3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Unknown function
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
1Y8PB 3A7LA 3SE0A 3T51B 3FPPA 3PUZA 2JXMB 4DNRB 3T53B 3I4LA 1YNJC 5BN4A 5JEAG 1VF7A 1PMRA 4IQZA 1BDOA 2IT1A 4HR7B 1K8MA 1E2VA 3VR2A 1OXVA 4G7HC 1K8OA 2JE6I 1GJXA 1ZYRC 4JBWA 2V4DA 1Q1EA 2ZT9C 4XTCS 3VA7A 4LJZC 4TKOB 2A6ED 3PUXA 1TKWB 1VCIA 1OXSC 1Q12A 2BE5D 3OPOA 2E74C 3OW7A 1GUGA 3VR4A 2AUKA 2A69C 3M85A 2K7VA 1CTMA 3M4YA 1HTPA 1H9RA 1Y8OB 2PCFB 2BDOA 4BA1I 3NE5B 3VR5A 1H9KA 1OXUA 3EQLC 1G291 4G7ZC 1GUSA 1LABA 1Z7TA 1GUNA 3M7NA 3MFYA 1DD2A 3VR3A 1H9SB 2B8GA 3IKJA 3U9SA 1IW7D 4H0LC 4KN4C 3FMCA 1EWHA 2EJMA 3AB9A 2L5TA 2LMCB 2PNRC 5K36H 2DNEA 3PUVA 1QJOA 2AUJD 2KCCA 4GZYC 5BN5A 3ND8A 2A68C 1FYCA 2BA0A 3LNNA 3T56B 4DK1A 4H13C 1Y8NB 2D5DA 1DCZA 4BA2I 5K36G 3N6RA 1I6VC 2E76C 4IFDG 3KLRA 3ND9A 3CRKC 1B9NA 4KKUA 3BG3A 1GUOA 2R6GA 2A6HD 2QF7A 3LWUA 1SMYC 1H9JA 3A8KE 1OXXK 1ONLA 1TU2B 2F1MA 4KN7C 4RCNA 2DNCA 3OOCA 4KKSA 4KHZA 2PPBC 1GHJA 1DXMA 4KKTA 2Q8IB 1OXTA 1IYVA 4TQUS 4G7OC 2A69D 5BN3A 2BE5C 1O78A 2AWOA 2D2CC 1HPCA 2KA7A 3BDOA 5KNCA 1B9MA 1E2WA 2EJGC 2A6EC 5A35A 3I73A 4DK0A 2O5IC 3L7ZC 1GUTA 2D62A 2JEBI 1VDZA 3MXUA 4L8JA 1IYUA 2YYZA 3QG1A 1T5EA 2CW0C 1Y69U 2NN6I 3GQBA 3PUYA 2B8FA 4JK1C 4H44C 3HGBA 3P20A 2A68D 3A7AB 4DNTB 3PV0A 3QIAA 1V8QA 1CFMA 2DN8A 1E2ZA 1Q90A 1GHKA 1CI3M 1Q1BA 2JEAI 3CRLC 4OO1H 2K32A 4XIGS 1A6XA 3D4RA 3QJYA 1H9SA 3A8JE 3GD7A 2EJFC 5KNDA 4KMUC 4KI0A 2O5JC 1HQMC 1ZKOA 1LACA 1YNNC 1IW7C 3DXJC 4OGQC 3RLFA 2K33A 2A6HC 3SDZA 3H94A 4IFDH 2E75C 3I72A 5C0XH 1Z6HA 3W3AA 1VF5C 4OO1G 3VR6A 1HCZA 4I7ZC 3WDNA 2EVBA 3PUWA 1V43A 1O7LA 1FR3A 2BA1A 5KNBA 3A8IE 5JEAH 3TZUA 5C0XG 4PV1C 2NN6H 3D31A 1H9MA 4LK1C 3IFTA 2NN6G 2EDGA
chains in the Genus database with same CATH superfamily
2ZTEA 2YV5A 1TXYA 2MUYA 2OEOA 2K50A 1HR0W 4R4CA 2G9HD 4X64Q 3IRBA 3I17A 3PEDA 1VQ7A 1B50A 2UXDQ 1JWMD 1OXVA 2XGTA 5IO6A 1LTAD 3NXWA 2R61A 2OCEA 1GM5A 5CORA 4JI7Q 3NELA 1J6QA 3KJOA 1EUJA 2V1CC 1ICMA 4Z2VA 3U50C 2IHFA 3UE0A 1QFTA 3P75A 1SXTA 1WUBA 1VQFA 4C1NK 4OWWB 1B56A 4MIRA 4GU8A 1LTSD 1F2LA 1VWFB 2CWAA 4CGYB 2WEXA 2RTEB 1MUPA 1SMYD 2FGSA 5JD2A 2IW3A 3H3VC 3PO3G 1VQDA 1SA8A 3NPPA 4NXNQ 3S14B 1K3BA 1EIFA 4KY6A 4BY1G 1IW7D 2Y0SE 4KN4C 1SLJA 3WOEA 1CZWA 1TS5A 3KLSA 2R92G 1VWDB 4R4IA 3BS2A 2K52A 3M3YH 1OEKA 1R9TH 3Q0AA 3LHNA 1X32A 2N93A 1HY2A 1SBBB 1WOCA 3TP8A 2A68C 2RTKA 4CJ1B 3MM0A 3CBSA 1G6ZA 4V190 3E0JA 3H15A 3T2XA 3KF6B 1X55A 3PMFA 3N6RA 3ND9A 1SLGB 3I0AA 1JJJA 1TOUA 2LY7A 4Z9CB 4DV5L 3MG5A 2VB2X 3PGZA 3CU7A 5FLXE 1FGBD 5H8TA 2GN5A 4DR1L 4GLXA 5E4WC 1DFVA 5K68A 2Y0SG 3KFUA 3I90A 1W2BA 1KQXA 3RDOA 1JJXA 4IJLA 3HWEA 3K5LA 5NUCA 2NP1A 2NUCA 1MKHA 5CV8A 4HSVA 3SR1A 2ZJQA 1D5XC 1TWHB 1K0RA 1BVSA 1FTPA 4DQ3A 5IYCG 2QCPX 2FKJA 2Y3EA 3FYFA 3GTOH 2B2YC 2KEDA 3APVA 3SK8A 2AHOB 1Z9FA 2IZAA 4HCEA 4B3TQ 3CR6A 2F01A 3J80L 2H5XA 4KLKA 3EJIA 4FXGC 4CKEA 3FHWA 1TOWA 1LT5D 5LMNQ 1QNUA 1G5WA 2K32A 1YHAA 1SNPA 4YKMA 2RQXA 3OJYC 1VQHA 2QGQA 2YG2A 4OEMA 4JO6A 1ZKOA 3NADA 4YBPA 5A2QL 3S17B 1LLRD 1GX9A 2FINB 1KL5A 4ZH9A 1PH1A 2RVLA 4J8QA 5IP7H 4QGVA 5TSSA 5EKLA 1E3PA 3VR6A 2ZM6Q 5IGCA 3ZW1A 3KF8A 1E06A 4A60A 2EU7X 3WJEA 3U03A 4OL7A 3OIPA 5LJGA 4O3ZA 3STNA 3HOVG 4HPAA 2O2LD 4PV1C 5J3BA 1SJED 4OWTB 1X8PA 2G78A 2PI2A 1XNRL 2Q2MA 1MSGA 5EPKA 4WBKA 1HUMA 3T53B 4GJSA 4ARHA 4ES7A 1K0SA 3FA9A 1PMRA 2BH2A 5H9AA 3WJBA 1LIDA 2R93B 4A75A 2IX1A 1PTOH 1AQBA 1IZ6A 1LTGD 1GX8A 5BVTA 1GJXA 3VG3A 1GUWA 1VWCB 3S2DH 4JI3L 1GKAB 4DV6L 3MEFA 1BQQT 1Q12A 2WEWA 2CH4W 4B3TL 3VR4A 4Z27A 3PP6A 4YDAA 1HTPA 4DV7Q 2X46A 1V1OA 1TWAB 5JVG3 4JI8L 1SAPA 4IRWA 4LNQA 1ICFB 2SDFA 4K8IA 2ZAIA 1AELA 2TSSA 1JWSD 2IL8A 2HMBA 1GUNA 1C0AA 3SZIA 1YP7A 1RF2D 3I56A 5FKAC 3HOYH 4LF4L 4KD4A 1C48A 1W6JA 2X32A 4N8FA 2WQAE 2B2UC 3J81j 4QL5A 4AZQA 1EWHA 1LCVA 1R0UA 1N4JA 3CPWA 5HZQA 2F4IA 5FQ7E 2OVEA 1SXXA 4I65A 4LF9L 1IL2A 1W3SA 3ND8A 1YNXA 2CM9A 4TSSA 1GT5A 5B5FA 2RSNA 4AH6A 5D4AA 1L1OB 1DCZA 2Z6KA 1MX7A 2VQEQ 2KUMA 1PZJD 4DNEA 1FNWA 3DM3A 3KUPA 1NY4A 3M9BA 4KKUA 3ZW0B 4P2CB 4QZUA 3BX7A 4IMOA 3G6JB 4ZUJA 1SFOB 4KHZA 2PPBC 2F0IA 5LMNL 1MEPA 2DJGA 3R2IA 2F0QA 2OFAA 1EY8A 4ME3A 3SZHA 1N32L 3UEWA 1X89A 4CPHA 4FBVA 1B1ZA 1UEAB 4NP5A 4X3SA 1EPAA 4GNXB 2OTJA 1IKLA 5FO7B 1B9MA 3B6YA 4DUYQ 1KD1C 3VHMA 2AQ1B 4CDFC 2B63H 3EMMA 4C5PA 5KHPA 4I3BA 2ENBA 1TXLA 1BSYA 5HA1A 1JE5A 2LBVA 2KQ3A 1TWFB 1VWIB 1WTWA 2X69A 1ASYA 4GUZA 4L5SA 5C0XJ 4RH6A 3WJGA 2D0PA 1PTOF 4JI0Q 3ZZVA 1XMOL 3CC7A 4NW4A 2XNAC 4XIGS 4LFCL 1Y0GA 3K5NA 2XRQD 3QJYA 3NBXX 2O5JC 2A5BA 2K5WA 1TQOA 3TREA 4C56C 1HBPA 2FT9A 3DEPA 2FTBA 1GXAA 2K33A 2L1BA 3WYPA 3GTQB 4KH8A 5M9OA 5C0XH 3PIOA 3J7YW 2AT0X 5J1ZA 5C3EH 3WDNA 1EL0A 2K62A 5EPQA 2CH4A 1WFQA 3T1DA 4JNJA 5EGTA 4CPIA 