KJNA 4GKJL 4NLJA 3NBXX 3NHHA 2IZGB 1JYJA 5ELEA 2J0TD 2E5LQ 1TOUA 3MEFA 5IODA 1SYBA 4LW1A 1KT6A 1BSYA 5EDCA 3I3CA 3GTQB 3CR6A 2GH7A 2LBVA 2NNEA 5FJ8G 1IL2A 2XVSA 3FKIG 1B8EA 2AVIA 3G4SA 4Z28A 5L3YA 4I7ZC 4B9WA 1HUNA 2VNUD 2K5DA 3HWGA 3RD4A 1KDCA 4YFPA 2ANSA 3PP6A 1PZJD 3HFZB 4RGOS 1EIYB 4GZVA 3RDQA 1BWYA 1XTDA 4CPIA 2R93B 1A18A 2TMPA 4BJ8A 3ND9A 1EFWA 4JI5L 2RDHA 1RSUB 4RUUA 3RY2A 4OONA 4KMUC 3DM1A 4YMYA 4X64L 1ENCA 4UDUC 5FAZA 2VFBA 2KCNA 1BVSA 1QNKA 2I5HA 5M3FG 3I4NG 3H3IA 5F2BA 1BUVT 2OCEA 4HPCA 2IZEB 2UXBQ 4XMCA 5ISRA 2HMBA 4HFOA 4PNYA 3HOYH 1E2TA 4LFAQ 4CGYB 1CK1A 1FYCA 1HZAA 1JYDA 4MISA 1G5WA 3EBWA 2X45A 3PUVA 5DEHA 4Y5DA 1U4LA 2E2HH 3QQ2A 4H02A 4A3DB 1MX7A 5K36H 2IPKD 1XNQL 1T8VA 4ZGUA 1X56A 4LJZC 3NWSA 4XDXA 4DA2A 1FJGQ 1EQVA 2N78A 3PQUA 4IJLA 1BO0A 2RSNA 4U3QA 5EEEA 1GHKA 2PZTA 4JBKA 2OF1A 2NB0A 5FO7B 3X3MA 3J7ZC 4X62L 2NZHA 2HHHL 3AMUA 4NB3A 2EJMA 5I2YA 2N88A 1SFOB 2PQAB 2Q39A 2IFBA 3DXJC 1ZXTA 3MXGA 4A3FH 1EY7A 4IUPA 2Q2MA 1GT1A 4A3IH 1EUOA 1A62A 1GUWA 4A3KG 1X6OA 1JQYD 2QA4A 1CZWA 3S1RH 1HRJA 1LKEA 2E4JA 4Z9CB 2QO6A 3RE5A 4KCAA 1OBQA 1YIVA 4IRWA 1WD0A 2A1AA 1K24A 1VQDA 4A3IG 4DQ4A 1M1KC 1SWAA 4A93H 2G5LA 1B7YB 4DR5L 3BX7A 2MJIA 2EY5A 4EGVA 2HT1A 1PEEA 2F73A 5M5XB 2K5WA 1CBSA 4LQZA 1XJVA 2DN8A 2PZUA 3V8UA 4TKBA 1JB7A 3STMX 1KXOA 4D6AA 2CQAA 2JYOA 2WQAE 1I4HA 3BX8A 4OELB 3DLLA 4IUQA 4YCWA 2AUJD 4GOPA 3TP8A 2F0UA 1RTNA 2F0MA 3IAYA 4A3MH 4E6IA 3GTJB 3H94A 1KHIA 3OMGA 5K5PA 2A73B 4X3SA 5LL6S 2DUDA 4JCVE 3SDZA 4ZHDA 1EIGA 1E1TA 2B63H 1ICWA 3I90A 1EPBA 3TQYA 2GJ5A 4YGHA 2R74A 2L55A 4YIJA 4LKPA 3P1HA 4GNWA 1SYEA 1PH8A 2RTHB 3I8ZA 1LLRD 1SYFA 3HKSA 2JA5B 4DR1L 4FF1A 1I3QH 3J80i 1GX8A 1IHZA 4R4IA 2W2BA 3CCUA 3MVVA 4IFDI 4A3GH 5FLMG 5C44B 1VWLB 3ZW2A 1NAPA 3CBCA 3KDFA 1H95A 4LNQA 1AELA 1MI2A 3S60A 3KF6A 4BX5A 3J7AV 5LHY1 1ZKOA 1JR0D 4KV6A 1EY8A 1LNMA 4C5PA 3WOEA 3K5OA 4A3GG 1VQ8A 3BVZA 3NQIA 3DEPA 4JK1C 1MEPA 2UUCL 1YWDA 5K68A 4O49A 5M5WH 4JI4Q 3KLWA 1U9RA 1IYUA 2F0IA 3MWYW 5JVH3 3RLFA 1KGLA 4AQYL 2EE1A 2HIVA 4PG3A 2B2TA 3PIP3 4Y0SA 3WOFA 5EPQA 1KT3A 5ELNA 1SREA 1Y53X 3BYYB 2R93G 1CBRA 4DV0L 1H9SA 3T1HQ 2Y3EA 4DK1A 4B3RL 2A6HC 5L8NA 4JGLA 1JMZA 2QDLA 3C1FA 5CORA 1EQQA 4K14A 4QMGA 2CH4A 4POFA 1PH9A 3CPFA 2F0SA 2WAQE 2AT5X 1OBUA 1SWQA 5H9KA 3VG6A 4GN3B 1Z9FA 4FVMA 1HN2A 1OXVA 3NTIA 2A5BA 2SNSA 3OSOA 2A74C 1VWOB 4LAAA 4OS8A 4AZOA 3PUYA 5H9NA 3SR1A 2Q2HA 2OL6O 3CCJA 3K5NA 1OEKA 4AIMA 1OXUA 4ZCKA 2RTEB 2K23A 1IL8A 1ZEQX 2A6EC 4JI3L 4ZQ3A 3KJPA 3S1MB 1A0IA 4ORYA 3AB9A 4LF5L 4HSPA 2PQEA 4BVMA 4DNIA 3CMPA 1YZ6A 3E0JA 4I65A 3NQ3A 5IE8A 1A57A 1BNZA 2R6GA 1SE8A 1R4PB 4YY3L 1AH9A 1D7QA 1O80A 4ZJ0A 1EEFD 1G6ZA 4R4CA 3MXNA 4I3BA 3WJCA 1GUTA 1XNQQ 5F6ZA 5JJZA 1N8RC 4RFBA 3OD9A 4M1UB 1MK5A 1V9PA 2D0OA 3QOLA 1D2UA 4U46A 1QCBD 4ZFXA 1TS3A 1O1UA 4M7MA 5I9PA 1DV9A 4KI0A 1EZ6A 1C9OA 3S9WA 1G7NA 1IFBA 5C0NA 2OFBA 1EU3A 1LTID 1LUQA 3SGIA 1FGBD 1MUPA 1LDQA 5F1EA 2FT9A 1MKHA 2L15A 4P74A 2HHHQ 4X62Q 4LF4L 5BYPA 2ZJPA 1Z6HA 3WDNA 1P6PA 4I6SA 5CBEE 3VHHA 1SWJA 4I95A 4HIMA 3C2PA 4G7OC 4R8IA 2A8VA 4GUZA 4KN7C 1DOLA 2JP1A 2RTNB 5EBDA 4ZUJA 4JBWA 4MVLA 3I55A 3NTHA 2A5HA 4GGZA 2FS6A 1F9RA 4IO9A 5C5LA 4LF7L 3FYFA 1S4ZA 1I4RA 2XN9C 1TS2A 2NVYH 4XMDA 5LL6X 1PBYA 3FELA 3H09A 3I91A 1RJTA 1XNRL 4C1NI 4R8NA 1ZYRC 3UE0A 1ASZA 1QFTA 4LUVA 2B29A 1BR9A 3OIQA 3UDIA 1UWVA 1SWUA 3DHQA 4ARHA 2OEOA 4C3JB 4GDAA 2AWOA 3PUZA 4QB4A 4L1NA 2NWGA 1J9OA 1VQIA 1XWEA 2MUYA 2L4NA 1SRUA 1Q8KA 4ABNA 4RA8A 1HR0W 3IFTA 2EZVA 4GETA 3PO3H 2L1BA 3B2HA 3S1NH 4QCLA 3KQ0A 1BM5A 4OGQC 5JEAH 1X8PA 3TGBA 5DNFA 1LF7A 3H0GG 2A2GA 1EQDA 2RDFA 2ZXPA 4XQNA 1KL5A 3BRNA 4ULLA 4PV1C 1EYDA 4JI2L 3ZUIA 2AMCB 5C44G 4AZQA 2ZTEA 4L5QA 3VG3A 3SLTA 1VWCB 3AEHA 3GDEA 1HR0L 3B2IA 1U5KA 1CKNB 3A8IE 1CBIA 2CZUA 1EY4A 3SVMA 1YNJC 2KBNA 5IWAL 1XMOL 1PXUA 4ZHGA 1AB0A 3NTKA 4BBSG 2FGSA 3GTPB 4OWTB 3Q24A 3CCSA 1FR3A 1SN8A 3M3YB 4JI7Q 3EYCA 3H3VC 3PF4A 1QUQA 2L0CA 4A3BH 1Q86C 2JA8G 2IX3A 4C3IH 1EY9A 2VS1A 2VY3A 2B2WC 4LF8L 2JA7H 2Q8TA 2EVBA 4YBUA 5H8TA 4A3BG 5HAEA 5C5MA 1K3RA 4BY1G 4C3IG 1BDOA 4DV6L 2JA7G 1TWGH 2FINB 3SAOA 5IYCH 1EU4A 4MVEA 4A3LG 4IAXA 2ICEC 2JEBI 5ELCA 1HBQA 2MHDA 5C4JH 2F0QA 4AQYQ 5CGKA 3SZHA 5IYCG 2K5NA 1NQNA 2POAA 5J22A 3BSZE 1VWRB 1KDAA 4DXFA 3OIPA 4BX6B 1GUGA 4ALOA 3PK2A 4LF6L 3H91A 5KIXA 2KQ3A 4PMBA 3SE0A 4B3RQ 3F2DA 3IFDA 1VQ4A 3KFGA 1G2TA 3MHBA 5KIDA 3S2HB 4LFBL 4OWWB 4DPGA 4OEMB 2JSOA 2WAQB 3NBHA 1K9MC 3I17A 1BCPC 1B50A 4FF3A 2V4DA 5C3EB 3GV6A 2DM5A 3HOWB 2G79A 3HOLA 2C5CA 2FKJA 5T1IA 2D5DA 4CDCC 2BDOA 5LMNW 2GTLM 3WJDA 2JJQA 2DJFA 4CKBA 4Y0PA 4GNXA 1B44D 4CBVA 3L2PA 1MGSA 3TEHB 1SWNA 5KGUA 1CUKA 1I4XA 4J15A 2R7DA 4ZK9B 4POGA 1DM0B 2IX0A 3FIQA 2QCPX 3WYQA 4OHJA 1D5ZC 1TVXA 4CJ1B 3K7AB 3RN2A 1KLUD 1VF7A 1JIWI 1GX9A 4CPHB 5H1SE 4JV5L 2IZJA 2MO5A 3J81E 1TY0A 4AZMA 3N6RA 3KFIA 3HOXB 5LMNL 1PZID 2Z4IA 5C3XA 1B4MA 2IY5B 4FF4A 4K19A 3Q6LA 1KQXA 4YHHL 3T1YQ 2A8GA 2MWHA 1D5MC 3ONAB 2O62A 2KEDA 2I5MX 2XRQD 1AZPA 4DR4L 1E3PA 1ESRA 1Y1WH 4BS9A 1NSNS 4O4SA 3D9WA 4FYDA 4IQZA 4YH0A 1PFBA 4YGZA 4BX7B 2WPUA 5CC4A 4K8JA 1HHVA 2EYLA 1H9JA 1BJ7A 1LFOA 2A5CA 5IP7H 3H6MA 1FVIA 1MIUA 5HBSA 1UNSA 2NVQB 3VE2A 1AVEA 1HFGA 5JOBA 3KFFA 5K06A 1G291 3T2XA 4MZ9A 1WCMH 1ERXA 3BZKA 3FPUB 3C3LA 4HJ8A 1SNMA 3RNUA 4JOIC 3STBC 1KD1C 5GQOA 1DOMA 1EWHA 4A3CH 4P2CB 5HA1A 4L5RC 1OPAA 1TW4A 4A3JH 1AP0A 1OEJA 5LMUL 1VWJB 1CA5A 4I60A 1E0BA 3MVFA 4RKLA 4U8UO 2JN4A 1U4RA 3VYTA 4A3CG 2RTQB 2HLVA 2TSSA 3HWFA 1PRTC 4B3TL 1PFNA 2CW0D 3APUA 2GVBA 4BY7H 1NP4A 3T6FA 5BN3A 1EFID 1O78A 1YITA 1QG5A 4DR2L 1HQQA 3I7FA 4FXKC 3HWDA 4KHVA 5BR8L 4DV4Q 1FDQA 4ZLTF 3HK1A 3U9PC 5IIFA 3T53B 3D0FA 4CJ2C 5AJ3Q 1TWAH 2PQAA 2Q4NA 3AU7A 4H7BA 4TKOB 1SWTA 3BDCA 2OVAA 5I6WA 