2H4OA 4NV7A 2HCCA 1DZJA 2NN6G 3MAQA 1CQVA 1KAAA 1RL2A 3QOLA 4YGZA 4AIMA 3RN2A 3SOTA 1YNJC 1S7DA 4R1JA 1PRTD 4UHVA 5FLXc 1U0XA 2NNDA 4L5QA 4LF6Q 5B11O 4JV5Q 1X3QA 1JYJA 4CDFA 4XTCS 3RE5A 3VA7A 1BCPC 4A3MB 4LF8Q 3K5OA 3O19A 3T2WA 3V2TA 4JI6Q 4XDXA 3D4DA 5C6AA 3A0JA 1EWIA 5C4XG 1JB3A 4Z6JA 2QDLA 2EYJA 1PH4A 2AUKA 5HBSA 3TF6A 3E3CA 2CFMA 3QWNA 1LTRD 2F3IA 1UUPA 2HDLA 1B70B 4U673 1YVCA 2F0VA 2JU8A 3LV4A 3DUZA 5ISRA 4GKKL 2KT4B 1Y1WB 1IFCA 3SLOA 5M5WH 2NVQB 2ZJPA 2KTDA 2RHQB 4LZVA 1U4LA 2EE1A 4RMFA 4X62L 5LJBA 4YY3L 2N88A 5ELFA 4NXMQ 3FKIG 4GLVB 2NVTH 2VZAA 3NTKA 4KHPL 5C4HA 2ZXOA 5C44B 1F9RA 1I6HB 4NKLA 4P74A 2EYFA 1DZ1A 4ZHFA 3V05A 4HIMA 2B2VC 2BA0A 5C44H 5D45A 3P24A 3BLGA 2Q4NA 3L2PA 2X55A 2M2LA 1UZ2X 3KLRA 2JA5H 1TVXA 3HOZG 2IHEA 4UPAA 4ZR2A 3HOXH 4IJHA 3MC0B 1UREA 1W5RA 4KN7C 4OKAA 1KZXA 1I50H 1XMOQ 3CP0A 5D48A 2HIVA 1ACDA 4LFCQ 5EAYA 4GH7A 1PFMA 1SWJA 3ULLA 2X34A 3EW1A 2EYLA 2KA7A 4IZ8A 2O5IC 2VQEL 3B2HA 5JPNC 4L8JA 2JMBA 3ELXA 2WAQG 4BCSA 3QG1A 1NNXA 4Y59A 4ZHHA 3NBHB 2GTLM 1ICWA 1G74A 4POGA 1QY2A 3A7AB 4GDZA 2R93G 5H1SE 4MVIA 5F6ZA 1YHQA 1HQRD 1N32Q 5AFWA 1QUQA 1SWAA 3STMX 3SZJA 4IABA 3G6EA 4CK4A 2EJFC 5KNDA 4BS9A 1SLDB 1PH8A 3EBKA 3HOVB 2PMZB 3V8UA 3EIVA 4JBJA 4M6SA 2IZKA 1P16A 5JAVA 3VDYA 4J1MA 2RTFB 1II3A 3A8IE 3BVZA 2UU9Q 4L63B 3S17H 1W6FA 1H9MA 3J80i 2X8FA 3BU9A 1U0LA 3CQZB 2QOMA 4X64L 4YFQA 4YFRA 2I5MX 3HOWG 1NQMA 3JS1A 5D3IB 2FXQA 4S3SA 5ELBA 3BZCA 3C1FA 1SRHA 1KLGD 1B2TA 5AJCA 2C35B 4GOPC 3NUCA 3BU1A 2KECA 1BXTA 2KD2A 1KC8C 3SLTA 5C3EG 3I4NG 1XJVA 4TKHA 1G51A 4AQYL 1SYGA 2ZT9C 2QO6A 4TJZA 5F2DA 4HAEA 3U4VA 1SWLA 1WCMG 3RMHA 3D0FA 2JJQA 4K2KA 1A3TA 4O42A 1J5EQ 5IT9E 3S16B 2L0CA 4C2MB 4O2DA 5M5YB 1DF8A 1LFOA 2PCFB 3NE5B 1CKMA 2WP8J 1EYAA 4GOPB 2M4LA 4HPBA 1FELA 2RTPB 5JPMC 3MA2B 4PQXA 2HQEA 3PIPA 2Q2UA 1TY0A 3MFYA 5IO5A 4O4SA 2WB1B 2DY8A 2B8GA 4YWLA 2JA6H 1B0OA 1PH9A 4P72A 2EYPA 4JI3Q 4B3RL 1X8UA 1ESFA 2A73B 4XQJA 2E8GA 4UP7A 2BT9A 3W1GA 3LTWA 4B3ML 3S24A 2EYMA 3NSWA 2XKLA 1E7ZA 2J7ZA 1JJ2A 1V9PA 4H13C 4WJ4A 5H9NA 2K03A 1LCWA 2B2TC 4IB6A 2I07B 3UAQA 1IKJA 4GDAA 1RDPD 2PZWA 4BBOA 1JZUA 4WFN3 2VFCA 2H1EA 1X9NA 3S1QB 1JMXA 5CE4A 1C8CA 2E2HB 1N34L 1XX8A 2L12A 1FJGL 1HUNA 2P5ZX 2F0EA 2MJIA 3FW4A 1IYVA 1SWEA 2HLVA 1SYCA 3NR3A 1EXSA 1JJCB 1N34Q 1FJGQ 1KOIA 4GKCA 4TRDA 3MHBA 4F87A 4NMZA 5KIXA 4OONA 5C4ZA 5D8JA 3G7LA 4OMXA 3VGWA 4AZMA 1IBKL 1S2PA 1SWHA 1YWCA 2RTLA 4ORRA 1NE3A 3JAMi 1EWCA 1VDZA 5ELEA 3U9OA 2L4NA 5J39A 2Y3FA 2KEEA 1VWHB 3RNUA 1UE5A 2EY1A 4ODGA 5C0XI 4EQOA 1BBXC 3P7JA 4LFAQ 1SREA 2AMMX 1TT2A 2OL6O 1EFID 3U58A 2WIIB 2JSOA 4ZJ0A 4FO2A 1FL0A 2KHJA 4M7MA 3D6CA 4O3XB 3I91A 3VG6A 1LACA 3K7AH 3SDZA 4DUYL 5C4XB 1JOOA 1X8OA 1EEFD 1IJ8A 2E75C 5B27A 3NQIA 3OYYA 1C7YA 3RUZA 2K1BA 2BS5A 3KFFA 4JYAQ 1B4OA 2RF4A 4FP5D 1HCZA 4KCAA 1WYDA 1HR0Q 4MVLA 2BC3A 5FQ8E 1ET6A 4PJ2A 4OXPA 3L4RA 3TEHB 1A63A 2JXMB 3PSIA 2RTBB 3EN2A 3FELA 4FVMA 3O22A 2I5HA 4BY1B 1HMRA 3CCMA 4YMYA 1YZ6A 2RTDB 2UZ2A 2FS6A 2XN9C 4N7CA 4YH0A 1ML0D 4IUTA 2MGSA 3C3LA 4UP9A 4A3EH 1KDAA 1LM0A 3TP6A 4LJZC 3TZSA 4HJ7A 4ORYA 3AUMO 2E74C 3NBIA 1VQJA 1GOZA 1EI5A 1EZ8A 4YKOA 2Q2TA 4Z2OA 1RODA 2WKDA 2RSOA 1YWDA 1TR5A 2BDOA 4BA1I 1QVGA 1EU3A 4EQPA 1GM6A 5D47A 1AE3A 2F3VA 4RG1A 1M8AA 2G79A 4CSBA 1NP4A 5GROA 1YITA 4X3TA 1X65A 4ODDA 4C3JG 1Q46A 2F0WA 3M7NA 3IA8A 2LKVA 4NDXA 2LFNA 3X3MA 3QKGA 3UEUA 2Y0SB 1YHBA 3WJDA 2F0JA 4P75A 4A3GG 1SRFA 2Z6KC 3GTPH 5DM63 2IZCB 4QGXA 3WXQA 1IYJB 1SE2A 3NTHA 3S5VA 4EEJA 3HOLA 5IP9H 4OS8A 4R0BA 3E3XA 5C3EB 2HHHL 4YDBA 1QCBD 1XPRA 2WAQE 4YIJA 4YWKA 1VWQB 1JBHA 2E2JH 2AT5X 4XYQA 1VS0A 2AKQA 4IFDG 3AMUA 4OIJA 1B9NA 1V1PA 1U4PA 3AFQA 2R6GA 3RBYA 3CKGA 3OTOQ 5CV6A 3FENA 5E3FA 3CBCA 3E9IA 3FIDA 1Q8IA 2RCQA 1DXMA 3BU2A 1UE6A 3CMPA 2FMMA 3Q34A 1I6HH 2BH8A 3SHLA 1STGA 1HZBA 2OXPA 3H0GH 5IYBG 1MJEA 1RAVA 1KXOA 1E2WA 3H91A 5H9LA 3CCQA 1HHVA 1FE3A 1X3GA 1V1PB 3MXUA 3O2YA 5C3XA 4ZK9B 1T9HA 5C3WA 5KYLA 1JIWI 3NQ3A 4FBRA 1CA5A 4QJFA 4DAMA 2I0QA 1KTKA 1VQPA 1IBML 4OS0A 2HYSA 4Y5DA 5FLXL 4L1NA 2JEAI 4OO1H 4R8NA 5ELCA 3T1YL 1YUPA 3GD7A 4KD3A 4ZLTF 1G2TA 4C3HB 3P6CA 1IW7C 3CW2C 1MHWC 3BYTB 2B2YA 3H3IA 1Z6HA 1HXYD 2KHIA 4ORWA 2OFRX 2BS6A 1Y53X 1LTTD 3ELZA 2CWPA 4A3BG 2OWOA 3Q23A 1QZGA 4QRLA 1EQVA 3F8TA 1D3SA 1E00A 2NBFA 2NVTB 4DV6Q 2I5VO 3TZUA 3S60A 3ZWEA 5C4XH 4AYHA 2NN6H 2HIXA 2K04A 3KK7A 4BBRH 4XQNA 1TWCH 4A3CG 3T51B 4ALPA 1KXLA 1KGLA 4U3QA 5BVSA 4P71A 1PH6A 3I4LA 3AEHA 2GJ5A 4UP8A 3EA6A 1SWQA 1LTLA 4I9RA 2B2WC 1PTOC 4LF8L 5M3FH 5F6BA 2ZM6L 2V4DA 1S5CD 1E1OA 5HY6A 3J80c 4A3CH 4A3EG 1DZPA 1MVGA 3KYHC 4JC0A 1CKNB 1B3AA 4WJWA 3HP3A 4DR4Q 2WPUA 1DF3A 1C4QA 2A74C 4DR2L 5LKEA 1Y55X 1X8QA 4JI5Q 3BJUA 3HOYG 3I70A 1F9SA 1SY1A 4HN7A 1CJ5A 4N9PA 4NYRA 2FWVA 5LJCA 4BXXG 2RDFA 1K8AC 1B8AA 3GTGB 