2F4IA 3D6CA 3RZDH 4JI1Q 1VQCA 1SXYA 4IABA 1SA8A 3BDRA 1HY2A 1DFVA 1E00A 1SWSA 5FO8B 2UUAQ 2JGSA 1SNCA 2Z9HA 2X8TA 1LTGD 4GJVA 4N7CA 3RZOH 1CRBA 3V05A 3C76X 1J5EL 1BSOA 1VQEA 3WZPA 1B9NA 2BT9A 5JVG3 1A3TA 1SY2A 3O2YA 1BRPA 4JI2Q 4HPDA 2LKVA 3U9SA 2FS7A 4CDDA 5CE4A 5DAUA 1JORA 1TVQA 2RTCB 4QQ1A 4EQ5A 2VZAA 1U0LA 3JC66 2EY2A 3I4LA 3FKIB 1CI3M 1SWPA 2ZTCA 4GH7A 1Q8IA 2K28A 1V1OA 4KKTA 2WP8J 3J81L 5C0XI 5C0XJ 1N36L 1QY2A 1SXTA 1VYFA 3CKFA 4CDFA 3VU1A 4U8UN 2ZM6Q 4OELA 3RR5A 1TIID 2PW5A 4A60A 4DU9A 5FO9B 2L9CA 4HIKA 3M7NA 5CV8A 1LIEA 1AN8A 4LF8Q 1EY6A 3NX2A 2HD3A 1BCPB 2F0TA 1TWFH 3TGAA 3I4NB 2L67A 5M3FB 5IT9E 1UE5A 1VWKB 1HZCA 2NZ1D 3ZYYX 1G6PA 2NNQA 3S17H 3D95A 1VWEB 3WXQA 1A63A 1VQJA 1PTOD 1SROA 2KJXA 4PSQA 5D8JA 3HOWG 1ZNEA 2EQSA 3EW2A 1LPJA 4GK9A 1WTWA 3GTKB 1YWBA 4YGGA 3J7A5 1QOHA 2A68D 2AH7X 1HZ9A 1H9KA 1HTPA 3HOYB 4KHPQ 1YJWA 4AW8A 1X8UA 3CC2A 3VYRA 5EJWA 1JMXA 3S5VA 1HBPA 3HZXA 4OXPA 3ZW1B 3KUPA 5EPKA 1K3BC 4LFCL 5G3LD 1SWFA 1LTTD 3LWEA 1WFQA 5F6BA 1N32L 4KD4A 3U50C 1K83H 3TP7A 1FELA 3HTYA 1HMSA 4HJ7A 1RCVD 5C4XH 2IJ0A 2K62A 1N9WA 4Y52H 2JU3A 3PPTA 1GD7A 1T5EA 2RTKA 4XQQA 1GXAA 5IO7A 2RQXA 3BZCA 3E3XA 4JV5Q 4Y7NB 3MM0A 3UEVA 1G74A 5C4XG 1II3A 4A76A 1VQFA 3OTOL 3A8JE 5IGGA 2GA4B 2F3VA 4UY8C 3NK9A 2I5LX 4JW0A 1LTBD 1GKHA 5NUCA 4A3IB 1VQ5A 1D8LA 1NDJA 2F09A 5DPQA 5HCDC 3HKZG 1IBLL 1V1PB 3D4WA 4RCOA 1XMQQ 4DR4Q 4O42A 3V96A 1ASYA 1HMRA 3UAQA 4X3KA 4IOAA 4TNNA 2UXCL 1L0WA 2BSZA 3Q0AA 2KTDA 2OZQA 4B08A 2VXWA 2Q8RE 1B1ZA 4JNJA 4QGVA 1I50H 1QZHA 3E5SA 3H15A 2MHVA 1VQHA 3GTGH 2JEAI 4JYAQ 1UEAB 4QGUA 1MSGA 2DJGC 5JPNC 2GC9A 2ZJQA 3CXCA 4JI6L 3ZWEA 1X3QA 4LZUA 1RTOA 2KEEA 3CQZB 5IP9G 3T2WA 2G9DA 3K57A 4V190 4A3MB 3RDSA 3F9DA 1GGLA 3B2KA 5IGFA 5LMUQ 5FK9C 1T0VA 3E3CA 5BVTA 4N9TA 1A3VA 1VQLA 5IO6A 3R8BA 2ZJRA 5K67A 2PI2E 3EQLC 3SZJA 2B63B 1HXYD 1B3QA 1K28A 1SYDA 5IGCA 4OO1I 1Y8OB 1HNZL 4BCSA 3NE5B 1JJCB 3UDFA 1Z47A 4DV1L 2DY7A 4DR2Q 1SXWA 4NP1A 1EUJA 1K8GA 1HTLD 4RMFA 3RY1A 4IB9A 3KK7A 1PTOH 4ZUIA 2R92H 1F2MA 3VYUA 1DCZA 4IFDH 4XT1B 4MTKA 3IFBA 4TRDA 4A3GB 5ELOA 1HNWL 3U0DA 2R92G 1F9SA 3CHBD 2X55A 1FTPA 3FLLA 4JBJA 4A75A 3P6DA 3CCMA 1E06A 2CBRA 1MSHA 1D1IA 1LTLA 3OE3A 2X6GA 1YVCA 5L8OA 4C3HH 1J5EQ 1ONLA 3SLJA 3D96A 3A56A 1DC9A 5IGEA 4EQOA 1H9RA 5M5WB 2VB2X 4YWKA 4C2MB 5E1FA 3L7ZC 4XMEA 4RGTA 2QO5A 4ZCBA 1B56A 1NGLA 2BDNA 1RXKA 1JWMD 4G4KA 4DR3Q 1SMYD 3QJYA 2VUMH 1QABE 2VDFA 4JPBW 5LJGA 2RTFB 1ET6A 2B2VC 4DR6L 2F01A 1LCVA 2NP1A 1DF8A 3F8TA 3D3RA 3RLNA 1DZPA 1A2UA 4K5WA 3I72A 2Z4HA 2OFRX 2K75A 1MX8A 3P6EA 4GLXA 2D0PA 2KTSA 2F0NA 3K7UC 2X6LA 2AL0X 4NLIA 2PCFB 3FR4A 2B2YA 3W5OA 1TY2A 3S15H 1GKAB 1ZNGA 3J80c 3CW2C 1VMCA 4K0KL 1DGSA 2IZCB 3HOYG 3DTQA 3MAQA 1SE2A 2Q8IB 1Q81C 5HTEA 3BZDB 4ON1A 1L0YB 3AKNA 1I5FA 5A35A 2Q9SA 1CKNA 1UEBA 4JC0A 1U4PA 3EROA 4IALA 5L37A 2FTBA 2Z6KC 1FD7D 1TU2B 5ELDA 2RD7C 4MIRA 5K36G 2YMSA 4V0BA 1L0XB 3HWEA 4HIDA 2L68A 2L11A 3QWNA 1LDOA 1N9MA 5JJIA 2RVLA 2JE6I 1R0UA 4ZHFA 5HZ8A 5B3MO 4GS3A 3STNA 1HXZA 3OWEB 2HCCA 1N33L 4GKKL 4TQUS 1BBWA 4UPAA 1TKWB 1RAVA 1N7YA 3RKGA 4X6AH 3QO2A 5E7NA 2EPBA 1JE4A 1KXLA 4N9PA 2NN6I 3T4AC 5KHPA 2MF6A 5FLXc 2I5VO 3EM0A 2RTPB 1ENAA 2CVRA 1RXHA 2K50A 3BY0A 1BBUA 4A3FG 5DM63 1FNVA 1SBBB 4DN4M 5KYLA 3P24A 5IYDH 3EC5A 4ALBA 1DJRD 1LTAD 4S3SA 1D6EC 2KVMA 2RF4A 2YTVA 3RDUA 2X32A 4BX6A 1UREA 4OIKA 2X69A 4JO6A 3F1ZA 3T16A 3AUMO 3J81i 4A93G 1YJ9A 4DGZA 3KLSX 1JMCA 1CQFA 2NTSA 3S2DH 4HTHA 4COTA 4OEMA 3GO5A 1BXTA 4DXGA 1VWMB 2CBSA 1AEXA 1OXSC 4DV5Q 5EPJA 1S2PA 3AKMA 4N7DA 1SE4A 1PH4A 4AH6A 2MGSA 3M4QA 2VQFL 1VWIB 5KNDA 1CM9A 2M9VA 3EW1A 2Z6BA 4L8JA 5E4WC 4A3MG 1IBKQ 1KT7A 3FEWX 4HWMA 4CPHA 4KLKA 2E2IH 1XPUA 1STPA 2A69D 5M9OA 2D9UA 5GAGC 2B63G 3H0GB 4JI6Q 2AMMX 2A3FX 2OL8O 3PO3B 4EKVA 2KA7A 5KYIA 4KK7A 5CMDA 1MOYA 3CCLA 4DUYQ 4OL7A 1I78A 2KOLA 3K0XA 3VR5A 3H3VI 4GD9A 2RQ0A 2ALYB 3F2UA 3S16H 2P5ZX 2HNXA 4UP9A 1AVGI 2JQOA 4BX7A 5KICA 5IO5A 4WFVA 3P6HA 4F88A 1SRJA 4RGMA 3TZUA 3B2JA 4RHSA 1SMXA 2K03A 4BBSB 4IB7A 3CU7A 1DXMA 4DV1Q 2AKWB 3K58A 4EXZA 2F3IA 3CPWA 2I07B 1XPRA 2OWOA 1UE6A 3CMAA 5J3BA 4LUOA 2JA6H 2LBAA 3S5XA 3IRBA 2JA8B 1ESFA 4NXML 1STSB 1Q1BA 4GKJQ 3P20A 1TT2A 4YVBA 5JAVA 1VQ9A 1X8OA 3DWPA 1Y1VH 4ZGFA 2BA1A 3ZW0B 4A3BB 1K8AC 3LX0A 1D5XC 2EDGA 4BY1B 4C3IB 2JA7B 2B2UC 2XIWA 5DM73 1B3AA 4I9RA 4F87A 2FHNX 5CYUA 2X4MA 1NE3A 3P6GA 3ZZVA 4XMHA 2YV5A 1EIFA 2LY7A 2BH8A 3R2TA 1JOQA 5BVQA 3WZQA 5AJBA 2N8NA 1S5BD 3CAMA 1Y69U 1TWGB 1I94L 1EALA 5EGTA 5D45A 1UE7A 3WBGA 1F9QA 1PA6A 4ORXA 2OQ0A 2XRSD 2X8SA 3CCRA 2YU9B 4JI5Q 1PM1X 2F0OA 1SWBA 4KY5A 5M5YH 5HZ5A 4JVZA 1VDZA 2NBFA 2LSSA 5IOCA 3W2DA 4X64Q 2JMBA 3NPOA 4EVOA 4QYPA 1UAPA 1JWSD 2AWNA 2MNAA 4GN5A 4QY7A 4KTAA 3TP6A 1U4MA 1STGA 3DMUA 2IZKA 1LCWA 1I4GA 1SWOA 4HEDA 1RSTB 2QEXA 1SWDA 5CYBA 2CFMA 2J7ZA 3C46A 1LIFA 2XKLA 2K05A 1Y9LA 4K0KQ 1B8AA 2I46A 1VS0A 4NP5A 5B29A 3P6FA 3GTLH 3DUZA 3JSQA 3TRZA 2ZAIA 2P8GA 3FA7A 2UXDL 2LFOA 2E75C 2Q2TA 1X89A 1UYNX 2EJFC 1OO9B 4AYBG 4ZKCB 4JI0L 1YP6A 4NV8A 5C6AA 1RD9D 3CRKC 3KJOA 1HNXL 4WJ3M 4EEJA 3HKZE 2H5XA 4RHRA 5B5FA 1ENFA 4CK4A 1SFOH 1ZNLA 3BU9A 4QF4A 1ALBA 4GOPC 1N33Q 3I4OA 1A3YA 4FBOA 1SNDA 4O1NA 2WKCA 3ZQ3A 4CDCA 1VQGA 5CV7A 1GX3A 4NW2A 1YIJA 4YKOA 3VG7A 1SNQA 2CW0C 1GXDC 3OOCA 3FMZA 3FRPB 3ZJYC 4BXXH 1LIDA 5BN4A 4NKLA 3QOJA 2VQEL 2AUKA 3A54A 4YCVA 3WOVA 1VQNA 4L5TA 1PH2A 4CPFA 4DR5Q 1B53A 4Z2VA 2OYBO 1WCMB 2PNRC 3NR3A 4X3TA 1K0RA 1FEMA 1X8QA 4TKHA 3PIOA 2C1SA 1MHWC 3VR2A 4D6BA 3ZW1A 1SDFA 4A3JB 1LT3D 2NTTA 4BBRH 3NWTA 4OS0A 4PJ2A 4IZ8A 1P16A 4IURA 3FPPA 1BSQA 2FWVA 3GTJH 3PECA 1SMPI 4UU2A 3M4PA 1O7YA 4BY7B 4GGTA 2NVTB 2NYZD 3PO3G 2FHLA 3MA2B 1EYGA 2F0KA 2XGTA 4IAWA 5JEAG 4KC8A 1SRFA 5ELFA 5LJCA 1JJGA 3PQSA 1E1OA 3FP9A 