4KJOA 1IHZA 5M5YH 2AH7X 4C1NI 2F09A 1L0WA 1JMCA 1JORA 1ZNLA 1ZNDA 4ZKBB 4U8UO 4NXNL 5DG4A 1LT6D 1RD9D 1U9RA 5FOBB 5CV5A 1EEID 4AZPA 4GN3B 5K06A 4YHHL 2DNEA 4GD9A 3FW5A 2KCCA 1LIFA 2AF5A 1SRGA 3AFPA 2EXDA 1TS2A 4EDEA 1Y1VG 5CYBA 1SWPA 1MD2D 1ML7A 1I6VC 5LMNW 1NAPA 1O8VA 2ZTDA 3GTLH 1VWEB 4QQ1A 4FXKC 2Z1CA 3I4OA 3W1BA 4AZOA 2A6HD 3LWUA 4Q5VA 1SMYC 1IL8A 1H9JA 3NP8A 4PMBA 2EY5A 4RAUC 1STRB 2DM5A 4O3YA 1GVPA 1LELA 4WRDA 4DR2Q 4GN5A 2GVAA 4QGWA 4JI5L 3F2UA 4G7OC 1EYDA 1MBYA 2B2VA 3BDOA 1HPCA 2EJGC 4XMCA 3K7AB 1XPUA 3K8AA 4DK0A 3F2CA 2ASNX 2OF1A 1BO0A 3BVGA 5G3LF 4DR6L 2PY1A 3MX7A 1EZ6A 4BY7H 4QIWB 1Y69U 3CXCA 1SRJA 3SK4A 2WAQB 2IZEB 3QIAA 4DV7L 4UU2A 3EC5A 1E24A 2F0GA 1VQGA 2PI2E 4EGVA 4GGTA 2ALLX 1HBQA 3A5UA 4K5XA 4LF7L 3TGCA 5ELNA 4BWGB 4IOCA 1CBQA 2GVBA 2MQHA 5GAHC 2JOZA 3I72A 2QO5A 4ZQ3A 4U8UN 2RA4A 4ZFXA 5DEHA 2KCTA 1VQMA 4MHEA 5FENA 3PUWA 1CM9A 4GOPA 1N9WA 3ULPA 1IBLQ 3FRPB 1N0SA 1JOKA 4IAWA 4IB7A 3C2PA 1XTDA 4O3WA 4NLJA 3SE0A 3UDIA 4U8UM 1A0IA 3VYUA 4HTHA 2IWHA 2E5LL 4BBRB 5BN4A 3JC66 3K58A 1NR2A 1VF7A 5BR8Q 1D7QA 2AT8X 4JBKA 3MXNB 3WOFA 3SXHA 3F6ZB 2OY5O 3RDXA 3H3VH 1HH2P 4IALA 4G7HC 3FKIB 4NP1A 4EQNA 4AZRA 3IAYA 2GC9A 1I94L 1I78A 3SVMA 3NWSA 4DR6Q 3TQYA 4RKLA 4DU9A 1TKWB 1N7YA 2BE5D 3OPOA 2FS7A 3RD4A 4RHRA 1IXRA 1EY5A 2FFKB 1Y1WG 1CHQD 1CTMA 3VU1A 4LFBQ 1DYQA 1HMTA 1GX3A 3S2HB 4DAYA 1I9HA 4TVAB 4LKPA 1RLBE 4F8MA 4A1YA 3SGIA 2JA7H 2NNEA 4X65L 4LF5Q 3CCRA 1PH2A 1IIUA 4X3UA 3AEVA 4OIKA 3PO2G 1DD2A 3MVVA 2HNXA 3P6GA 4ML7B 1TWGB 5HURA 4GNXC 3FP9A 1B8EA 3BRNA 1PRTF 2RCFA 1NC9A 3ZW2A 4FDBA 3TMEA 1JJGA 4QZTA 2QDBA 4A3DG 1SEBD 2ACPX 4HPCA 4LZUA 4A3MH 2A2GA 1PVOA 1BUVT 3RKGA 2MFIA 2JQOA 3PUVA 4KIIA 4CHTB 1N43A 1AEXA 4FF2A 1Y14B 4WORA 3J7A5 3WBGA 2CZUA 4AYBE 4IN3A 4LF9Q 4BX5B 3MTSA 1SJHD 3CCEA 2RTOB 2WR6A 1JE4A 3CAMA 2F0LA 1CQFA 2LS01 2PZTA 4AQYQ 4Y52H 1Y1WH 1MX8A 3K0YA 4IUVA 3PO3B 1PZKD 3R3OA 4Z28A 1LCZA 3KBXA 1ASZA 1I4HA 3PK2A 3X00A 1ZXTA 4TQUS 5E1FA 2B3GA 4HJ5A 3KFHA 2RCNA 1O78A 3GTOB 4BQUA 4A3JB 4CKBA 3NQTA 3PQUA 1VQLA 2RTMA 3E6ZX 2JEBI 4IPDA 3KOJA 2QCBA 3TP7A 1VMCA 1JWUD 2F0UA 3VHHA 1VQKA 1E02A 1BOSA 3FKIH 3NPOA 4BX5A 1SRUA 3HEJA 4ILWA 2ID0A 4DA2A 2W2AA 4DV0L 3PV0A 2LSSA 1CSQA 1V8QA 1NMGA 5LL6X 1DC9A 1ZNKA 2HZRA 3AQQA 1YJ9A 2JA6G 3I4MG 2PZUA 3G48A 4H7BA 2ES2A 2O62A 3EROA 1EIHA 2RTGB 3R2TA 4KI0A 1W6KA 5DAUA 4DK6C 4IUNA 1YNNC 4OGQC 2OVAA 2AT6X 4XT1B 1EQQA 4CBVA 4BBSB 4MVEA 2OQ0A 2Q8RE 4X62Q 1D8LA 2L67A 2HD3A 4JI1L 1LYLA 1V43A 2B63G 3GTPB 1KL4A 2RQ0A 2EDGA 1YIVA 1D5MC 1CKNA 1VQ9A 1J8IA 1KNAA 3S14H 5BVQA 5IYDH 3FMZA 3A56A 2UUAQ 4N8X1 1PA6A 3HWGA 3RZOB 3J81c 2NVYH 3KDFB 1WD0A 2BSZA 1XPOA 4JI2L 3HOWH 4LW1A 2FHLA 3NQ9A 1E22A 1XYIA 2A3FX 4BY7B 4FBOA 2A2UA 5AJBA 1JC7A 2F0SA 1PFNA 3TN2A 4NYQA 2UXBL 1JOQA 4IUUA 3SK5A 1GT1A 1PTSA 4K5VA 3CCLA 1DOMA 4CDDC 2UXBQ 5JOBA 3MVFA 1ESRA 3S1NH 5M5XB 4IFDJ 4DV4Q 1SYDA 5CV4A 4MEEA 3A55A 3PO2B 3PPTA 1HNWL 1HMSA 1WBIA 5AQ6A 2LB6A 2TMPA 4OWXB 1WTXA 1SRIA 2MM3A 1XXGA 1F2ZA 2MP1A 1HXZA 3HS0C 3QR8A 5LMUL 1XMQQ 1QY1A 3I2ZA 5EEEA 3FIQA 3H6MA 5GQOA 5JJLA 3Q22A 5F58A 2ICIA 1Y9TA 5KGUA 2RA6A 5K36H 4OELA 1T68X 4B3SQ 2AUJD 1SNMA 4GZYC 3RN5A 1A62A 2PO4A 4M8AA 2XTIA 3T56B 4Y0PA 3B2JA 4Y7NB 5IOCA 2UUAL 4FYDA 1ERBA 3O13A 1RSTB 1HZAA 2J0TD 2F4VQ 1LF7A 3OD9A 4YFPA 2OFMX 2R7ZH 3WZOA 4CPHB 4KY7A 2YTYA 3I8ZA 1YJNA 3OWEB 3M4OH 4YHHQ 2MPMA 4JGLA 4RCOA 2KTSA 2AT3X 2BE5C 1PFSA 3UEVA 3U0DA 2WFWA 1QNKA 4IB8A 5FLMG 2QM9A 3EBEA 4COTA 4Q0FA 3M4OB 3KLWA 2EYOA 1KQWA 4JVZA 5CGKA 1SWGA 1HR0L 1CA6A 1AVGI 1BSQA 1JQPA 4DR1Q 1QE6A 5IRUA 1I06A 1YWAA 2X56A 3OSOA 1TY2A 1QFVA 2EIFA 2AQ3B 1SWOA 2X6LA 5B10O 3STBC 1SE8A 2WB1E 4A3MG 3ICEA 4HFOA 4YGGA 4ZGFA 5GADC 1YJWA 2PQAB 3DXJC 3H94A 1S3OA 4EQ5A 2ALYB 3MXGA 1D1KA 1X56A 4F7XA 4OO1I 1P8LA 2QO4A 1YNJD 4I7ZC 4TLJA 1PHJA 3TBIB 4DV1L 5KNBA 4B9WA 1UWVA 3HOUB 1D2BA 3A5ZB 1O1VA 3D31A 2K05A 3E5SA 2EZVA 5A2QE 3RY2A 1PYWD 5D14A 3GTLB 3DWAA 4TKJA 2JU7A 5JEAG 2RTRB 2B39A 2IX0A 2IT1A 2BDNA 1E2VA 4JI4Q 4IUPA 4A3IG 1YEZA 4RUNA 2R92B 1VWLB 2EOTA 3R93A 4JBWA 4QMGA 1D2UA 2AQ2B 4DNIA 3EW2A 4OX9Q 2BOSA 4LF4Q 4BOEA 4HMIA 3HOVH 3P6HA 3HKZG 3PF4A 1OXSC 1IBLL 4RHSA 3CPFA 2K7VA 1RJTA 3U4ZA 1NGLA 1Y8OB 3EVQA 1KDBA 4A3FG 2RTIB 4WFVA 4R9WA 2VNUD 3CHBD 1MI2A 1IBKQ 5BR8L 1LIBA 1QZHA 2NTTA 1MM9A 1Z7TA 3KFIA 3T1HQ 4ZYSA 3ZW1B 3D8GA 2MNAA 3RWXA 3KQ0A 2ZXRA 4LKTA 1BCPB 1DM0B 3JAME 2MJ8A 3IKJA 2A1AA 5K67A 1SE3A 4LFAL 1GD7A 1SNQA 4NNTA 5IODA 1NCVA 4ZRZA 2CM4A 1I4QA 1K83H 2MF6A 3BDLA 1LTID 3EM0A 5EKIA 1HZCA 3OBLA 5EDBA 4JI8Q 1U4RA 1SLFB 1FYCA 1K83B 1RXJA 2Q2HA 2N8NA 1EY9A 2KBNA 5E7NA 4BA2I 3S1MH 4YCEA 3CMEA 3UEXA 3RZDH 1HJPA 1RCVD 3BG3A 3QOJA 3LWEA 4A3KG 3MFGA 2WKCA 1CRBA 3V96A 4KKSA 4EVOA 3WZNA 1PH3A 1YIJA 4U46A 1HNXQ 4ZCBA 1UE1A 1G8ZD 4KKTA 1SWCA 2X8TA 