2F0EA 1BKBA 4I9SA 2F52A 2B2TC 1PFSA 1HH2P 1Q3LA 2OVDA 4HIOA 2JA5H 2FR3A 1TWAB 4KT5A 4QYNA 1IYVA 1LV9A 3RZDB 1W6KA 3MC0B 4DR1Q 1PMPA 4JOIA 4NDXA 5D48A 1O7LA 4UAIA 3RZOB 1IYJB 3HOZH 2OY1O 1VWGB 4R0BA 3I4MH 1V1PA 4NNTA 1NUCA 4JG2A 4Y0RA 3PV0A 5H9LA 3DSZA 4U68A 1CHQD 3PF5A 1SY1A 3HOZG 2K1BA 3I4MG 1A2TA 3V2TA 4ZRZA 4DR7L 3WYPA 2UUCQ 2CKZB 1PTOC 1AE3A 1PH6A 2PMZB 4LK1C 1WOCA 2F0HA 4C1NK 3FENA 5C0XH 1PH5A 5IRWA 1HXLA 3Q23A 2WACA 4U673 1D2BA 1I6HH 2A68C 1XTCD 2E8GA 2L5PA 2BHVA 2K14A 4NXMQ 1RBPA 1AE2A 3APVA 1JOOA 4INNA 3GTMH 2LKKA 4P75A 4DV0Q 4Z2PA 1CSQA 4KKSA 1CA6A 5JJLA 2E2JH 5AJCA 2K6AA 3SXHA 3S24A 5IXGA 3OW7A 1ILQA 2ZXRA 4ODGA 1TWFB 2IZDB 4AZRA 4B55A 5CBAE 4ZAIA 3VA7A 2HKDA 1I94Q 3HOUH 3VYSA 1SWRA 4ML7B 3S17B 1WI5A 2IZFB 3M9BA 2N93A 1IZ6A 2AT8X 2X56A 4DFAA 2CWPA 2QILA 1IKLA 3ERSX 3HOUG 3JQOA 4FXGC 4I3CA 1EIHA 3LWUA 1I9HA 2IW3A 3W1GA 4BA2I 3A55A 3S1MH 4R4QA 2ENBA 3EBKA 3MG5A 4OMWA 4JI3Q 4KY7A 2RTBB 1ET9A 1YHBA 3PGZA 4YKMA 3HOEA 3TGCA 4TLJA 4LF5Q 5FQ6E 1STYA 2F1MA 1F2LA 1QQSA 5BVSA 1S40A 1PH7A 3TF6A 4BOEA 1G51A 4DAVA 4R1JA 4GOPB 4OS3A 2OFMX 1IBML 2EXDA 4YY3Q 1AFPA 1VWBB 1N43A 1IW7D 2ZSCA 4B3SL 1MVGA 1K83B 4K5XA 2QOMA 1Q1EA 1G91A 4RG1A 1STRB 2OF8A 2LFNA 1WTVA 4PZ7A 2R7ZH 1VYOA 1QJOA 5C4XB 5D4AA 5EAYA 1Z24A 3S26A 4AYHA 1QG7A 2UXDQ 1UUPA 1Y1WG 1I05A 1VQAA 1DZMA 5L8IA 2CCZA 1JV4A 1U0XA 1WJJA 3HKZB 1I04A 1C7YA 5IP7G 4LF4Q 1KAAA 4HJAA 5B5GA 2FJ2A 1BQQT 2EY6A 1GKAA 3BJUA 4IUTA 5AFWA 3NX1A 1NMFA 3LNNA 1WCMG 3CQNA 4EQNA 4K8IA 5IRAA 2KW1A 3VPJE 1NJIC 1DONA 2Q2PA 3BS2A 4TKJA 3RDXA 2B3GA 3QG1A 4LF7Q 3FA9A 2C9OA 4PZ8A 3DWAA 1AQBA 3U9OA 4A3JG 1NBXA 1S44A 2FXQA 2OF9A 3JAMc 4XYOA 3GTOB 1W4TA 1X3PA 1JJ2A 5JPMC 3GTGB 4RGNA 1M4VA 1AW7A 1C8CA 1NP1A 1U18A 2WSJA 1XNRQ 2XSTA 2LXKA 3PIPA 1VQ6A 3EIVA 4N8X1 4C3JH 1WD1A 1B2TA 2K4KA 4BY7G 3S1QB 2E76C 4LUZA 2BE5D 3S14H 3VG2A 3AEVA 4YFRA 1EIOA 5IGDA 4B9XA 1KRTA 1UZ2X 2MM3A 3SLOA 5B10O 2RCNA 4Q5VA 3KVNA 2EY1A 1J6QA 2CM9A 3VGWA 1EY5A 5JEAJ 3KFHA 4HJ5A 1ZRYA 2EYOA 3GQBA 4N8FA 4OO1H 1X55A 1RF2D 1LELA 1N9YA 4GDZA 1B70B 1SMYC 3TBIB 1SWEA 1X32A 3T56B 2C1QA 2ZT9C 3NELA 5I2XA 2CM4A 1PTOB 1SJED 2R92B 3K0YA 5C4ZA 1CKMA 3UI2A
chains in the Genus database with same CATH topology
1YWAA 4FXDA 2GTFX 4TJZA 5FLXE 1RKNA 4IMNA 4G7ZC 1OEEA 1QWYA 5DG4A 1SSOA 4ZH9A 4K2KA 1QWDA 2K5QA 3C77X 2QF7A 1PMRA 2K7VA 1MBYA 1ZNKA 3FMCA 3FR5A 2FHTA 1KLGD 3NUCA 2EYMA 1L6MA 1Y8NB 4QRLA 1KQWA 4ES7A 1XXGA 4BQUA 3GP7A 1Y8PB 3TP5A 5FOBB 1ZNHA 4HMJA 2SOBA 4HN7A 3CWKA 2M2LA 1HCZA 2SDFA 1EQTA 2F03A 2IT1A 3DWQA 2H1EA 4Q0FA 4ZHHA 2EXZA 3S15B 2MJ8A 1YP7A 5HZ6A 2D62A 2EOTA 2E2HB 2O5JC 1D1KA 3F6ZB 4ORWA 4CKCA 3KBGA 3MXPA 3SOTA 4K5VA 3J80L 4FBVA 4FGIB 4WFN3 3MFGA 1E02A 1Z7TA 3D4RA 3GD7A 4IB6A 2F0FA 3ZW0A 3FA6A 2PZWA 4H13C 1ML0D 3WVMA 1IKMA 3KZAA 1R4QB 4KN4C 1XX8A 2X46A 3R2IA 4A3FB 3IL8A 3ZUOA 4NYRA 2JW1A 1EL0A 5A2QE 4NW4A 5FFHA 1TXLA 2N55A 2KUMA 3S1RB 1GT5A 1TOWA 2X8FA 4XXEA 1EYCA 2EYPA 1A6XA 3O22A 1CJ5A 1LT4D 4YCEA 4A93B 3TDQA 1PRTB 3D97A 4M8AA 4ME5A 1KOIA 5FLXL 1GUOA 4KJOA 2A69C 4O4OA 1YUPA 4MHEA 5TSSA 5HURA 2RDGA 5D3IB 4MN3A 4WHIA 3RZYA 1NCVA 1LTSD 4QGXA 1IFCA 3ELZA 2WEXA 4J1MA 3TMEA 5I6YA 2ACOA 5HCCC 4CSBA 4IUVA 3MBTA 2FMCA 4ZR2A 1PZKD 3SEBA 1VMPA 2PW7A 3VG5A 1ADLA 1N0SA 1E2WA 3M4YA 3T1DA 3K6OA 1SXXA 2HYSA 1LABA 1KDBA 1I3QB 4MVKA 4O3ZA 1A3UA 5LJEA 3CQRA 2NNDA 1KT5A 2XWBB 5J1ZA 3PUWA 2K01A 3S16B 4IFDG 4OMXA 3WJBA 1EIIA 5F58A 1ML7A 3BVMA 1EEID 3BYTB 5EQ0A 1JZUA 4L6TB 1MD2D 2PYKA 3CRLC 1FE3A 2B8FA 4LMQD 1BEBA 3I73A 4MVIA 2PO4A 4TSSA 3TZDA 4C3HG 1MDCA 4GE1A 3NPPA 3C78X 4G7HC 1SYCA 1CT1D 1BCPF 4DQ3A 3PIO3 1Y1VB 4GU8A 1DOKA 3NQTA 1HQPA 1ZNDA 1STBA 2KD2A 5KEEA 2HDMA 5A2QL 5CV4A 3MTSA 3C1EA 5FENA 3F8AA 4FBRA 1LIBA 4O3YA 5FQ7E 5KNCA 2WIIB 1RDPD 2XWJB 5M5YB 2R73A 2GTLO 3FA8A 3K3LA 1KTKA 2RA6A 2HZQA 4Y0QA 3EA6A 1JOKA 2EJGC 1PDQA 5EKKA 3X3NA 4I3DA 4XMFA 2B2UA 4PMCA 1GUNA 4HCSA 4ORSA 1EI5A 4O3WA 2BS5A 4OIJA 4AYBB 3GTLB 4GKCA 2WWPA 2WEWA 3E6ZX 3SK6A 1GOZA 1G85A 1SNPA 4WFUA 1CFMA 3OBLA 2AQ2B 2BA0A 1OXTA 3FEKA 1FENA 3OMCA 3PH6A 5EZ2A 4GRJA 3MFYA 1T5XD 3LV4A 3L3OC 1PRTF 1JC7A 3EFXD 1F2YA 2JXMB 3G6JB 4F8MA 2DY8A 2GTLN 4A1HA 2ALLX 4DK0A 2VB3X 3OJYC 2K33A 1YNND 3OPOA 1AZQA 2NVYB 5LKEA 1JJJA 1C48A 2LMCB 2JU7A 2EU7X 5F7GA 1GM6A 2JN3A 2XSCA 3IKJA 3VA5A 1EW3A 2OXPA 3Q22A 3K59A 3STKA 2RCQA 4HPAA 1HQRD 4O4XA 4HPBA 3UEWA 2MP1A 4CHTB 4U8UM 3FR2A 4YCHA 4BBRB 1LO5D 2A13A 2FFKB 1WTPA 3S1NB 1STAA 4FO2A 4AZNA 4A1YA 5CR3A 3VG4A 1WTRA 3SK8A 1VPRA 3MZ5A 1SE3A 3APWA 4PQXA 1JICA 3J7AF 1GJXA 4ZH6A 4RKBA 4LZVA 3OHXC 2F0GA 1ERBA 4RH6A 4O3XB 2SNMA 3U03A 4WORA 1QY1A 3FW5A 2EYFA 1T68X 4IFDJ 2RKSA 3IA8A 3HOZB 3EMMA 3I4MB 3NSWA 2B2YC 3KBXA 3WJGA 3OWFA 3O19A 4QUFA 3A7LA 3RUZA 5EPLA 3MX7A 3N91A 4IN3A 3G7XA 1CHPD 1XKIA 5EDBA 1DYQA 4IUUA 3SK5A 1G2SA 4X3UA 4M6SA 5C4JB 2AQ1B 1I6HB 4NNSA 1SEBD 5J39A 1ACDA 2AT6X 1B4OA 3GTMB 1LT6D 3ERQA 4DNTB 1GHJA 5CV5A 5CV9A 4CJ0B 2E2JB 2EYJA 3JAME 1BLRA 4AZPA 1K8MA 3I70A 1EPAA 1HPCA 5LJKA 2BLGA 3L9AX 3HEJA 3BDOA 1IW7C 1F2ZA 2B2WA 1WVLA 3HOUB 4UU3A 2SEBD 3ITPA 2W2FA 5KRUA 1ICNA 2OT2A 4R9WA 4QIWB 3TN2A 2HUGA 1EZ8A 4L3RA 4O9SA 1QE6A 3BG3A 2WUTA 4LKTA 4QAEA 1BOSA 1WTOA 3P75A 1Q90A 1IKJA 2AT0X 1PBOA 3W3AA 3BVGA 2QOSC 1TR5A 1CZGA 4CV7A 4YDAA 1IKEA 2F0LA 1KT4A 2MPMA 1Y1WB 4GZYC 3MEHA 5FQ8E 3RSWA 2R7ZB 2H4OA 1X71A 2E74C 3R93A 2KECA 2AT3X 1F9PA 2L9HA 2G7BA 2BOSA 1KZXA 1HA5A 3TSSA 1BBXC 2B8GA 1DZKA 3PH5A 2BE5C 1XCAA 1E5PA 4ZHCA 5D47A 3NQKA 5HTDA 2F0WA 4YDBA 1QFVA 1V43A 2F0PA 5HA0A 4ZKBB 5HZQA 4H0LC 2RA4A 5D65A 2ICIA 3TZSA 3FVQA 1S5CD 2HQEA 3QIAA 3I0AA 4EQAC 2M00A 2QKIC 3HP3A 1JCKB 1EOTA 1IIUA 1O7ZA 2ZXOA 3S14B 3G7LA 4G57A 2KT4B 1QNUA 4RWSC 1LTRD 2ASNX 5H9AA 3JAML 1EY0A 3K5MA 3NP8A 2A2UA 1A2DA 4FQBB 4QZUA 3FEPA 1VYGA 4CKEA 1J8IA 2CHBD 4H44C 1SY0A 1OXXK 2RCTA 1QB5D 1XYIA 4FF2A 2QEJC 4HAEA 1BRQA 2R61A 2Z1CA 2WKDA 4IB8A 1JWUD 4J6HA 3P02A 4DAYA 4HMIA 4DAPA 5B27A 3HGBA 3D4DA 3D6WA 3T51B 4QUCA 2G78A 2F0JA 5C0XG 2KHSA 5EBCA 4XMGA 2JU8A 3BDLA 1S7DA 2L5TA 4KC7A 2YYZA 4A3EB 4ODDA 1HUMA 4A8ZA 1WTXA 1O1VA 1TWHB 4ORRA 1KNEA 3A7AB 1X8NA 3GAQA 4QGWA 1NR2A 2R3ZA 2OVEA 1FNUA 4KH8A 2NVXB 3BU1A 4HCEA 3RMHA 2M4LA 4XT3B 2F0DA 4BWGB 4ZYSA 2AQ3B 3WJFA 3GE2A 1I4QA 1WTQA 1PFMA 3QKGA 4MIUA 2A6HD 2JOZA 4ORUA 1JJXA 3ZI8A 5HZ9A 5HCEC 1Q12A 3LHNA 3NP1A 1ICMA 3JS1A 1V8QA 5M3MB 1KZWA 1SNOA 4KIIA 4K6DA 2QDBA 3HOVB 1DF3A 1U17A 5E3FA 2D2CC 5AEOA 1HFNA 4GNYA 1S5FD 2A6ED 4K6LA 4IBAA 1GT3A 4XTCS 1RLBE 2XNAC 5IGBA 2CZTA 4HSVA 2O2LD 1G8ZD 3SK4A 3VR4A 3FW4A 1RODA 3Q6SA 3URYA 1VF5C 1NR4A 4IUNA 2NUCA 1RHPA 5T1GA 4DNRB 1TWCB 4RAUC 5EKLA 1BBPA 5LJBA 1GT4A 1CBQA 1I50B 3PMFA 1ILPA 1SXUA 1FNWA 2KCCA 3VR3A 3KF8A 3J80E 5C3WA 4XQJA 5AQ6A 5C4HA 3M7GA 1QY0A 5CV6A 1H9SB 2FMMA 2HDLA 2WINB 4YBPA 2F3WA 3CKIB 4WBKA 4C3JG 1O8VA 3SHLA 3NADA 1Y9TA 3T13A 5BN5A 2QO4A 1K8OA 1KABA 4RCNA 1LICA 3VR6A 1DD2A 1STHA 3FDTA 5COYA 1SY3A 3ND8A 2L12A 2QM9A 4U9CA 4NYQA 1STEA 1SAPA 2O4XA 2HCIA 5JR8A 2PPBC 1B0OA 1I6VC 3CBSA 4QNIA 1ZYRD 2A0AA 2E2DC 4OO1G 2WQ9A 3B2LA 4YFQA 1H9MA 4KHZA 4L63B 4KY6A 2WR6A 4KD3A 4FP5D 1CTMA 3APXA 3GV3A 3N52A 2B39A 2G9HD 2O5IC 3R3OA 4FNFA 3L4RA 4ID6A 4EDEA 3NBIA 1C4QA 4ID2A 2QMIA 4C3HB 2R56A 3D8GA 2AKQA 3A8KE 2HZRA 2ACPX 3M4OB 3P7JA 2LS01 1W6JA 1EWCA 2VUMB 2F0VA 1GUSA 1I06A 1JB3A 1STNA 2PY1A 3BLGA 1YNJD 2Z8LA 1I4UA 3NQ9A 4BA1I 1EYAA 5LJDA 2DNEA 2W2AA 5F2DA 4KKUA 1LT5D 1TS4A 1LACA 3O13A 4EFGA 3PUXA 2BCOA 2Y0SB 5D14A 3NXWA 5EKIA 2DNCA 4XYQA 1A15A 4RUNA 2EYHA 1BF4A 2YG2A 1M8AA 2B2VA 2WV6D 4K2LA 4IMOA 4HR7B 1E2ZA 4PMWA 1S5DD 1IW2A 3HG9A 4WRDA 1I4PA 2K04A 1VCIA 4F7XA 1HQMC 3J7YW 4WJWA 2IWHA 5HWZA 1TS5A 1PYWD 2J4XA 1F77A 1BCPD 3D31A 3RWXA 1YNNC 3VE1A 3K5LA 2NN6H 5E4XA 1CQVA 2FR2A 5EEDA 1DZ1A 1D3SA 3RBYA 2NN6G 3PO2B 3M85A 2FRSA 3DEOA 1E2VA 2RBMA 4EQPA 1KNAA 4A3KB 4O4UA 3MXUA 5D3DA 3S2DB 2RSOA 1HA6A 3HS0C 1YWCA 2WB1B 2LA7A 2FLJA 3WJEA 3KLSA 4J8QA 3P6CA 2IX1A 5FKAC 1JBHA 4DF7A 3UEUA 4QZTA 3BS1A 3PEDA 1S5ED 1SYGA 3QB3A 3UEXA 1QILA 5HGTA 1HMTA 2IL8A 4ILWA 1OPBA 2ID0A 4C56C 2E2IB 3EJIA 1DZJA 2K32A 4XIGS 1PLFA 2LB6A 5I9OA 1H91A 1PTOF 4TQ2A 5IT9L 1EXSA 5LJHA 3EVQA 5KNBA 5I4DA 1B9MA 2OVSA 1PRTD 2ZAGA 3ELXA 2RN4A 4NMZA 1TQOA 1OBPA 5LKFA 5ELBA 1SJHD 3KLRA 2JA6B 2BS6A 1R9TB 3HRZC 4NLJA 5G3LF 4KJNA 3NBXX 3NHHA 1JYJA 5ELEA 2J0TD 1TOUA 5IODA 1SYBA 1KT6A 1BSYA 5EDCA 3I3CA 3GTQB 3CR6A 2LBVA 2NNEA 1B8EA 2XVSA 4I7ZC 4B9WA 1HUNA 2VNUD 2K5DA 3HWGA 3RD4A 1KDCA 4YFPA 2ANSA 3PP6A 1PZJD 4RGOS 4GZVA 1BWYA 2R93B 1A18A 2TMPA 3ND9A 2RDHA 4RUUA 4KMUC 3DM1A 4YMYA 1ENCA 4UDUC 5FAZA 2KCNA 1QNKA 3H3IA 1BUVT 4HPCA 4XMCA 5ISRA 2HMBA 4HFOA 4PNYA 4CGYB 1CK1A 1FYCA 1JYDA 4MISA 1G5WA 3EBWA 2X45A 3PUVA 5DEHA 1U4LA 4A3DB 1MX7A 5K36H 2IPKD 1T8VA 4ZGUA 4LJZC 3NWSA 4XDXA 4DA2A 1EQVA 3PQUA 1BO0A 2RSNA 4U3QA 5EEEA 1GHKA 2PZTA 2OF1A 2NB0A 5FO7B 3X3MA 3AMUA 2EJMA 5I2YA 2N88A 1SFOB 2Q39A 2IFBA 3DXJC 1ZXTA 3MXGA 1EY7A 4IUPA 2Q2MA 1GT1A 1EUOA 1GUWA 1LKEA 1JQYD 1CZWA 1HRJA 2E4JA 2QO6A 4Z9CB 4KCAA 1OBQA 1YIVA 1WD0A 4DQ4A 3BX7A 2MJIA 2EY5A 4EGVA 1PEEA 2F73A 5M5XB 2K5WA 1CBSA 4LQZA 2DN8A 2PZUA 3V8UA 4TKBA 3STMX 1KXOA 4D6AA 2CQAA 2JYOA 2WQAE 1I4HA 3BX8A 4IUQA 2AUJD 3TP8A 2F0UA 1RTNA 2F0MA 3IAYA 4E6IA 3GTJB 3H94A 3OMGA 5K5PA 2A73B 4X3SA 5LL6S 4ZHDA 3SDZA 1EIGA 2GJ5A 1ICWA 3I90A 1EPBA 4YGHA 2R74A 2L55A 4YIJA 4LKPA 3P1HA 4GNWA 1SYEA 3I8ZA 1LLRD 1SYFA 2JA5B 4FF1A 1GX8A 1IHZA 2W2BA 3MVVA 4IFDI 5C44B 3ZW2A 1NAPA 3CBCA 1AELA 1MI2A 3S60A 3J7AV 5LHY1 1ZKOA 1JR0D 4KV6A 1EY8A 1LNMA 3WOEA 3K5OA 3BVZA 3NQIA 3DEPA 4JK1C 1YWDA 4O49A 1U9RA 1IYUA 2F0IA 3MWYW 5JVH3 3RLFA 1KGLA 2EE1A 2B2TA 3PIP3 4Y0SA 3WOFA 5EPQA 1KT3A 3BYYB 1CBRA 1H9SA 4DK1A 2A6HC 5L8NA 4JGLA 5CORA 3C1FA 4K14A 4QMGA 2F0SA 2AT5X 1OBUA 5H9KA 3VG6A 4FVMA 1HN2A 1OXVA 3NTIA 2SNSA 3OSOA 2A74C 4LAAA 4OS8A 4AZOA 3PUYA 5H9NA 3SR1A 3K5NA 1OEKA 1OXUA 2K23A 1IL8A 1ZEQX 2A6EC 4ZQ3A 3S1MB 4ORYA 3AB9A 4HSPA 2PQEA 4BVMA 3CMPA 3E0JA 4I65A 3NQ3A 1A57A 1BNZA 2R6GA 1R4PB 1O80A 4ZJ0A 1EEFD 1G6ZA 3MXNA 4I3BA 3WJCA 1GUTA 5F6ZA 5JJZA 4RFBA 3OD9A 4M1UB 3QOLA 1D2UA 4ZFXA 1QCBD 1TS3A 1O1UA 4M7MA 5I9PA 1DV9A 4KI0A 1EZ6A 1G7NA 3S9WA 1IFBA 5C0NA 1EU3A 1LTID 1FGBD 1MUPA 5F1EA 2FT9A 5BYPA 1Z6HA 3WDNA 1P6PA 4I6SA 5CBEE 4I95A 3C2PA 4G7OC 4R8IA 4KN7C 1DOLA 2JP1A 5EBDA 4ZUJA 4JBWA 4MVLA 3NTHA 2A5HA 2FS6A 1F9RA 5C5LA 3FYFA 1S4ZA 1I4RA 2XN9C 1TS2A 4XMDA 5LL6X 3FELA 3H09A 3I91A 1RJTA 4C1NI 4R8NA 1ZYRC 1QFTA 1BR9A 3OIQA 4ARHA 3DHQA 2OEOA 4C3JB 2AWOA 3PUZA 4QB4A 4L1NA 2NWGA 1J9OA 1XWEA 2MUYA 2L4NA 4ABNA 4RA8A 3IFTA 2EZVA 4GETA 2L1BA 3B2HA 4QCLA 3KQ0A 1BM5A 4OGQC 5JEAH 1X8PA 3TGBA 5DNFA 1LF7A 2A2GA 1EQDA 2RDFA 2ZXPA 4XQNA 3BRNA 4ULLA 4PV1C 1EYDA 3ZUIA 4AZQA 3VG3A 3B2IA 3A8IE 1CBIA 2CZUA 1EY4A 3SVMA 1YNJC 1PXUA 4ZHGA 1AB0A 3NTKA 3GTPB 3Q24A 1FR3A 3M3YB 3EYCA 3H3VC 2L0CA 2IX3A 1EY9A 2B2WC 2Q8TA 2EVBA 4YBUA 5H8TA 5HAEA 5C5MA 4C3IG 1BDOA 3SAOA 2FINB 1EU4A 4MVEA 4IAXA 2ICEC 2JEBI 5ELCA 1HBQA 2MHDA 2F0QA 5CGKA 2POAA 5J22A 3BSZE 1KDAA 4DXFA 3OIPA 1GUGA 4ALOA 3H91A 5KIXA 2KQ3A 4PMBA 3SE0A 3IFDA 3KFGA 1G2TA 3MHBA 5KIDA 3S2HB 2JSOA 2WAQB 3NBHA 3I17A 1BCPC 1B50A 4FF3A 2V4DA 5C3EB 3GV6A 2DM5A 3HOWB 2G79A 3HOLA 2C5CA 5T1IA 2D5DA 2GTLM 2BDOA 3WJDA 4CKBA 4Y0PA 1B44D 4CBVA 1MGSA 5KGUA 1I4XA 4ZK9B 3FIQA 1DM0B 2IX0A 2QCPX 4OHJA 1D5ZC 4CJ1B 1TVXA 3K7AB 1KLUD 1VF7A 1JIWI 1GX9A 2MO5A 3J81E 1TY0A 4AZMA 3N6RA 3KFIA 3HOXB 1PZID 2Z4IA 5C3XA 1B4MA 4FF4A 3Q6LA 1KQXA 2MWHA 1D5MC 3ONAB 2O62A 2KEDA 2XRQD 1AZPA 1ESRA 4BS9A 1NSNS 4O4SA 4FYDA 4IQZA 4YH0A 1PFBA 