1OXTA 2GTLO 4HIKA 1TWFH 3S1NB 2E4JA 1STNA 2A69D 1UYNX 3S16H 2A0AA 5HTEA 4XQQA 1VQNA 1KFFA 2MHDA 4GE1A 5H9KA 4NPSA 3D96A 3N52A 1G85A 4TKBA 2CCZA 2A5CA 3L7ZC 2D62A 4LUZA 1KIXA 1NTGA 4RGNA 1DOKA 3T1HL 2FR3A 1KL9A 3HOYB 2MO1A 1WJJA 3VA5A 2CBSA 1R4PB 1B7YB 5ELOA 1PYBA 2R92H 4O9SA 4DNTB 3P20A 2A68D 2JA7B 1HFGA 2Q9SA 3ZYYX 4N7DA 1CFMA 3SEBA 3E9HA 4DV2L 1EFWA 1GHKA 1A6XA 1ZNHA 1LT4D 3K5MA 2B2TA 3MEHA 2CW0D 3HPEA 1HQMC 2RD7C 5C4JH 5JVH3 1RKNA 3TSSA 2AL0X 1NUCA 4PMCA 1D6EC 1OPBA 4BBSH 4UAIA 5LHY1 5IT9L 1STBA 4HCSA 1EALA 2RTHB 2EPBA 3Q6SA 1Q86C 1Y8PB 3A7LA 2VUMH 3I4NH 3D95A 4MIUA 2K5VA 5T1IA 1WTPA 2F03A 4DNRB 2A13A 1M1KC 1PDQA 1K24A 4HR7B 4Y0QA 3B2LA 4CJ2C 2E2IH 4IPHA 2A8VA 3CC2A 2CVRA 1TWAH 3G71A 3W2DA 1PM1X 3PQIA 2LFOA 4UDUC 1SWDA 1QG7A 4K5WA 5B3MO 1KDCA 1HA5A 1I04A 4XMFA 4QB4A 3J81i 2F3WA 4J6HA 2RTCB 2VQFQ 1K3RA 3CKFA 1ZYRD 1A8VA 3BDCA 3J7AF 3NX1A 2RTNB 3PDFA 2IZLB 4NLIA 3T6FA 1BKBA 1H9KA 3TGAA 2IJ0A 2PNHA 1LABA 4WFUA 1M4VA 5KICA 1BR9A 4AYBB 1YWBA 4DR4L 1ENAA 4A3JG 2CQOA 4GGZA 4A3DH 1B3QA 3P6EA 3CCVA 1G2SA 4QQBX 3APXA 1Y1VH 2L55A 4JCVE 4A3EB 1HQPA 1KT4A 4A3KB 2F0DA 1ALBA 1OBQA 5EJWA 1QWYA 2OF9A 3HKSA 5ELDA 4A3IB 3DLLA 1LUQA 4ZHDA 1KT7A 3LNNA 4TNNA 4A3BH 1O80A 4BJ8A 4C3JH 4XMHA 3CKIB 1SYFA 2QEXA 2A19A 1TWGH 4O4UA 4IO9A 1KT3A 3S1MB 4U9CA 4LUVA 1I94Q 3HFZB 4CV7A 1STPA 3HOXG 2JA8G 2F0FA 4GNWA 3PO2H 1N36L 1CK1A 3FA6A 1GHJA 1NR4A 2L5PA 4XXEA 3J80E 1VWPB 2ANSA 4R4TA 3B2IA 2JA9A 4C2MH 2R3ZA 3WWVA 3JQOA 5CR3A 1BF4A 2XVSA 2D2CC 2RDGA 2WV6D 4KK7A 5IGDA 4LF7Q 2LXJA 1OSPO 1S5ED 4H02A 4JW0A 1SWSA 2AVIA 2MO5A 1DZKA 1IYUA 2CKZB 1KNEA 1CSPA 1VQCA 2PW5A 1BCPF 3K0XA 2B8FA 5KEEA 4LMQD 1KRTA 4A93G 1BSOA 4C3IG 1SFOH 3S15B 5BYPA 1CHPD 3CMAA 3ZUIA 1I4XA 1YBYA 4E6IA 1O7IA 1XNRQ 2UUCL 3HG9A 3JAMc 3J7ZC 3APWA 2IX3A 5D65A 1H9SA 3CQZH 2PQEA 4XYOA 1HN2A 1L6MA 4GNYA 4KMUC 5F7GA 5HZ8A 2QMIA 1VQAA 1RSUB 3CF5A 2CBRA 4NB3A 3VYTA 4A3BB 1VWRB 3CQNA 1QQSA 3W3AA 3GTJB 2JK8A 3T13A 4NXML 2JA8H 1VYFA 2ATWA 4BBSG 2R93H 2BA1A 2EXZA 3M3YB 5JEAH 4I95A 1ET9A 1CBSA 3PIO3 4XT3B 2Z4IA 2JGSA 2VQFL 1Q7YC 1RXKA 3NX2A 4A76A 1EYCA 4EQAC 1B4MA 4ZUIA 2EY6A 4Y7NH 5HCDC 1CBIA 3X3NA 1WI5A 1ZYRC 2PW7A 2GH7A 1PBOA 4MISA 3GO5A 4NNSA 4R8IA 3DMUA 4I9SA 4A3FB 1IKEA 5IWAL 4Y0SA 1EQDA 3BSZE 3CQRA 1JICA 1A3UA 2GTLN 1DGSA 4IAXA 3OW7A 4A3JH 1MSHA 5LKFA 1I5FA 1GUGA 2A69C 1O7YA 1LNMA 3ZUOA 4K8JA 2KENA 4JI0L 1QVFA 1O1UA 1Z24A 4CPEA 1QB5D 1FGUA 1AVEA 4HMJA 2A8GA 1PTOB 1CBRA 1X3FA 3EQLC 1GKHA 2KVMA 2UXDL 2R7ZG 3BS1A 4JI4L 3D4WA 4DR5L 1W4TA 5LJKA 1SSOA 2OQKA 2IZGB 2KCNA 1VWNB 2G7BA 2FMCA 4X66Q 4EKVA 2QEJC 2VY3A 4PZ8A 4RGOS 1JV4A 3FEPA 3HK1A 1PTOD 1RXHA 4CDDA 2DUDA 1STEA 4IBAA 1GT3A 3PH5A 1PXUA 2Z8LA 3FLLA 3FA7A 1VYOA 3NBHA 1NQNA 4I6SA 4A3DB 2PQAA 4RFBA 4AW8A 4GLAC 5HGQA 3CRKC 4GNXA 1GUOA 3DEOA 1JCKB 3K6OA 4BX7B 4JBMA 2OVSA 2JN4A 1CT1D 1ENFA 1ONLA 2K5HA 5IYCH 2DNCA 4DR7Q 2ZSCA 2KOLA 1VQ5A 1UNSA 4IPGA 3U9PC 2EY2A 2Q8IB 2UUCQ 5FQ6E 2F0MA 1O7ZA 2RDHA 1BEBA 3MXPA 1GKAA 3I3CA 3AYHB 2AWOA 1VWJB 1X54A 1EU4A 3VYRA 3DTQA 2A6EC 1LKEA 1EQTA 1EOTA 1I4PA 4ON1A 2IZIA 1HNWQ 1KZWA 1Z47A 1VQIA 2ZXPA 4CDCC 2VS1A 4GKKQ 2HZQA 4X6AH 2JP1A 4HJ8A 2L68A 3N91A 3OW2A 4K2LA 3HRZC 1N36Q 4DUZL 4JPBW 3S1QH 3OIQA 2R7ZB 1SWTA 4LFBL 3RDUA 1OEEA 4Z2PA 2W2BA 1KL3A 5I9OA 1CI3M 3M4PA 4I3DA 2HT1A 4KHPQ 1S5DD 3I4NB 3A8JE 1WTOA 5M3MG 4X3KA 2B63B 1A15A 3DWQA 1GT4A 3TRZA 2NZHA 5LJEA 1PH5A 4J15A 5CYUA 4JV5L 1SWUA 5I4DA 3TP5A 1VF5C 4OO1G 1C9OA 2M9VA 3A74A 4KV6A 1AW7A 1PZID 4RGMA 1FR3A 4DAVA 4I3CA 4A1HA 3S9WA 1HNZQ 4C3HH 3GTKH 5CV9A 4G57A 2F0NA 3FVQA 1OO9B 1LIEA 4K6LA 4R4OA 1LDQA 2J4XA 2NWGA 3GTKB 2KW1A 4U68A 4DV4L 4KC8A 3WJFA 1K8MA 4CPFA 4YCWA 3KZAA 4OX9L 3GV3A 2Q2PA 4PNYA 1ZNGA 1SY3A 2OT2A 1RTNA 3RLOA 5LL6S 1AH9A 1EY7A 4R4QA 1L1OC 3PUXA 1JQYD 3G7XA 4CDEC 1QVCA 1PEEA 4PMWA 5FLMH 3WYQA 2WQ9A 1EQRA 1F2YA 3HWFA 1H9RA 1CKOA 4AYBG 3KF8B 1EIIA 4YCVA 2OYBO 3GV6A 1AZPA 1LTBD 2R7FA 1G291 2YTVA 3CC4A 1H95A 1HZ9A 4ORXA 3OHXC 3ITPA 4M1UB 3I7FA 3K80C 1DZMA 1NDJA 1JYDA 3KF6A 2F0OA 3VE1A 1XNQL 1STHA 1ICNA 5IRAA 5L3YA 4DV0Q 1VWGB 4A4IA 3F2DA 4B3MQ 3JSQA 2QOSC 3FMCA 1I3QB 4BBRG 4YVBA 3OTOL 4A3GH 2FHTA 4DV1Q 3HKZE 2LMCB 2YMSA 4GGRA 2K28A 4QYPA 4K0KL 4JOIC 5DM73 2N78A 2NTSA 1NBXA 1A2UA 1U18A 5EDCA 3HOEA 3UDXA 1OTCA 5K36G 5GAGC 1SYBA 2E76C 2ASBA 1SY0A 1Y52X 4A3LG 2KCMA 3BY0A 2VUMB 1RHPA 3UDGA 2X6GA 3TS0A 2L9CA 1QILA 4QNIA 1OXXK 4DV3Q 1TU2B 3DSZA 1FNVA 3TS2A 1HFNA 1SWBA 1SLEB 4YBUA 3NQKA 4CDEA 1PBYA 2YU9H 1JT8A 2M00A 2JN3A 2OFBA 1I4GA 4L5TA 4OELB 5GAEC 2RTQB 1Q81C 4ZH6A 3QO2A 5KNCA 3I4MB 1ENCA 4NV8A 3SK6A 4D6AA 3K59A 5IXGA 3W5OA 3S2DB 4HIOA 1Q82C 4FXDA 4B55A 1WCMH 3RDMA 2POAA 3BYYB 2F0HA 4ALOA 3L3OC 2E2HH 3HGBA 1ZRYA 4BY1H 4IURA 4UY8C 1VWKB 3VG7A 1RTOA 1AN8A 2D0OA 1TIID 1LT3D 3BZDB 5I6WA 