4YGZA 5CC4A 4K8JA 1HHVA 2EYLA 1H9JA 1BJ7A 1LFOA 3H6MA 5HBSA 1UNSA 2NVQB 3VE2A 1HFGA 5JOBA 3KFFA 5K06A 1G291 1ERXA 3FPUB 3C3LA 1SNMA 1DOMA 1EWHA 5HA1A 4P2CB 1OPAA 1TW4A 1AP0A 1OEJA 1CA5A 1E0BA 3MVFA 4RKLA 4U8UO 1U4RA 3VYTA 2HLVA 2TSSA 3HWFA 1PRTC 1PFNA 2CW0D 3APUA 1NP4A 5BN3A 1EFID 1O78A 1QG5A 4FXKC 3HWDA 4KHVA 1FDQA 3HK1A 4ZLTF 3U9PC 5IIFA 3T53B 4CJ2C 2Q4NA 3AU7A 4H7BA 4TKOB 2OVAA 3BDCA 5I6WA 2F4IA 3D6CA 1SXYA 4IABA 1SA8A 3BDRA 1DFVA 1E00A 5FO8B 2X8TA 1SNCA 4N7CA 1LTGD 1CRBA 3V05A 3C76X 1BSOA 1B9NA 2BT9A 5JVG3 1A3TA 1SY2A 3O2YA 1BRPA 4HPDA 2LKVA 3U9SA 2FS7A 5CE4A 5DAUA 1JORA 1TVQA 4QQ1A 2EY2A 3I4LA 3FKIB 1CI3M 4GH7A 1Q8IA 2K28A 1V1OA 4KKTA 2WP8J 3J81L 5C0XI 5C0XJ 1QY2A 1VYFA 1SXTA 3VU1A 4U8UN 1TIID 2PW5A 4A60A 4DU9A 5FO9B 2L9CA 3M7NA 5CV8A 1LIEA 1AN8A 1EY6A 3NX2A 1BCPB 2F0TA 3TGAA 3I4NB 2L67A 5M3FB 5IT9E 2NZ1D 3ZYYX 2NNQA 3D95A 3WXQA 1PTOD 2KJXA 5D8JA 4PSQA 1ZNEA 1LPJA 4GK9A 1WTWA 3GTKB 1YWBA 4YGGA 1QOHA 2A68D 2AH7X 1H9KA 1HTPA 3HOYB 4AW8A 1X8UA 3VYRA 5EJWA 3S5VA 1HBPA 3HZXA 3ZW1B 3KUPA 5EPKA 5G3LD 1LTTD 3LWEA 5F6BA 4KD4A 3TP7A 3HTYA 1FELA 1HMSA 1RCVD 2IJ0A 2K62A 3PPTA 2JU3A 1T5EA 4XQQA 1GXAA 5IO7A 2RQXA 4Y7NB 3UEVA 1G74A 1II3A 3A8JE 5IGGA 2GA4B 2F3VA 3NK9A 1LTBD 5NUCA 4A3IB 2F09A 5DPQA 5HCDC 1V1PB 3D4WA 4RCOA 1HMRA 4O42A 3V96A 3UAQA 4X3KA 4TNNA 3Q0AA 2KTDA 2OZQA 4B08A 2VXWA 2Q8RE 1B1ZA 4QGVA 3E5SA 2MHVA 2JEAI 1UEAB 1MSGA 5JPNC 2GC9A 3ZWEA 1X3QA 4LZUA 1RTOA 2KEEA 3CQZB 2G9DA 3K57A 4V190 4A3MB 3F9DA 1GGLA 3B2KA 5IGFA 5FK9C 1T0VA 3E3CA 5BVTA 4N9TA 1A3VA 5IO6A 3R8BA 3EQLC 2B63B 1HXYD 5IGCA 1SYDA 4OO1I 1Y8OB 3NE5B 1Z47A 2DY7A 1SXWA 4NP1A 1HTLD 4IB9A 3KK7A 1PTOH 4ZUIA 1F2MA 3VYUA 1DCZA 4IFDH 4XT1B 3IFBA 4TRDA 4A3GB 3U0DA 1F9SA 3CHBD 3FLLA 1FTPA 3P6DA 1E06A 2CBRA 1MSHA 1D1IA 3OE3A 2X6GA 5L8OA 1ONLA 3D96A 3A56A 1DC9A 5IGEA 4EQOA 1H9RA 5M5WB 2VB2X 4C2MB 5E1FA 3L7ZC 4XMEA 4RGTA 2QO5A 4ZCBA 1B56A 1NGLA 2BDNA 1JWMD 4G4KA 1SMYD 3QJYA 1QABE 5LJGA 1ET6A 2B2VC 2NP1A 3D3RA 1DZPA 1A2UA 4K5WA 3I72A 2Z4HA 2OFRX 1MX8A 3P6EA 2KTSA 2F0NA 2X6LA 2AL0X 4NLIA 2PCFB 3FR4A 2B2YA 1TY2A 1GKAB 1ZNGA 1VMCA 3DTQA 3MAQA 1SE2A 2Q8IB 5HTEA 3BZDB 4ON1A 1L0YB 3AKNA 5A35A 2Q9SA 1U4PA 3EROA 4IALA 2FTBA 1FD7D 1TU2B 5ELDA 2RD7C 4MIRA 5K36G 2YMSA 4V0BA 1L0XB 3HWEA 2L68A 2L11A 3QWNA 2RVLA 2JE6I 1R0UA 4ZHFA 5HZ8A 3STNA 3OWEB 2HCCA 4TQUS 1TKWB 3RKGA 3QO2A 2EPBA 1JE4A 4N9PA 2NN6I 3T4AC 5KHPA 3EM0A 1ENAA 2CVRA 3BY0A 5DM63 1FNVA 1SBBB 4DN4M 5KYLA 3P24A 4ALBA 1DJRD 1LTAD 4S3SA 1D6EC 2KVMA 1UREA 4OIKA 2X69A 3T16A 4DGZA 3KLSX 1CQFA 2NTSA 4HTHA 4COTA 3GO5A 1BXTA 4DXGA 2CBSA 1AEXA 1OXSC 5EPJA 1S2PA 3AKMA 4N7DA 1SE4A 2MGSA 5KNDA 1CM9A 2M9VA 4L8JA 5E4WC 1KT7A 3FEWX 4HWMA 2A69D 5M9OA 2D9UA 3H0GB 2AMMX 2A3FX 3PO3B 2KA7A 5KYIA 4KK7A 5CMDA 4OL7A 2KOLA 3VR5A 2RQ0A 3F2UA 2HNXA 1AVGI 5KICA 5IO5A 4WFVA 3P6HA 4F88A 4RGMA 3TZUA 3B2JA 4RHSA 2K03A 4BBSB 4IB7A 3CU7A 1DXMA 3K58A 4EXZA 2I07B 2LBAA 3S5XA 2JA8B 1ESFA 1Q1BA 3P20A 1TT2A 5JAVA 1X8OA 3DWPA 4ZGFA 2BA1A 3ZW0B 4A3BB 3LX0A 1D5XC 2EDGA 4BY1B 4C3IB 2JA7B 2B2UC 2XIWA 5DM73 1B3AA 4I9RA 4F87A 5CYUA 3P6GA 3ZZVA 4XMHA 2LY7A 3R2TA 1JOQA 5BVQA 5AJBA 1S5BD 1Y69U 1TWGB 1EALA 5EGTA 5D45A 3WBGA 1F9QA 4ORXA 2XRSD 2X8SA 2YU9B 1PM1X 2F0OA 4KY5A 5HZ5A 1VDZA 2NBFA 5IOCA 3NPOA 3W2DA 2JMBA 4EVOA 4QYPA 1UAPA 1JWSD 2AWNA 3TP6A 4KTAA 1U4MA 1STGA 3DMUA 1I4GA 4HEDA 5CYBA 2J7ZA 3C46A 1LIFA 2XKLA 2K05A 1Y9LA 2I46A 4NP5A 5B29A 3P6FA 3DUZA 3JSQA 2ZAIA 2P8GA 3FA7A 2LFOA 2E75C 1X89A 2EJFC 1OO9B 4ZKCB 1YP6A 5C6AA 1RD9D 3CRKC 4EEJA 4RHRA 1ENFA 4CK4A 1ZNLA 3BU9A 4QF4A 1ALBA 1A3YA 4FBOA 1SNDA 4O1NA 2WKCA 3ZQ3A 5CV7A 4NW2A 4YKOA 3VG7A 1SNQA 2CW0C 1GXDC 3OOCA 3FMZA 3FRPB 1LIDA 5BN4A 4NKLA 3QOJA 3WOVA 2AUKA 3A54A 1B53A 1WCMB 2PNRC 3NR3A 4X3TA 1FEMA 1X8QA 4TKHA 3VR2A 4D6BA 3ZW1A 1SDFA 4A3JB 1LT3D 2NTTA 4OS0A 3NWTA 4PJ2A 4IZ8A 4IURA 3FPPA 1BSQA 2FWVA 3PECA 1SMPI 4UU2A 1O7YA 4BY7B 2NVTB 2NYZD 3MA2B 2F0KA 4IAWA 5JEAG 4KC8A 5ELFA 5LJCA 3PQSA 2F0EA 4I9SA 2B2TC 1Q3LA 2OVDA 2FR3A 1TWAB 4KT5A 4QYNA 1IYVA 1LV9A 3RZDB 1W6KA 3MC0B 1PMPA 4NDXA 5D48A 1O7LA 4UAIA 3RZOB 4R0BA 1V1PA 4NNTA 1NUCA 4Y0RA 3PV0A 5H9LA 3DSZA 4U68A 1CHQD 1SY1A 2K1BA 1A2TA 3V2TA 4ZRZA 1PTOC 2PMZB 4LK1C 2F0HA 4C1NK 3FENA 5C0XH 3Q23A 2WACA 4U673 1D2BA 2A68C 1XTCD 2L5PA 2BHVA 1RBPA 3APVA 1JOOA 4INNA 2LKKA 4KKSA 1CA6A 5AJCA 2K6AA 3SXHA 3OW7A 1ILQA 2ZXRA 4ODGA 1TWFB 4AZRA 5CBAE 4ZAIA 3VA7A 4ML7B 3VYSA 3S17B 2N93A 2AT8X 4DFAA 2QILA 1IKLA 3JQOA 4FXGC 4I3CA 1EIHA 3LWUA 2IW3A 4BA2I 3A55A 2ENBA 3EBKA 4OMWA 4KY7A 1ET9A 4YKMA 3HOEA 3TGCA 4TLJA 5FQ6E 1STYA 2F1MA 1F2LA 1QQSA 5BVSA 3TF6A 4BOEA 4DAVA 4OS3A 2OFMX 1AFPA 1IW7D 1MVGA 1K83B 4K5XA 1Q1EA 1G91A 2LFNA 1WTVA 1QJOA 5C4XB 5D4AA 1Z24A 3S26A 4AYHA 1QG7A 1UUPA 1I05A 1DZMA 5L8IA 1JV4A 1U0XA 3HKZB 1I04A 1KAAA 2FJ2A 1BQQT 2EY6A 1GKAA 4IUTA 5AFWA 3NX1A 3LNNA 3CQNA 4EQNA 4K8IA 2KW1A 3VPJE 1DONA 2Q2PA 3BS2A 4TKJA 3QG1A 3FA9A 2C9OA 3DWAA 1AQBA 3U9OA 1S44A 4XYOA 3GTOB 1X3PA 5JPMC 3GTGB 4RGNA 1M4VA 1AW7A 1C8CA 1NP1A 1U18A 2WSJA 2XSTA 1WD1A 1B2TA 3S1QB 2E76C 3VG2A 2BE5D 4YFRA 1EIOA 5IGDA 4B9XA 1UZ2X 2MM3A 4Q5VA 2EY1A 2CM9A 1EY5A 5JEAJ 3KFHA 1ZRYA 2EYOA 3GQBA 4OO1H 1RF2D 4GDZA 3TBIB 1SMYC 1X32A 3T56B 2ZT9C 5I2XA 2CM4A 1PTOB 1SJED 2R92B 3K0YA 5C4ZA 4K19A 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VA7 A;  1H9S B;  1CFM A;  3CRK C;  1K8M A;  2AWO A;  3PUZ A;  1HPC A;  4L8J A;  4JK1 C;  2BA0 A;  1OXT A;  3BDO A;  4G7Z C;  1IW7 C;  2NN6 G;  3M85 A;  5BN5 A;  3MFY A;  2A68 D;  1K8O A;  1FYC A;  1E2V A;  1ONL A;  4IQZ A;  1H9K A;  4RCN A;  1E2W A;  1IYU A;  1H9R A;  1HTP A;  3HGB A;  3IFT A;  3LWU A;  2A69 D;  3M4Y A;  3RLF A;  3L7Z C;  2QF7 A;  1H9J A;  1PMR A;  3T51 B;  2K7V A;  2PPB C;  3ND8 A;  4OGQ C;  4BA2 I;  3PUV A;  2JXM B;  5JEA H;  5C0X G;  3BG3 A;  3MXU A;  2CW0 C;  3FMC A;  1LAB A;  3QJY A;  5K36 H;  3OOC A;  1H9S A;  2KA7 A;  2L5T A;  4DK0 A;  4DK1 A;  1I6V C;  2A6H C;  2F1M A;  2YYZ A;  1G29 1;  4LJZ C;  2K33 A;  5BN4 A;  2AUK A;  3OPO A;  4OO1 G;  1Y8N B;  4PV1 C;  1DD2 A;  1Q90 A;  1H9M A;  4KHZ A;  3VR5 A;  1Y8P B;  2PNR C;  3I72 A;  2LMC B;  3W3A A;  1GHK A;  3A8I E;  1EWH A;  3A7A B;  1CTM A;  1IW7 D;  3PUW A;  3IKJ A;  1YNJ C;  1HCZ A;  1OXV A;  3TZU A;  4IFD G;  3VR2 A;  2EJM A;  1Q1E A;  1T5E A;  1DXM A;  2O5I C;  2PCF B;  2IT1 A;  1QJO A;  3PUY A;  3DXJ C;  3CRL C;  4GZY C;  2B8F A;  1FR3 A;  3FPP A;  1OXU A;  3I73 A;  5BN3 A;  1O78 A;  1Q1B A;  3P20 A;  2E74 C;  2Q8I B;  3A8J E;  2A6E C;  2A6H D;  2D62 A;  3A8K E;  5A35 A;  4G7H C;  2BA1 A;  2K32 A;  2EVB A;  3AB9 A;  4XIG S;  2EDG A;  2O5J C;  1Q12 A;  2B8G A;  5JEA G;  1GUS A;  1TU2 B;  1BDO A;  5K36 G;  3T53 B;  2BE5 C;  1V8Q A;  2R6G A;  4TKO B;  5KNB A;  3LNN A;  1Y69 U;  2JEB I;  1B9M A;  1IYV A;  2JE6 I;  4BA1 I;  1GJX A;  1Z7T A;  2DN8 A;  3D4R A;  3GD7 A;  3QG1 A;  1V43 A;  4TQU S;  2D2C C;  2DNE A;  1GUT A;  1TKW B;  5KNC A;  4KKU A;  1GUG A;  4H13 C;  1B9N A;  1O7L A;  2JEA I;  4H0L C;  1VDZ A;  2A6E D;  3SE0 A;  3KLR A;  4XTC S;  2AUJ D;  4KN4 C;  3VR6 A;  2NN6 I;  3PV0 A;  3U9S A;  3QIA A;  4KI0 A;  1LAC A;  3H94 A;  3PUX A;  3VR4 A;  2E76 C;  2V4D A;  2BE5 D;  3I4L A;  1CI3 M;  3A7L A;  1VF5 C;  2D5D A;  4KKT A;  1Z6H A;  2BDO A;  2DNC A;  3WDN A;  3SDZ A;  4LK1 C;  1A6X A;  2EJG C;  4DNR B;  4I7Z C;  4G7O C;  5C0X H;  3EQL C;  4KN7 C;  4HR7 B;  1E2Z A;  1Y8O B;  2A68 C;  1GUN A;  3NE5 B;  4JBW A;  1VF7 A;  1VCI A;  3GQB A;  1GUO A;  3M7N A;  2A69 C;  5KND A;  4OO1 H;  1HQM C;  3ND9 A;  1OXS C;  4KKS A;  4H44 C;  2E75 C;  1SMY C;  3N6R A;  1OXX K;  4KMU C;  3T56 B;  2EJF C;  2KCC A;  3VR3 A;  4DNT B;  2ZT9 C;  1GHJ A;  1DCZ A;  3OW7 A;  1ZYR C;  3D31 A;  4IFD H;  1YNN C;  2NN6 H;  1ZKO A; 
#chains in the Genus database with same CATH topology
 1HR0 Q;  4FXD A;  1SWH A;  2E5L L;  1YWA A;  2GTF X;  4TJZ A;  2DJG A;  5FLX E;  1RKN A;  4IMN A;  5IWA Q;  4G7Z C;  1XMO Q;  1RL2 A;  3GTP H;  3X00 A;  1OEE A;  1VWH B;  1QWY A;  5DG4 A;  3M3Y H;  1N34 L;  1SSO A;  4ZH9 A;  4K2K A;  1QWD A;  2C35 B;  2K5Q A;  4LWC A;  1JT8 A;  1JQP A;  1SWC A;  3C77 X;  2QF7 A;  1PMR A;  1HZB A;  2K7V A;  2YTY A;  1MBY A;  3MXN B;  1ZNK A;  3FMC A;  4A3E H;  2DJF C;  3FR5 A;  2FHT A;  4DV3 L;  1W6F A;  1KLG D;  3NUC A;  2OY5 O;  2EYM A;  1TWH H;  1L6M A;  1Y8N B;  4DV6 Q;  4QRL A;  4A3E G;  1KQW A;  4ES7 A;  1XXG A;  4BQU A;  1IXR A;  3GP7 A;  1Y8P B;  1VQP A;  3TP5 A;  5FOB B;  1ZNH A;  4HMJ A;  3KFU A;  2SOB A;  1A8V A;  4HN7 A;  2NVX H;  3CWK A;  4CDE A;  2M2L A;  3FDC A;  2UXB L;  1HCZ A;  2SDF A;  1VWA B;  1EQT A;  3E9H A;  2F03 A;  2IT1 A;  3DWQ A;  1MJE A;  1VWN B;  4TVA B;  1E24 A;  4LF6 Q;  2RTJ A;  2H1E A;  4Q0F A;  3S2H H;  4ZHH A;  2EXZ A;  3S15 B;  2C4I A;  2MJ8 A;  3G48 A;  1PV4 A;  4LFB Q;  1YP7 A;  1EOV A;  5HZ6 A;  2D62 A;  2EOT A;  2PI2 A;  1FL0 A;  5C3E H;  2KCM A;  4QL5 A;  2E2H B;  2IZL B;  2O5J C;  1D1K A;  3F6Z B;  3FHW A;  4AYB E;  4P72 A;  5M3M H;  4DAM A;  1YHQ A;  1FJG L;  4ORW A;  4CKC A;  3KBG A;  3MXP A;  4YWL A;  3SOT A;  4K5V A;  3HOV H;  3J80 L;  4FBV A;  4FGI B;  5M3M G;  4FDB A;  3MFG A;  4QJF A;  4WFN 3;  4ALP A;  1E02 A;  1Z7T A;  3D4R A;  3GD7 A;  1QVG A;  4IB6 A;  3HOV G;  4GLV B;  2F0F A;  3ZW0 A;  3FA6 A;  3HOX H;  2PZW A;  4H13 C;  1LM0 A;  1AVD A;  1ML0 D;  3WVM A;  5LMN Q;  1IKM A;  3KZA A;  1R4Q B;  4KN4 C;  5GAH C;  3CME A;  1XX8 A;  2X46 A;  3R2I A;  4A3F B;  3IL8 A;  1Y14 B;  3ZUO A;  4NYR A;  4YHH Q;  1EL0 A;  5A2Q E;  2JW1 A;  4NW4 A;  5FFH A;  1IBM Q;  3UE1 A;  3VHI A;  1TXL A;  4Z2O A;  2LXJ A;  2N55 A;  2KUM A;  3S1R B;  1GT5 A;  1TOW A;  4B3S Q;  3CC4 A;  2X8F A;  1TWC H;  5IYB H;  4XXE A;  1VQO A;  1EYC A;  2EYP A;  1A6X A;  3O22 A;  1CJ5 A;  1LT4 D;  4YCE A;  3RLO A;  4A93 B;  3TDQ A;  1PRT B;  3D97 A;  4M8A A;  4ME5 A;  1KC8 C;  1KOI A;  5FLX L;  1GUO A;  4KJO A;  2A69 C;  4O4O A;  3ULP A;  1YUP A;  3WZO A;  4MHE A;  5TSS A;  4DAY B;  2K52 A;  5HUR A;  2RDG A;  1T9H A;  1NBW A;  4MN3 A;  2JK8 A;  5D3I B;  3F2C A;  4OKA A;  4WHI A;  3RZY A;  1NCV A;  1LTS D;  2PNH A;  2CWA A;  1IFC A;  4QGX A;  3ELZ A;  2WEX A;  2FKG A;  4J1M A;  3TME A;  5I6Y A;  2ACO A;  5HCC C;  4CSB A;  5HGQ A;  4IUV A;  1LUZ A;  3MBT A;  2FMC A;  4ZR2 A;  5B11 O;  1PZK D;  2QCB A;  5DLQ E;  3SEB A;  1VWF B;  1VMP A;  2PW7 A;  4CDD C;  2OTL A;  1ADL A;  1N0S A;  3VG5 A;  4MTN A;  4PZ6 A;  1E2W A;  3M4Y A;  4B3T Q;  3T1D A;  3K6O A;  1XPO A;  2ES2 A;  2RTO B;  1SXX A;  1QVC A;  3CCQ A;  2HYS A;  2UU9 L;  1LAB A;  4CDF C;  5BR8 Q;  1KDB A;  4X66 L;  1Q7Y C;  1I3Q B;  4MVK A;  4O3Z A;  1A3U A;  1SLD B;  1S3O A;  3CQR A;  5LJE A;  2NND A;  1KT5 A;  2RHQ B;  2XWB B;  5J1Z A;  3PUW A;  2K01 A;  3S16 B;  4IFD G;  4OMX A;  3WJB A;  3RN5 A;  1EII A;  5F58 A;  1ML7 A;  2IZA A;  4MEE A;  3T6L A;  3BVM A;  1EEI D;  3BYT B;  5EQ0 A;  2AF5 A;  3G71 A;  1JZU A;  4L6T B;  4JI4 L;  1MD2 D;  2PYK A;  3CRL C;  5JJK A;  2B8F A;  4LMQ D;  1BEB A;  3I73 A;  1FE3 A;  4MVI A;  2PO4 A;  2MO0 A;  4TSS A;  3TZD A;  3A74 A;  3M4O H;  4C3H G;  1X9N A;  1MDC A;  5FJ8 H;  1C0A A;  3FKI H;  3NPP A;  3B6Y A;  4G7H C;  3C78 X;  1SYC A;  2Y3F A;  4GE1 A;  3CCV A;  3T1H L;  1CT1 D;  1BCP F;  4BBO A;  4DQ3 A;  3PIO 3;  4DV7 L;  1Y1V B;  1VWQ B;  3CP0 A;  4GU8 A;  1N36 Q;  1DOK A;  1X54 A;  3U58 A;  2VUM G;  3NQT A;  1HQP A;  1ZND A;  1STB A;  1N34 Q;  1L2F A;  2KD2 A;  