4IMNA 4PZ7A 4GK9A 1TWCB 3E0EA 2NNQA 3F8AA 4CJ0B 1CZGA 1SY2A 3OE3A 1SWKA 3D9WA 1QOHA 1QY0A 3C76X 2C1SA 5FFHA 1EOVA 4JI7L 1HA6A 2EVBA 4JYAL 3KDFA 1ADLA 3GTMH 1YNND 4PSQA 3FR2A 1X6OA 4B3SL 1JJUA 2K23A 2CZTA 4QGUA 4C3HG 2VUMG 1U17A 3FPPA 5LJHA 4RGTA 4DR3L 1G91A 3F9DA 1F77A 2WWPA 4QYNA 3OMCA 3LGJA 3ZJYC 2OZQA 1DOLA 3D3RA 1BBUA 4B08A 1GGLA 2JE6I 4ULLA 2F52A 2NVXH 3VE2A 1Q1EA 2G9DA 1X71A 3QQ2A 5AJ3Q 4LAAA 1R9TB 1EPBA 4TKOB 2A6ED 4JI2Q 2ZJRA 1IFBA 2K5QA 5B29A 3T4AC 4N9TA 1A3YA 2OTLA 3M85A 3L9AX 2QA4A 4DXGA 2OVDA 5C5LA 2XSCA 1T5XD 3GTGH 1TW4A 3VR5A 1PH7A 2DY7A 2P8GA 1KT5A 1KABA 2MWHA 4ID2A 4IB9A 3K57A 4G7ZC 1GUSA 5C5MA 2JW1A 3MXNA 1NMFA 1S40A 4YGHA 2Z4HA 1BRPA 2PYKA 3MZ5A 1FDQA 3VR3A 5AEOA 1X3PA 3P1HA 5IYDG 1VPRA 3FDTA 5COYA 2I46A 4EX5A 2R73A 1BBWA 4H0LC 4JG2A 1LV9A 3C46A 5I9PA 1A57A 4OEMB 4OHJA 2E2JB 5C0NA 1RIPA 2W2FA 3VG4A 2ZTCA 3T1YQ 1M90C 3AB9A 1FEMA 2XIWA 3FPUB 4DKAC 1E2TA 4YCHA 4QY7A 4LWCA 3AU7A 3K7UC 1B44D 5I2YA 3DHQA 4I60A 5HZ9A 4DR5Q 2JA6B 5G3LD 3Q8DA 1GO3E 1YP6A 1EY6A 2QF7A 4YWMA 2N55A 4P73A 1PLFA 3JAML 4C3JB 2RCTA 1NSNS 4BXXH 4ZGUA 3L0OA 3OOCA 3H3VI 3F1ZA 5IE8A 4QUCA 1QWDA 4BX6A 1VWOB 1KQSA 2LXKA 5BN3A 5IY0A 5F1EA 2GA4B 1YI2A 4RWSC 2IPKD 1XWEA 1G7NA 3OWFA 1OBPA 3I73A 2RTAA 5IT9c 4RA8A 2K75A 1Q8KA 1GUTA 3CWKA 4DV5Q 3KJPA 4MZ9A 2LBAA 3GQBA 3P6DA 1EY4A 1VQ8A 2DGYA 3K3LA 1X3EA 4H44C 5I6YA 1PRTC 2RKSA 5M3MH 3ERQA 1Q90A 4C3IB 4FGIB 1GXDC 3D4RA 4MN3A 2G5LA 1F9QA 1SE4A 2K6AA 3IFBA 2E5LQ 4MVKA 3GP7A 3GAQA 1L1OA 1AFPA 2FLJA 2EYHA 4LUOA 2UXCQ 5DPQA 4D6BA 2E2DC 4A3IH 5KRUA 4RKBA 1WTHA 2UXCL 4GZVA 2JU3A 4A8ZA 1N33L 4ID6A 1SXWA 4EFGA 4F88A 4XMEA 2WUTA 3IFTA 2ICEC 1T8VA 3S5XA 1SXYA 1UYOX 2F73A 2WSJA 3VHIA 1EUOA 4DCBA 2QKIC 2HUGA 2ZAGA 4O1NA 2HQLA 4MTKA 1VWBB 1K8OA 4JI6L 1SXUA 2HCIA 2F0TA 4A3LH 1STSB 5L8NA 3GTQH 4KTAA 1K73C 1A2DA 4DQ4A 1LO5D 2PMZE 4IUQA 3I4MH 5HA0A 1B53A 1LUZA 3C78X 3M4YA 1N9YA 5CC4A 1BWYA 4C3IH 2X45A 2N49A 3VG5A 2JA7G 4O4XA 3ERSX 3S15H 5IGEA 1MDCA 2B2WA 3M4QA 5IGFA 1A3VA 3HOXB 5JEAJ 3C77X 5AJ3L 5EZ2A 3IFDA 1KRSA 1PV4A 2L15A 4GS3A 1ZEQX 3PF5A 1HTLD 3T16A 1VYGA 4POFA 1FENA 1V1QA 3H0GG 5IYBH 1N8RC 5EPJA 4K14A 2LA7A 1N33Q 3WJCA 2EJMA 4GRJA 2L5TA 1MK5A 4O49A 2UUBL 1P6PA 1A2TA 1OEJA 1BCPD 2DJGC 1WTVA 1AZQA 1K3BC 2AKWB 3MBTA 5B2AO 4DK1A 3S26A 5L8IA 2OY8A 3ONAB 5EQ0A 4I7AA 1K28A 2FHNX 4IOAA 3APUA 3RSWA 1HRJA 3Q24A 2C9OA 2HDMA 4RCNA 2BCOA 2Y32A 2O4XA 1Q3LA 1UE7A 5IGGA 5IP9G 2KJXA 2IZDB 1G6PA 1SMPI 1ERXA 5HWZA 4K0KQ 4GKJL 1R4QB 1TS3A 4CKCA 1S44A 5B5GA 3QB3A 5A35A 1U4MA 3AKMA 2AWNA 2G5DA 3OMGA 4DUZQ 3M7GA 4DF7A 2NN6I 2R56A 1UEBA 3UDFA 1VQBA 3CCUA 1H91A 5F2BA 4ZAIA 4DV3L 4X66L 1E5PA 1EW3A 1ZNEA 3CCSA 2IZBA 4BY7G 2DJFC 1T0VA 2F0KA 2FRSA 4ZHCA 1WCMB 3EYCA 1L2FA 3RDQA 1NJIC 2R7DA 1QG5A 3P6FA 1WTQA 3KVNA 4A93H 1S4ZA 3RLFA 5IRWA 1DJRD 1BM5A 3TZDA 2A6HC 2WINB 3BVMA 1D5ZC 5CMDA 2SNSA 4CDCA 5FAZA 1KT6A 5C44G 4EXZA 4ZKCB 1Y1VB 3NTIA 4L3RA 2D9UA 4INNA 1SR3A 5IO7A 4LK1C 4DR7L 4DGZA 5L37A 4HSPA 1SNOA 3PUZA 2JA5B 1X8NA 1Y9LA 2LKKA 3Q6LA 3A54A 2FKGA 1MGSA 1PFBA 1EY0A 2VW9A 4IQZA 2CHBD 1BDOA 5EBCA 1JMZA 3GTMB 5IIFA 4GKJQ 3PCOB 2ACOA 2XRSD 4ZCKA 2QW7A 4KY5A 3FEWX 3TGBA 2K14A 3HZXA 1AE2A 3FEKA 1OBUA 2UYWA 4BGFA 2MHVA 1SWFA 1BLRA 2Q2IA 1OPAA 2X8SA 4HWMA 1BRQA 1I3QH 2HKDA 4XMGA 3F2BA 2VXWA 2K5DA 4YY3Q 3RE6A 5LJDA 2F0PA 1VQEA 1SMXA 4ORUA 3NHHA 2Z0SA 1D1IA 2XWJB 3EBWA 5FO8B 5D3DA 3KLSX 5CSEA 4LF5L 4K6DA 1OXUA 3ZW0A 3FR4A 2VFBA 2FR2A 3RDSA 2I5ZO 2I5LX 3LX0A 2SNMA 4PG3A 4GN4B 1H9SB 1VWMB 3STKA 1I05A 3PH6A 1L0XB 1IKMA 4ME5A 2VDFA 1TWHH 3FR5A 3FDCA 1UAPA 3RLNA 4DK3C 3SAOA 3VG2A 1I4RA 1FD7D 2L11A 2PNRC 5CBAE 5J22A 4IPCA 2YU9B 1QJOA 3AKNA 3DM1A 5FO9B 3J81L 1VWAB 1PRTB 4A3KH 4QCLA 2B2UA 4GJVA 3H09A 4QUFA 1SNCA 3TDQA 2IZJA 2FJ2A 3R8BA 5K5PA 5HAEA 3CD6A 1VMPA 4Y0RA 5LMUQ 5M5WB 2NVQH 1K8GA 2DJFA 1RBPA 4LQZA 2F1MA 5M3MB 2CQAA 3D6WA 4GETA 2OY7A 4JHQA 4DV2Q 2NZOA 5DLQE 3PECA 4K19A 1SWNA 1CUKA 1L0YB 3NENA 4JOIA 1FVIA 2HHHQ 4A3GB 1NBWA 1FJ1E 4QF4A 3P02A 5IGBA 2XWBB 1EYGA 3H0GB 5DNFA 5T1GA 2Q8TA 2R74A 5HZ5A 2AMCB 1T5EA 2QILA 2CW0C 3ER0A 3HTYA 4FF4A 3NWTA 3GDEA 1TVQA 2SEBD 4JK1C 4BVMA 2C5CA 4HPDA 1VQOA 4FF1A 4KJNA 4KT5A 4RUUA 1SDFA 2DN8A 1NP1A 4NW2A 1AP0A 1Q1BA 3T6LA 2NZ1D 5L8OA 3HKZB 5FJ8H 4ZHGA 4G4KA 5EPLA 2Q39A 2OF8A 2IY5B 4IFDH 2JA5G 1SYEA 5E4XA 2JA8B 4WHIA 1EIGA 2NVXB 1IW2A 4L5RC 3HOWB 5FJ8G 1SWRA 3GTJH 1J9OA 2IZHB 1O7LA 3RZOH 1LPJA 1U5KA 2B29A 3RR5A 4JI1Q 4DR3Q 1J5EL 1E1TA 1AB0A 3HOZB 4ORSA 3VYSA 5KYIA 3RY1A 2CAMA 1S5FD 4TQ2A 2BHVA 1N9MA 1JR0D 3J7AV 3UE1A 4BX7A 4AZNA 1I4UA 1HXLA 4X65Q 1WVLA 1SROA 3VR2A 2YTXA 2X4MA 1XKIA 5EEDA 1LICA 3G4SA 5CV7A 2UU9L 2NB0A 1BJ7A 4YCUA 4DN4M 1QUQB 1VCIA 4BX6B 3FA8A 4ABNA 2Z9HA 1KLUD 5IWAQ 2OL8O 3KFGA 1VQ4A 3ZQ3A 4HIDA 2JYOA 4V0BA 5HCCC 4IFDI 4FQBB 4HEDA 