5KEE A;  2HDM A;  5A2Q L;  4LF9 L;  3KOJ A;  5CV4 A;  4DV2 L;  3MTS A;  3C1E A;  5FEN A;  3F8A A;  4FBR A;  4MNO A;  1LIB A;  4O3Y A;  1TXY A;  5FQ7 E;  5KNC A;  3I4N H;  5M3F H;  4DV3 Q;  4QIW E;  2WII B;  1RDP D;  4DK3 C;  1FGU A;  2XWJ B;  5M5Y B;  2N49 A;  2R73 A;  2GTL O;  1YBY A;  3FA8 A;  2RTI B;  3K3L A;  1KTK A;  3GTK H;  2RA6 A;  4WJ4 A;  2HZQ A;  2Y0S G;  4Y0Q A;  3EA6 A;  2MFI A;  1S72 A;  3KF8 B;  1JOK A;  1W2B A;  4IJH A;  1SRI A;  2EJG C;  1PDQ A;  5EKK A;  3X3N A;  3LTW A;  4I3D A;  4XMF A;  4OX9 L;  2Q2I A;  2B2U A;  3TRE A;  4PMC A;  1GUN A;  4HCS A;  4ORS A;  1EI5 A;  4DNE A;  4O3W A;  2BS5 A;  1YJN A;  4OIJ A;  4LFC Q;  4AYB B;  3GTL B;  4GKC A;  2WWP A;  2WEW A;  3E6Z X;  3SK6 A;  1GOZ A;  1G85 A;  3WWV A;  1SNP A;  3G6E A;  1N32 Q;  4WFU A;  1L1O C;  1CFM A;  3OBL A;  2AQ2 B;  3PO2 H;  2BA0 A;  1OXT A;  3FEK A;  1FEN A;  3OMC A;  3PH6 A;  4NV7 A;  4Y7N H;  4GRJ A;  5EZ2 A;  2I0Q A;  1NY4 A;  3MFY A;  1T5X D;  3LV4 A;  3L3O C;  4A3K H;  5IYD G;  4JHQ A;  3PO2 G;  1P8L A;  1JC7 A;  1PRT F;  3EFX D;  3K80 C;  1F2Y A;  4IPC A;  3OTO Q;  2JXM B;  3G6J B;  4F8M A;  2UUB L;  4YCU A;  3TS2 A;  2DY8 A;  2GTL N;  4A1H A;  2ALL X;  4DK0 A;  2VB3 X;  4NPS A;  2CAM A;  4A4I A;  3OJY C;  2K33 A;  1YNN D;  2WB1 G;  3OPO A;  4IPG A;  4APV A;  1IBL Q;  2F4V L;  1AZQ A;  2NVY B;  4DUZ L;  5LKE A;  1PHJ A;  1JJJ A;  1CSP A;  2I5Z O;  2OY8 A;  4GLA C;  1C48 A;  2LMC B;  3QR8 A;  2UXC Q;  1NQM A;  2JU7 A;  2EU7 X;  5F7G A;  1GM6 A;  2JN3 A;  2XSC A;  3IKJ A;  3VA5 A;  1EW3 A;  2OXP A;  3Q22 A;  2ASB A;  3K59 A;  3STK A;  2RCQ A;  4HPA A;  1HQR D;  5IT9 c;  4O4X A;  4HPB A;  3UEW A;  2MP1 A;  4CHT B;  4U8U M;  3FR2 A;  1QVF A;  4YCH A;  3CQZ H;  1LO5 D;  4BBR B;  2A13 A;  3AFQ A;  2R7F A;  2FFK B;  1Q82 C;  1WTP A;  3S1N B;  3PCO B;  1STA A;  4FO2 A;  4AZN A;  1KIX A;  4A1Y A;  4O0A A;  5CR3 A;  3VG4 A;  1WTR A;  3SK8 A;  1VPR A;  3MZ5 A;  1SE3 A;  3APW A;  4PQX A;  1JIC A;  3J7A F;  1GJX A;  1RXJ A;  4I7A A;  1HNZ Q;  4ZH6 A;  1LYL A;  2UZ2 A;  4GGR A;  4L5S A;  4RKB A;  5FLM H;  4LZV A;  2KCT A;  2PMZ E;  3OHX C;  2F0G A;  1QZG A;  4RH6 A;  4R4T A;  2UU9 Q;  1ERB A;  4O3X B;  2SNM A;  3BU2 A;  3Q8D A;  4WOR A;  1R9T H;  1QY1 A;  4X66 Q;  3FW5 A;  3U03 A;  4DK6 C;  2EYF A;  4JI7 L;  1T68 X;  4IFD J;  2RKS A;  2JA6 G;  4P71 A;  3IA8 A;  3HOZ B;  1HNW Q;  3EMM A;  3I4M B;  3GTQ H;  3NSW A;  3KBX A;  2B2Y C;  3WJG A;  2KHI A;  3OWF A;  3O19 A;  3A7L A;  4QUF A;  1MM9 A;  3RUZ A;  1YI2 A;  2EIF A;  5EPL A;  3MX7 A;  1Y1V G;  3N91 A;  4IN3 A;  3G7X A;  1SLE B;  4C2M H;  1CHP D;  3CD6 A;  4UHV A;  1XKI A;  5EDB A;  2R93 H;  3EN2 A;  1DYQ A;  4IUU A;  2HIX A;  3SK5 A;  3F2B A;  1G2S A;  4X3U A;  4M6S A;  5C4J B;  1KL4 A;  4YWM A;  2AQ1 B;  1I6H B;  4NNS A;  1SLJ A;  2AHO B;  1SEB D;  4Z6J A;  5J39 A;  1ACD A;  2AT6 X;  1B4O A;  3GTM B;  1SWL A;  1LT6 D;  4DR6 Q;  4DV7 Q;  3ERQ A;  4DNT B;  1GHJ A;  3OYY A;  5CV5 A;  5CV9 A;  4CJ0 B;  4X65 L;  2E2J B;  2EYJ A;  3JAM E;  1BLR A;  1YHA A;  4AZP A;  1K8M A;  3I70 A;  4ME3 A;  1EPA A;  1HPC A;  4LF9 Q;  5LJK A;  4DV2 Q;  2BLG A;  3L9A X;  3HEJ A;  3BDO A;  1IW7 C;  1F2Z A;  2B2W A;  1WVL A;  3HOU B;  2IZH B;  2SEB D;  3ITP A;  2W2F A;  5KRU A;  1ICN A;  2OT2 A;  1NMG A;  4R9W A;  4QIW B;  3TN2 A;  2HUG A;  1EZ8 A;  4A3D H;  4L3R A;  4O9S A;  1QE6 A;  3E9I A;  3UDG A;  1KL3 A;  3BG3 A;  2WUT A;  1L1O B;  4A3D G;  4LKT A;  4QAE A;  5JD2 A;  4CPE A;  1BOS A;  1WTO A;  3P75 A;  1Q90 A;  1IKJ A;  2AT0 X;  1PBO A;  3T1Y L;  4Y59 A;  3W3A A;  3BVG A;  2QOS C;  4OX9 Q;  1TR5 A;  1CZG A;  4CV7 A;  4YDA A;  1IKE A;  4GKK Q;  2F0L A;  1KT4 A;  2MPM A;  1Y1W B;  4GZY C;  3MEH A;  4P73 A;  5FQ8 E;  3RSW A;  2R7Z B;  2H4O A;  1X71 A;  2E74 C;  1FJ1 E;  3R93 A;  2KEC A;  2AT3 X;  1F9P A;  2L9H A;  2G7B A;  2BOS A;  1KZX A;  1HA5 A;  2OTJ A;  2K5H A;  3TSS A;  1BBX C;  2B8G A;  1DZK A;  1WBI A;  3Q34 A;  3PH5 A;  2BE5 C;  1XCA A;  5M5X H;  4BXX G;  1YNX A;  1E5P A;  2RCF A;  4IPD A;  4ZHC A;  5D47 A;  1GO3 E;  1W3S A;  3NQK A;  5HTD A;  2F0W A;  4YDB A;  1SLG B;  1QFV A;  1V43 A;  4DUZ Q;  2UUB Q;  2F0P A;  5HA0 A;  4ZKB B;  2X34 A;  5HZQ A;  3PDF A;  4OWX B;  4H0L C;  2RA4 A;  5D65 A;  2ICI A;  3TZS A;  3FVQ A;  2RHS B;  2IZB A;  2F4V Q;  1S5C D;  2HQE A;  3QIA A;  5HY6 A;  4BBR G;  3HP3 A;  2M00 A;  1MJC A;  1V1Q A;  2QKI C;  2VQF Q;  3I0A A;  4EQA C;  4DV4 L;  1JCK B;  1EOT A;  2G8C O;  3LGJ A;  1IIU A;  1O7Z A;  2ZXO A;  3S14 B;  5AJ3 L;  3G7L A;  4G57 A;  2KT4 B;  1QNU A;  1EWI A;  3I2Z A;  4RWS C;  1PYS B;  2OL7 A;  1LTR D;  2ASN X;  5H9A A;  4JI1 L;  3JAM L;  3AYH B;  3A0J A;  3H0G H;  1EY0 A;  2KHJ A;  3K5M A;  3NP8 A;  2Y32 A;  2A2U A;  2UUA L;  1A2D A;  4FQB B;  4QZU A;  2JA5 G;  3FEP A;  2A19 A;  5C44 H;  4CKE A;  1VYG A;  1J8I A;  1PVO A;  2CHB D;  4H44 C;  1SY0 A;  1E7Z A;  2KEN A;  1OXX K;  2RCT A;  1QB5 D;  2YTX A;  1XYI A;  1SLF B;  4FF2 A;  2QEJ C;  4NXN L;  4HAE A;  4R4O A;  1BRQ A;  2QGQ A;  2R61 A;  1Q46 A;  3K8A A;  4BBS H;  2QW7 A;  1KRS A;  2Z1C A;  2WKD A;  4IB8 A;  2JA8 H;  2ZM6 L;  1JWU D;  4J6H A;  3P02 A;  4DAY A;  4HMI A;  4DAP A;  4IOC A;  5B27 A;  3HGB A;  3D4D A;  3D6W A;  3T51 B;  4QUC A;  3W1B A;  2G78 A;  2F0J A;  3U4Z A;  1VQM A;  5C0X G;  4BGF A;  2KHS A;  5EBC A;  2MQH A;  4XMG A;  4BY1 H;  2JU8 A;  3BDL A;  1S7D A;  2L5T A;  4O2D A;  4A3L H;  4KC7 A;  2YYZ A;  4A3E B;  4ODD A;  4JBM A;  1HUM A;  4A8Z A;  1WTX A;  1O1V A;  1TWH B;  1O7I A;  3OW2 A;  4ORR A;  1KNE A;  3UDX A;  3VDY A;  3A7A B;  2Y0S E;  1X8N A;  3GAQ A;  4QGW A;  1NR2 A;  2R3Z A;  3I56 A;  1FNU A;  2CH4 W;  