3NP1A 2K5NA 1SNDA 2OL7A 1HQQA 1ILPA 2RHSB 1XMQL 5JJKA 2OY1O 2N3SA 5CHKA 2C1QA 1QABE 2NYZD 3U9SA 5I2XA 2G8CO 3RZDB 1DV9A 2VB3X 3HOZH 4HJ9A 1FNUA 4DAYB 5HGTA 4UU3A 4XMDA 2K4KA 3PIP3 3HOUH 1A18A 3C1EA 1BNZA 5HZ6A 3BDRA 4A3FH 3D97A 4KHVA 3KBGA 1TS4A 4O0AA 4OS3A 2KHSA 1S5BD 1F2MA 3NK9A 1XTCD 5M3FB 2IZFB 4FNFA 3MWYW 3PO3H 5IP7G 1S72A 1JB7A 5HTDA 1Y8NB 2D5DA 2L9HA 1AVDA 4B9XA 1K9MC 3HOUG 3HWDA 3DWPA 5FK9C 3GE2A 4L6TB 1XNQQ 2F4VL 1STAA 2WACA 5JJIA 3WZQA 3BX8A 3BZKA 4HJAA 4B3RQ 1DONA 1HNZL 4FF3A 4ALBA 3A8KE 1PYSB 3J81E 2EQSA 3STBD 2WB1G 2K01A 4QAEA 3S1RB 2UUBQ 1EIYB 4OMWA 2GTFX 2A5HA 2SOBA 3NEMA 1LDOA 1WD1A 4APVA 3I55A 1ILQA 4A93B 3SLJA 5EBDA 5JR8A 1KHIA 3RZYA 3WVMA 3ZI8A 1F9PA 1MJCA 2YYZA 1MOYA 1IBMQ 2VL6A 3PUYA 3S1RH 4WJ3M 2E2IB 3IL8A 3K81C 1WTRA 1BBPA 4MNOA 2Z6BA 4DAPA 1I50B 4PZ6A 1VQ6A 4KC7A 5KIDA 3PQSA 1MIUA 1E2ZA 1HNXL 3WOVA 3S2HH 4DFAA 5M5XH 5HCEC 1E0BA 3CRLC 3B2KA 4DPGA 3URYA 2C4IA 2MO0A 3VPJE 3WZPA 3EFXD 5JJZA 1PMPA 1SN8A 1XCAA 2BLGA 1EIOA 4LF6L 4QIWE 5CBEE 3ULJA 3CCJA 5EKKA 1STYA 5M3FG 2IFBA 3UI2A 2RN4A 4O4OA 2XSTA 4DXFA 2PI3O 2NVYB 5C0XG 5C4JB 2RTJA 4MTNA 5BN5A 1KAWA 2RBMA
chains in the Genus database with same CATH topology
2MUYA 2OEOA 3I17A 2G9HD 3PEDA 1B50A 1JWMD 1OXVA 5IO6A 1LTAD 3NXWA 2R61A 5CORA 1ICMA 1QFTA 3P75A 1SXTA 4MIRA 4C1NK 1B56A 4GU8A 1LTSD 1F2LA 4CGYB 2WEXA 1MUPA 1SMYD 2IW3A 3H3VC 1SA8A 3NPPA 3S14B 4KY6A 1IW7D 4KN4C 3WOEA 1CZWA 1TS5A 3KLSA 3BS2A 1OEKA 3Q0AA 3LHNA 1X32A 2N93A 1SBBB 3TP8A 2A68C 4CJ1B 3CBSA 1G6ZA 4V190 3E0JA 3PMFA 3N6RA 3ND9A 3I0AA 1JJJA 1TOUA 2LY7A 4Z9CB 2VB2X 3CU7A 5FLXE 1FGBD 5H8TA 5E4WC 1DFVA 1KQXA 3I90A 1JJXA 3HWEA 3K5LA 5NUCA 2NP1A 2NUCA 5CV8A 3SR1A 4HSVA 1FTPA 1D5XC 1TWHB 4DQ3A 2QCPX 3FYFA 2B2YC 2KEDA 3APVA 3SK8A 4HCEA 3CR6A 3J80L 3EJIA 4FXGC 4CKEA 1TOWA 1LT5D 1QNUA 1G5WA 2K32A 1SNPA 4YKMA 2RQXA 3OJYC 2YG2A 1ZKOA 3NADA 4YBPA 5A2QL 3S17B 1LLRD 1GX9A 2FINB 4ZH9A 2RVLA 4J8QA 4QGVA 5TSSA 5EKLA 3VR6A 5IGCA 3ZW1A 3KF8A 1E06A 4A60A 2EU7X 3WJEA 3U03A 4OL7A 3OIPA 5LJGA 4O3ZA 3STNA 4HPAA 2O2LD 4PV1C 1SJED 2G78A 1X8PA 2Q2MA 1MSGA 5EPKA 4WBKA 1HUMA 3T53B 4ARHA 4ES7A 3FA9A 1PMRA 5H9AA 3WJBA 1LIDA 2R93B 2IX1A 1PTOH 1AQBA 1LTGD 1GX8A 5BVTA 1GJXA 3VG3A 1GUWA 1GKAB 1BQQT 1Q12A 2WEWA 3VR4A 3PP6A 4YDAA 1HTPA 2X46A 1V1OA 1TWAB 5JVG3 1SAPA 2ZAIA 2SDFA 4K8IA 1AELA 2TSSA 1JWSD 2IL8A 2HMBA 1GUNA 1YP7A 1RF2D 5FKAC 4KD4A 1C48A 1W6JA 2WQAE 2B2UC 4AZQA 1EWHA 1R0UA 5HZQA 2F4IA 5FQ7E 2OVEA 1SXXA 4I65A 3ND8A 2CM9A 4TSSA 1GT5A 2RSNA 5D4AA 1DCZA 1MX7A 2KUMA 1PZJD 1FNWA 3KUPA 4KKUA 3ZW0B 4P2CB 4QZUA 3BX7A 4IMOA 3G6JB 4ZUJA 1SFOB 4KHZA 2PPBC 2F0IA 3R2IA 2F0QA 1EY8A 3UEWA 1X89A 4FBVA 1B1ZA 1UEAB 4X3SA 4NP5A 1EPAA 4ID2A 5FO7B 1IKLA 1B9MA 2AQ1B 3EMMA 5KHPA 4I3BA 2ENBA 1TXLA 1BSYA 5HA1A 2LBVA 2KQ3A 1TWFB 1WTWA 2X69A 5C0XJ 4RH6A 3WJGA 1PTOF 3ZZVA 4NW4A 2XNAC 4XIGS 3K5NA 2XRQD 3QJYA 3NBXX 2O5JC 2K5WA 1TQOA 1HBPA 4C56C 2FT9A 4IMNA 3DEPA 2FTBA 1GXAA 2K33A 2L1BA 3GTQB 4KH8A 5M9OA 5C0XH 3J7YW 2AT0X 5J1ZA 3WDNA 1EL0A 2K62A 5EPQA 3T1DA 5EGTA 2H4OA 2HCCA 1DZJA 2NN6G 3MAQA 1CQVA 1KAAA 3QOLA 4YGZA 3SOTA 1YNJC 1S7DA 1PRTD 1U0XA 2NNDA 1X3QA 1JYJA 4XTCS 3VA7A 1BCPC 4A3MB 3O19A 3K5OA 3V2TA 4XDXA 3D4DA 5C6AA 1JB3A 2EYJA 2AUKA 5HBSA 3TF6A 3E3CA 3QWNA 1LTRD 1UUPA 2HDLA 4U673 2F0VA 2JU8A 3LV4A 3DUZA 5ISRA 2KT4B 1Y1WB 1IFCA 2NVQB 2KTDA 4LZVA 1U4LA 2EE1A 5LJBA 2N88A 5ELFA 3NTKA 5C4HA 2ZXOA 5C44B 1F9RA 1I6HB 4NKLA 4ZHFA 2EYFA 1DZ1A 3V05A 2B2VC 2BA0A 5D45A 3P24A 3BLGA 2Q4NA 2M2LA 1UZ2X 3KLRA 1TVXA 4ZR2A 3MC0B 1UREA 1KZXA 4KN7C 5D48A 1ACDA 4GH7A 1PFMA 2EYLA 2KA7A 4IZ8A 2O5IC 3B2HA 5JPNC 4L8JA 2JMBA 3ELXA 3QG1A 4ZHHA 2GTLM 1ICWA 1G74A 1QY2A 3A7AB 4GDZA 4MVIA 5F6ZA 1HQRD 5AFWA 3STMX 4IABA 4CK4A 2EJFC 5KNDA 4BS9A 3EBKA 3HOVB 2PMZB 3V8UA 4M6SA 5JAVA 4J1MA 1II3A 3A8IE 3BVZA 4L63B 1H9MA 2X8FA 3BU9A 3CQZB 4YFQA 4YFRA 3JS1A 5D3IB 5ELBA 4S3SA 3C1FA 1KLGD 1B2TA 5AJCA 3BU1A 3NUCA 2KECA 1BXTA 2KD2A 4TKHA 1SYGA 2ZT9C 2QO6A 4TJZA 5F2DA 4HAEA 3RMHA 4K2KA 1A3TA 4O42A 5IT9E 3S16B 2L0CA 4C2MB 5M5YB 1LFOA 2PCFB 3NE5B 2WP8J 1EYAA 2M4LA 4HPBA 1FELA 5JPMC 3MA2B 4PQXA 2HQEA 1TY0A 3MFYA 5IO5A 4O4SA 2WB1B 2DY8A 2B8GA 1B0OA 2EYPA 1X8UA 1ESFA 2A73B 4XQJA 2BT9A 2EYMA 3NSWA 2XKLA 2J7ZA 4H13C 5H9NA 2K03A 2B2TC 4IB6A 2I07B 3UAQA 1IKJA 1RDPD 2PZWA 1JZUA 4WFN3 2H1EA 3S1QB 5CE4A 1C8CA 2E2HB 1XX8A 2L12A 1HUNA 2F0EA 2MJIA 3FW4A 1IYVA 2HLVA 1SYCA 3NR3A 1EXSA 1KOIA 4GKCA 4TRDA 3MHBA 4F87A 4NMZA 5KIXA 5C4ZA 5D8JA 3G7LA 4OMXA 4AZMA 1S2PA 1YWCA 4ORRA 1EWCA 1VDZA 5ELEA 3U9OA 2L4NA 5J39A 2KEEA 2EY1A 4ODGA 5C0XI 4EQOA 1BBXC 3P7JA 2AMMX 1TT2A 1EFID 2WIIB 2JSOA 4ZJ0A 4FO2A 4M7MA 3D6CA 4O3XB 3I91A 3VG6A 1LACA 3SDZA 5C4XB 1X8OA 1JOOA 1EEFD 2E75C 5B27A 3NQIA 3KFFA 2BS5A 3RUZA 2K1BA 1B4OA 4FP5D 1HCZA 4KCAA 4MVLA 5FQ8E 1ET6A 4PJ2A 3L4RA 2JXMB 3FELA 4FVMA 3O22A 1HMRA 4BY1B 4YMYA 2FS6A 2XN9C 4N7CA 4YH0A 1ML0D 4IUTA 2MGSA 3C3LA 1KDAA 3TP6A 4LJZC 3TZSA 4ORYA 2E74C 3NBIA 1GOZA 1EI5A 1EZ8A 4YKOA 1RODA 2WKDA 2RSOA 1YWDA 1TR5A 2BDOA 4BA1I 5D47A 1EU3A 4EQPA 1GM6A 2F3VA 1M8AA 2G79A 4CSBA 1NP4A 4X3TA 4ODDA 4C3JG 2F0WA 3M7NA 3IA8A 2LKVA 4NDXA 2LFNA 3X3MA 3QKGA 3UEUA 2Y0SB 3WJDA 2F0JA 4QGXA 5DM63 3WXQA 1SE2A 3NTHA 3S5VA 4EEJA 3HOLA 4OS8A 4R0BA 5C3EB 4YDBA 1QCBD 4YIJA 1JBHA 2AT5X 4XYQA 2AKQA 4IFDG 3AMUA 4OIJA 1B9NA 1V1PA 1U4PA 2R6GA 3RBYA 5CV6A 3FENA 5E3FA 3CBCA 1Q8IA 2RCQA 1DXMA 3CMPA 2FMMA 3SHLA 1STGA 2OXPA 1KXOA 1E2WA 3H91A 5H9LA 1HHVA 1FE3A 1V1PB 3MXUA 3O2YA 5C3XA 4ZK9B 5C3WA 5KYLA 1JIWI 3NQ3A 4FBRA 1CA5A 1KTKA 4OS0A 2HYSA 5FLXL 4L1NA 2JEAI 4OO1H 4R8NA 5ELCA 1YUPA 3GD7A 4KD3A 4ZLTF 1G2TA 4C3HB 3P6CA 1IW7C 3BYTB 2B2YA 3H3IA 1Z6HA 1HXYD 4ORWA 2OFRX 2BS6A 1LTTD 3ELZA 3Q23A 4QRLA 1EQVA 1D3SA 1E00A 2NBFA 2NVTB 3S60A 3ZWEA 3TZUA 4AYHA 2NN6H 2K04A 3KK7A 4XQNA 1KGLA 3T51B 4U3QA 5BVSA 3I4LA 2GJ5A 3EA6A 4I9RA 2B2WC 1PTOC 5F6BA 2V4DA 1S5CD 1DZPA 1MVGA 1B3AA 4WJWA 3HP3A 1DF3A 1C4QA 2A74C 5LKEA 1X8QA 3I70A 1F9SA 1SY1A 4HN7A 1CJ5A 4N9PA 4NYRA 2FWVA 5LJCA 2RDFA 3GTGB 4KJOA 1IHZA 2AH7X 4C1NI 2F09A 1JORA 1ZNLA 1ZNDA 4ZKBB 4U8UO 5DG4A 1LT6D 1RD9D 1U9RA 5FOBB 5CV5A 1EEID 4AZPA 5K06A 2DNEA 3FW5A 2KCCA 1LIFA 1TS2A 4EDEA 5CYBA 1MD2D 1ML7A 1I6VC 1NAPA 1O8VA 4QQ1A 4FXKC 2Z1CA 4AZOA 2A6HD 3LWUA 4Q5VA 1SMYC 1IL8A 1H9JA 3NP8A 4PMBA 2EY5A 4RAUC 2DM5A 4O3YA 4WRDA 4QGWA 3F2UA 4G7OC 1EYDA 1MBYA 2B2VA 3BDOA 1HPCA 2EJGC 4XMCA 3K7AB 2ASNX 4DK0A 2OF1A 1BO0A 3BVGA 5G3LF 3MX7A 2PY1A 1EZ6A 4QIWB 1Y69U 3SK4A 2WAQB 3QIAA 4UU2A 2F0GA 4EGVA 2ALLX 1HBQA 4K5XA 3TGCA 4BWGB 1CBQA 2JOZA 3I72A 2QO5A 4ZQ3A 4U8UN 2RA4A 4ZFXA 5DEHA 4MHEA 5FENA 3PUWA 1CM9A 3FRPB 1N0SA 1JOKA 4IAWA 4IB7A 3C2PA 4O3WA 4NLJA 3SE0A 4U8UM 3VYUA 4HTHA 2IWHA 4BBRB 3K58A 5BN4A 1NR2A 1VF7A 2AT8X 3F6ZB 3WOFA 3SXHA 4IALA 4G7HC 3FKIB 4NP1A 4EQNA 4AZRA 3IAYA 2GC9A 3SVMA 3NWSA 4RKLA 4DU9A 1TKWB 2BE5D 3OPOA 2FS7A 3RD4A 4RHRA 1EY5A 2FFKB 1CHQD 1CTMA 3VU1A 1DYQA 1HMTA 3S2HB 4DAYA 4LKPA 1RLBE 4F8MA 4A1YA 2NNEA 1IIUA 4X3UA 4OIKA 1DD2A 3MVVA 2HNXA 3P6GA 4ML7B 1TWGB 5HURA 1B8EA 3BRNA 1PRTF 3ZW2A 3TMEA 4QZTA 2QDBA 1SEBD 2ACPX 4HPCA 4LZUA 2A2GA 1BUVT 3RKGA 4KIIA 3PUVA 4CHTB 1AEXA 4FF2A 4WORA 3WBGA 2CZUA 4IN3A 3MTSA 1SJHD 2WR6A 1JE4A 2F0LA 1CQFA 2LS01 2PZTA 1MX8A 3K0YA 4IUVA 3PO3B 1PZKD 3R3OA 3KBXA 1I4HA 1ZXTA 4TQUS 5E1FA 3KFHA 1O78A 3GTOB 4BQUA 4A3JB 4CKBA 3NQTA 3PQUA 3E6ZX 2JEBI 3TP7A 1VMCA 1JWUD 2F0UA 1E02A 1BOSA 3NPOA 3HEJA 4ILWA 2ID0A 4DA2A 2W2AA 3PV0A 1V8QA 5LL6X 1DC9A 1ZNKA 2HZRA 2PZUA 4H7BA 2O62A 3EROA 1EIHA 3R2TA 4KI0A 1W6KA 5DAUA 4IUNA 1YNNC 4OGQC 2OVAA 2AT6X 4XT1B 4CBVA 4BBSB 4MVEA 2Q8RE 2L67A 1V43A 3GTPB 2RQ0A 2EDGA 1YIVA 1D5MC 1J8IA 1KNAA 5BVQA 3FMZA 3A56A 3HWGA 3RZOB 1WD0A 3NQ9A 4FBOA 1XYIA 2A3FX 4BY7B 5AJBA 2A2UA 1JC7A 2F0SA 1PFNA 3TN2A 4NYQA 1JOQA 4IUUA 3SK5A 1GT1A 4K5VA 1DOMA 5JOBA 3MVFA 1ESRA 5M5XB 4IFDJ 1SYDA 5CV4A 3A55A 3PO2B 3PPTA 5AQ6A 1HMSA 2LB6A 2TMPA 1WTXA 2MM3A 1XXGA 1F2ZA 2MP1A 3HS0C 1QY1A 5EEEA 3FIQA 3H6MA 3Q22A 5F58A 2ICIA 1Y9TA 5KGUA 2RA6A 5K36H 1T68X 2AUJD 1SNMA 4GZYC 2PO4A 4M8AA 4Y0PA 3T56B 3B2JA 4Y7NB 5IOCA 4FYDA 1ERBA 3O13A 2J0TD 1LF7A 3OD9A 4YFPA 2OFMX 4KY7A 3I8ZA 3OWEB 2MPMA 4JGLA 4RCOA 2KTSA 2AT3X 2BE5C 3UEVA 3U0DA 1QNKA 4IB8A 2QM9A 4COTA 4Q0FA 3M4OB 2EYOA 1KQWA 5CGKA 1AVGI 1CA6A 1BSQA 1QE6A 1I06A 1YWAA 1TY2A 3OSOA 1QFVA 2AQ3B 2X6LA 4ZGFA 4HFOA 4YGGA 3DXJC 3H94A 3MXGA 1D1KA 4F7XA 4OO1I 2QO4A 1YNJD 4I7ZC 4TLJA 3TBIB 5KNBA 4B9WA 3HOUB 1D2BA 1O1VA 3D31A 2K05A 3E5SA 2EZVA 5A2QE 1PYWD 5D14A 3GTLB 3DWAA 4TKJA 2JU7A 5JEAG 2B39A 2IX0A 2IT1A 2BDNA 1E2VA 4IUPA 4RUNA 2R92B 2EOTA 3R93A 4JBWA 4QMGA 1D2UA 2AQ2B 2BOSA 4BOEA 4HMIA 3P6HA 1OXSC 4RHSA 2K7VA 1RJTA 1NGLA 1Y8OB 3EVQA 1KDBA 4WFVA 4R9WA 2VNUD 3CHBD 1MI2A 1LIBA 2NTTA 1Z7TA 3KFIA 4ZYSA 3ZW1B 3D8GA 3RWXA 3KQ0A 2ZXRA 4LKTA 1BCPB 1DM0B 3JAME 2MJ8A 3IKJA 1SE3A 1SNQA 4NNTA 5IODA 1NCVA 4ZRZA 2CM4A 1I4QA 3BDLA 1LTID 3EM0A 5EKIA 3OBLA 5EDBA 1U4RA 1FYCA 1K83B 1EY9A 4BA2I 4YCEA 3UEXA 1RCVD 3BG3A 3QOJA 3LWEA 3MFGA 2WKCA 1CRBA 3V96A 4KKSA 4EVOA 4ZCBA 1G8ZD 4KKTA 2X8TA 1OXTA 2GTLO 3S1NB 2E4JA 1STNA 2A69D 2A0AA 5HTEA 4XQQA 4GE1A 2MHDA 5H9KA 3D96A 3N52A 1G85A 4TKBA 3L7ZC 2D62A 4RGNA 1DOKA 2FR3A 3HOYB 3VA5A 2CBSA 1R4PB 4O9SA 4DNTB 3P20A 2A68D 2JA7B 1HFGA 2Q9SA 3ZYYX 4N7DA 1CFMA 3SEBA 1GHKA 1A6XA 1ZNHA 1LT4D 3K5MA 2B2TA 3MEHA 2CW0D 1HQMC 2RD7C 5JVH3 1RKNA 3TSSA 2AL0X 1NUCA 4PMCA 1D6EC 1OPBA 4UAIA 5LHY1 5IT9L 1STBA 4HCSA 1EALA 2EPBA 3Q6SA 1Y8PB 3A7LA 3D95A 4MIUA 5T1IA 1WTPA 2F03A 4DNRB 2A13A 1PDQA 4HR7B 4Y0QA 3B2LA 4CJ2C 2CVRA 3W2DA 1PM1X 2LFOA 4UDUC 1QG7A 4K5WA 1KDCA 1HA5A 1I04A 4XMFA 4QB4A 2F3WA 