2OVE A;  4KH8 A;  2YU9 H;  2NVX B;  3BU1 A;  4HCE A;  3DM3 A;  3RMH A;  2M4L A;  4XT3 B;  2F0D A;  3NEM A;  4BWG B;  3ER0 A;  4KHP L;  4ZYS A;  2AQ3 B;  3TS0 A;  4UU3 A;  3GE2 A;  3WJF A;  1I4Q A;  1KFF A;  1WTQ A;  1PFM A;  3QKG A;  4MIU A;  2A6H D;  2JOZ A;  4ORU A;  4X65 Q;  1JJX A;  3ZI8 A;  4B3M L;  5HZ9 A;  5HCE C;  1OSP O;  1CKO A;  1Q12 A;  1JE5 A;  3J81 j;  1OTC A;  1VQK A;  3LHN A;  3NP1 A;  1ICM A;  3JS1 A;  1V8Q A;  4UP7 A;  5M3M B;  1KL9 A;  2OY7 A;  2NZO A;  3ULL A;  1KZW A;  1SNO A;  4KII A;  4K6D A;  2QDB A;  3HOV B;  1DF3 A;  1U17 A;  4DKA C;  1N4J A;  5E3F A;  2D2C C;  5AEO A;  1K73 C;  1HFN A;  4GNY A;  1S5F D;  2A6E D;  4K6L A;  4IBA A;  1GT3 A;  4XTC S;  1RLB E;  2XNA C;  5IGB A;  2R7Z G;  3KYH C;  4HSV A;  2CZT A;  4JI0 Q;  2O2L D;  1G8Z D;  3SK4 A;  2WB1 E;  3PQI A;  3VR4 A;  1HNX Q;  1ROD A;  5GAD C;  3FW4 A;  3EBE A;  3Q6S A;  3URY A;  1VF5 C;  1NR4 A;  1WTH A;  4JI8 L;  4IUN A;  3AQQ A;  1XMQ L;  2NUC A;  3KDF B;  1RHP A;  5T1G A;  4DNR B;  1K3B A;  2PI3 O;  1TWC B;  3KF6 B;  4RAU C;  5EKL A;  1BBP A;  4BX5 B;  5LJB A;  1GT4 A;  3ULJ A;  1CBQ A;  1GVP A;  1VWD B;  1W5R A;  3RDM A;  2VW9 A;  1I50 B;  4JYA L;  1ICF B;  3PMF A;  1ILP A;  2ZTD A;  2VQE Q;  1SXU A;  1Y55 X;  1FNW A;  2KCC A;  3VR3 A;  2WFW A;  3KF8 A;  3J80 E;  5C3W A;  4XQJ A;  2IZI A;  5AQ6 A;  5C4H A;  3M7G A;  5CSE A;  1QY0 A;  5CV6 A;  1H9S B;  2VFC A;  2FMM A;  2HDL A;  2WIN B;  4YBP A;  2F3W A;  3CKI B;  4WBK A;  4C3J G;  1O8V A;  3SHL A;  3NAD A;  4DCB A;  1SWG A;  1Y9T A;  3T13 A;  5BN5 A;  2QO4 A;  1K8O A;  1KAB A;  4RCN A;  1LIC A;  3VR6 A;  1DD2 A;  1STH A;  3FDT A;  5COY A;  3RE6 A;  1SY3 A;  3ND8 A;  3ICE A;  2L12 A;  2NVT H;  2QM9 A;  4U9C A;  1LCZ A;  4NYQ A;  1K0S A;  1STE A;  1SAP A;  2O4X A;  2HCI A;  5JR8 A;  2PPB C;  1B0O A;  1I6V C;  3CBS A;  4QNI A;  1ZYR D;  2A0A A;  2E2D C;  4OO1 G;  1EQR A;  2WQ9 A;  3B2L A;  4YFQ A;  1X65 A;  1VQB A;  2RTD B;  1H9M A;  4KHZ A;  4L63 B;  4KY6 A;  3HPE A;  2WR6 A;  3E0E A;  4HJ9 A;  4KD3 A;  4FP5 D;  1CTM A;  3APX A;  3GV3 A;  3A5U A;  3N52 A;  3CC7 A;  1KAW A;  2BH2 A;  2B39 A;  2G9H D;  2O5I C;  3R3O A;  4FNF A;  3L4R A;  4ID6 A;  4EDE A;  3NBI A;  1C4Q A;  4ID2 A;  2QMI A;  4C3H B;  2R56 A;  4NXN Q;  1YEZ A;  3D8G A;  2RTL A;  2AKQ A;  3A8K E;  4GNX C;  4DR3 L;  2HZR A;  3CCE A;  1JJU A;  2IHE A;  2Z0S A;  1SRG A;  3M4O B;  3P7J A;  5GAE C;  2ACP X;  2LS0 1;  1W6J A;  2RTR B;  1EWC A;  2VUM B;  2GVA A;  2F0V A;  4DR7 Q;  1GUS A;  1KQS A;  1I06 A;  1M90 C;  1JB3 A;  1STN A;  2PY1 A;  1HJP A;  3BLG A;  1YNJ D;  2Z8L A;  1I4U A;  3NQ9 A;  3PSI A;  1Y52 X;  4BA1 I;  3NEN A;  2JA9 A;  1EYA A;  5LJD A;  4LFA L;  2DNE A;  2W2A A;  5F2D A;  4KKU A;  2XTI A;  3AFP A;  1LT5 D;  1TS4 A;  3SZI A;  3HOW H;  1LAC A;  3O13 A;  4EFG A;  3PUX A;  2BCO A;  2Y0S B;  2WAQ G;  2DGY A;  5D14 A;  1NTG A;  3NXW A;  5EKI A;  2DNC A;  4XYQ A;  5C3E G;  2BC3 A;  1A15 A;  4RUN A;  2N3S A;  2EYH A;  1BF4 A;  2YG2 A;  1PH3 A;  1M8A A;  3K7A H;  2OFA A;  2B2V A;  2WV6 D;  4K2L A;  4IMO A;  4HR7 B;  1E2Z A;  4UP8 A;  1S5D D;  4PMW A;  1IW2 A;  5CHK A;  3HG9 A;  4WRD A;  1I4P A;  2K04 A;  1VCI A;  4F7X A;  2K5V A;  1HQM C;  3J7Y W;  1SWK A;  4WJW A;  2RTA A;  3JAM i;  4B3M Q;  2IWH A;  1PH1 A;  5HWZ A;  2V1C C;  2UYW A;  3CKG A;  1TS5 A;  1PYW D;  2J4X A;  1F77 A;  1GM5 A;  2Q2U A;  2RTG B;  1BCP D;  3CF5 A;  3HOX G;  3D31 A;  3RWX A;  1YNN C;  1WUB A;  2RTM A;  3K5L A;  2NN6 H;  5E4X A;  1CQV A;  2FR2 A;  3VE1 A;  1UE1 A;  3U4V A;  5EED A;  1X3G A;  5IY0 A;  1DZ1 A;  1D3S A;  1RIP A;  1X3E A;  2NN6 G;  3RBY A;  3PO2 B;  1UYO X;  3M85 A;  2FRS A;  3DEO A;  1E2V A;  2RBM A;  4EQP A;  3L0O A;  1KNA A;  2GN5 A;  2Z6K A;  5IYB G;  2CQO A;  2NVQ H;  4A3K B;  3K81 C;  3FID A;  4O4U A;  3MXU A;  2MO1 A;  5D3D A;  3S2D B;  1X3F A;  2RSO A;  1HA6 A;  3HS0 C;  1YWC A;  2WB1 B;  4EX5 A;  4DV5 L;  2LA7 A;  5IRU A;  2FLJ A;  1E22 A;  3WJE A;  3KLS A;  4J8Q A;  3P6C A;  4JI8 Q;  2IX1 A;  1QUQ B;  5FKA C;  1IJ8 A;  1JBH A;  4DF7 A;  3UEU A;  4QZT A;  3BS1 A;  3PED A;  1S5E D;  1SYG A;  3QB3 A;  3A5Z B;  1IBK L;  1NNX A;  1SRH A;  5B2A O;  3UEX A;  1L1O A;  2OQK A;  1QIL A;  3GTO H;  2G5D A;  5HGT A;  1HMT A;  2IL8 A;  4ILW A;  1OPB A;  5IP9 H;  2ID0 A;  4GN4 B;  4C56 C;  1Y0G A;  2E2I B;  3EJI A;  3S1Q H;  2VL6 A;  1DZJ A;  4GJS A;  2K32 A;  4QQB X;  4XIG S;  1PLF A;  2LB6 A;  1VWP B;  3WZN A;  1WYD A;  3STB D;  5I9O A;  1SR3 A;  2HQL A;  4DUY L;  3VHM A;  1PTS A;  1H91 A;  1PTO F;  4TQ2 A;  5IT9 L;  4Z27 A;  1EXS A;  5LJH A;  3EVQ A;  5KNB A;  3NBH B;  3H3V H;  5I4D A;  1B9M A;  3J81 c;  2OVS A;  1NC9 A;  2ATW A;  1PRT D;  2ZAG A;  3ELX A;  5GRO A;  4GNX B;  2RN4 A;  4NMZ A;  3RDO A;  1TQO A;  1VQ7 A;  1OBP A;  4IPH A;  5LKF A;  5ELB A;  1PYB A;  1SJH D;  3KLR A;  4CDE C;  2JA6 B;  2BS6 A;  1R9T B;  2IHF A;  3HRZ C;  5G3L F;  4KJN A;  4GKJ L;  4NLJ A;  3NBX X;  3NHH A;  2IZG B;  1JYJ A;  5ELE A;  2J0T D;  2E5L Q;  1TOU A;  3MEF A;  5IOD A;  1SYB A;  4LW1 A;  1KT6 A;  1BSY A;  5EDC A;  3I3C A;  3GTQ B;  3CR6 A;  2GH7 A;  2LBV A;  2NNE A;  5FJ8 G;  1IL2 A;  2XVS A;  3FKI G;  1B8E A;  2AVI A;  3G4S A;  4Z28 A;  5L3Y A;  4I7Z C;  4B9W A;  1HUN A;  2VNU D;  2K5D A;  3HWG A;  3RD4 A;  1KDC A;  4YFP A;  2ANS A;  3PP6 A;  1PZJ D;  3HFZ B;  4RGO S;  1EIY B;  4GZV A;  3RDQ A;  1BWY A;  1XTD A;  4CPI A;  2R93 B;  1A18 A;  2TMP A;  4BJ8 A;  3ND9 A;  1EFW A;  4JI5 L;  2RDH A;  1RSU B;  4RUU A;  3RY2 A;  4OON A;  4KMU C;  3DM1 A;  4YMY A;  4X64 L;  1ENC A;  4UDU C;  5FAZ A;  2VFB A;  2KCN A;  1BVS A;  1QNK A;  2I5H A;  5M3F G;  3I4N G;  3H3I A;