4J6HA 3NX1A 1ZYRD 3J7AF 3BDCA 4NLIA 1H9KA 3TGAA 2IJ0A 1LABA 4WFUA 1M4VA 5KICA 1BR9A 4AYBB 1YWBA 1ENAA 3P6EA 1G2SA 3APXA 2L55A 4A3EB 1HQPA 1KT4A 4A3KB 2F0DA 1ALBA 1OBQA 5EJWA 1QWYA 5ELDA 4A3IB 4ZHDA 1KT7A 3LNNA 4TNNA 1O80A 4XMHA 3CKIB 1SYFA 4O4UA 1KT3A 3S1MB 4U9CA 4CV7A 2F0FA 4GNWA 1CK1A 3FA6A 1GHJA 1NR4A 2L5PA 4XXEA 3J80E 2ANSA 3B2IA 2R3ZA 3JQOA 5CR3A 1BF4A 2XVSA 2D2CC 2RDGA 2WV6D 4KK7A 5IGDA 1S5ED 2MO5A 1DZKA 1IYUA 1KNEA 2PW5A 1BCPF 2B8FA 5KEEA 4LMQD 1BSOA 4C3IG 3S15B 5BYPA 1CHPD 3ZUIA 1I4XA 4E6IA 3HG9A 3APWA 2IX3A 5D65A 1H9SA 4XYOA 2PQEA 1L6MA 1HN2A 4GNYA 5F7GA 4KMUC 5HZ8A 2QMIA 2CBRA 3VYTA 4A3BB 3CQNA 1QQSA 3W3AA 3GTJB 3T13A 1VYFA 2BA1A 2EXZA 3M3YB 5JEAH 4I95A 1ET9A 1CBSA 3PIO3 4XT3B 2Z4IA 3NX2A 1EYCA 4EQAC 1B4MA 4ZUIA 2EY6A 5HCDC 1CBIA 3X3NA 1ZYRC 2PW7A 4MISA 1PBOA 3GO5A 4NNSA 4R8IA 3DMUA 4I9SA 4A3FB 1IKEA 4Y0SA 1EQDA 3BSZE 3CQRA 1JICA 1A3UA 2GTLN 4IAXA 3OW7A 1MSHA 5LKFA 1GUGA 2A69C 1O7YA 1LNMA 3ZUOA 4K8JA 1O1UA 1Z24A 1QB5D 4HMJA 1PTOB 1CBRA 3EQLC 2KVMA 3BS1A 3D4WA 5LJKA 1SSOA 2KCNA 2G7BA 2FMCA 2QEJC 3FEPA 4RGOS 1JV4A 3HK1A 1PTOD 1STEA 4IBAA 1GT3A 3PH5A 1PXUA 2Z8LA 3FLLA 3FA7A 3NBHA 4I6SA 4A3DB 4RFBA 4AW8A 3CRKC 1GUOA 3DEOA 1JCKB 3K6OA 2OVSA 1CT1D 1ENFA 1ONLA 2DNCA 2KOLA 1UNSA 3U9PC 2EY2A 2Q8IB 5FQ6E 2F0MA 1O7ZA 2RDHA 1BEBA 3MXPA 1GKAA 3I3CA 2AWOA 3DTQA 1EU4A 3VYRA 2A6EC 1LKEA 1EQTA 1EOTA 1I4PA 4ON1A 1KZWA 1Z47A 2ZXPA 2HZQA 2JP1A 2L68A 3N91A 4K2LA 3HRZC 2R7ZB 3OIQA 1OEEA 2W2BA 4I3DA 5I9OA 1CI3M 1S5DD 3I4NB 3A8JE 1WTOA 4X3KA 2B63B 1A15A 3DWQA 1GT4A 5LJEA 5CYUA 5I4DA 3TP5A 1VF5C 4OO1G 2M9VA 4KV6A 1AW7A 1PZID 4RGMA 1FR3A 4DAVA 4I3CA 4A1HA 3S9WA 5CV9A 4G57A 2F0NA 3FVQA 1OO9B 1LIEA 4K6LA 2J4XA 2NWGA 3GTKB 2KW1A 4U68A 4KC8A 3WJFA 1K8MA 3KZAA 3GV3A 2Q2PA 4PNYA 1ZNGA 1SY3A 2OT2A 1RTNA 5LL6S 1EY7A 3PUXA 1JQYD 3G7XA 1PEEA 4PMWA 2WQ9A 1F2YA 3HWFA 1H9RA 1EIIA 3GV6A 1AZPA 1LTBD 1G291 4ORXA 3ITPA 3OHXC 4M1UB 1DZMA 1JYDA 2F0OA 3VE1A 1STHA 1ICNA 3JSQA 2QOSC 3FMCA 1I3QB 2FHTA 2LMCB 2YMSA 2K28A 4QYPA 5DM73 2NTSA 1A2UA 1U18A 5EDCA 3HOEA 5K36G 1SYBA 2E76C 1SY0A 3BY0A 2VUMB 1RHPA 2X6GA 2L9CA 1QILA 4QNIA 1OXXK 3DSZA 1TU2B 1FNVA 1HFNA 4YBUA 3NQKA 2M00A 2JN3A 1I4GA 4ZH6A 3QO2A 5KNCA 3I4MB 1ENCA 3SK6A 4D6AA 3K59A 3S2DB 4FXDA 2POAA 3BYYB 2F0HA 4ALOA 3L3OC 3HGBA 1ZRYA 4IURA 3VG7A 1RTOA 1AN8A 1TIID 5I6WA 1LT3D 3BZDB 4GK9A 1TWCB 2NNQA 3F8AA 4CJ0B 1CZGA 1SY2A 3OE3A 1QOHA 1QY0A 3C76X 5FFHA 1HA6A 2EVBA 1ADLA 1YNND 4PSQA 3FR2A 2K23A 2CZTA 4C3HG 1U17A 3FPPA 5LJHA 4RGTA 1G91A 3F9DA 1F77A 2WWPA 4QYNA 3OMCA 2OZQA 1DOLA 3D3RA 4B08A 1GGLA 2JE6I 4ULLA 3VE2A 1Q1EA 2G9DA 1X71A 1R9TB 4LAAA 1EPBA 4TKOB 2A6ED 1IFBA 2K5QA 5B29A 3T4AC 4N9TA 1A3YA 3M85A 3L9AX 2OVDA 4DXGA 5C5LA 2XSCA 1T5XD 1TW4A 3VR5A 2DY7A 2P8GA 1KT5A 1KABA 2MWHA 4IB9A 3K57A 4G7ZC 1GUSA 5C5MA 2JW1A 3MXNA 4YGHA 2Z4HA 1BRPA 2PYKA 3MZ5A 1FDQA 3VR3A 5AEOA 1X3PA 3P1HA 1VPRA 3FDTA 5COYA 2I46A 2R73A 4H0LC 3C46A 1LV9A 5I9PA 1A57A 4OHJA 2E2JB 5C0NA 2W2FA 3VG4A 3AB9A 1FEMA 2XIWA 3FPUB 4YCHA 3AU7A 1B44D 5I2YA 3DHQA 5HZ9A 2JA6B 5G3LD 1YP6A 1EY6A 2QF7A 2N55A 1PLFA 3JAML 4C3JB 2RCTA 1NSNS 4ZGUA 3OOCA 4QUCA 1QWDA 5BN3A 5F1EA 2GA4B 4RWSC 2IPKD 1XWEA 1G7NA 3OWFA 1OBPA 3I73A 4RA8A 3CWKA 1GUTA 2LBAA 3GQBA 3P6DA 1EY4A 3K3LA 4H44C 5I6YA 1PRTC 2RKSA 3ERQA 1Q90A 4C3IB 4FGIB 1GXDC 3D4RA 4MN3A 1F9QA 1SE4A 2K6AA 3IFBA 4MVKA 3GP7A 3GAQA 1AFPA 2FLJA 2EYHA 5DPQA 4D6BA 2E2DC 5KRUA 4RKBA 4A8ZA 4GZVA 2JU3A 4ID6A 1SXWA 4EFGA 4F88A 4XMEA 2WUTA 3IFTA 2ICEC 1T8VA 3S5XA 1SXYA 2F73A 2WSJA 1EUOA 2QKIC 2HUGA 2ZAGA 4O1NA 1K8OA 1SXUA 2HCIA 2F0TA 5L8NA 4KTAA 1A2DA 4DQ4A 1LO5D 4IUQA 5HA0A 1B53A 3C78X 3M4YA 5CC4A 1BWYA 2X45A 3VG5A 4O4XA 5IGEA 1MDCA 2B2WA 5IGFA 1A3VA 3HOXB 5JEAJ 3C77X 5EZ2A 3IFDA 1ZEQX 1HTLD 3T16A 1VYGA 1FENA 5EPJA 4K14A 2LA7A 3WJCA 2EJMA 4GRJA 2L5TA 4O49A 1P6PA 1A2TA 1OEJA 1BCPD 1WTVA 1AZQA 3MBTA 4DK1A 3S26A 5L8IA 3ONAB 5EQ0A 3APUA 3RSWA 1HRJA 3Q24A 2C9OA 2HDMA 4RCNA 2BCOA 2O4XA 1Q3LA 5IGGA 2KJXA 1SMPI 1ERXA 5HWZA 1R4QB 1TS3A 4CKCA 1S44A 3QB3A 5A35A 1U4MA 3AKMA 2AWNA 3OMGA 3M7GA 4DF7A 2NN6I 2R56A 1H91A 4ZAIA 1E5PA 1EW3A 1ZNEA 1T0VA 2F0KA 2FRSA 4ZHCA 1WCMB 3EYCA 1QG5A 3P6FA 1WTQA 1BM5A 1S4ZA 3RLFA 1DJRD 3TZDA 2A6HC 2WINB 3BVMA 1D5ZC 5CMDA 2SNSA 5FAZA 1KT6A 4EXZA 4ZKCB 1Y1VB 3NTIA 4L3RA 2D9UA 4INNA 5IO7A 4LK1C 4DGZA 4HSPA 1SNOA 3PUZA 2JA5B 1X8NA 1Y9LA 2LKKA 3Q6LA 3A54A 1MGSA 1PFBA 1EY0A 4IQZA 2CHBD 1BDOA 5EBCA 3GTMB 5IIFA 2ACOA 2XRSD 4KY5A 3FEWX 3TGBA 3HZXA 3FEKA 1OBUA 2MHVA 1BLRA 1OPAA 2X8SA 4HWMA 1BRQA 4XMGA 2K5DA 2VXWA 5LJDA 2F0PA 4ORUA 3NHHA 1D1IA 2XWJB 3EBWA 5FO8B 5D3DA 3KLSX 4K6DA 1OXUA 3ZW0A 3FR4A 2FR2A 3LX0A 2SNMA 1H9SB 3STKA 1I05A 3PH6A 1L0XB 1IKMA 4ME5A 3FR5A 1UAPA 3SAOA 3VG2A 1I4RA 1FD7D 2L11A 2PNRC 5CBAE 5J22A 2YU9B 1QJOA 3AKNA 3DM1A 5FO9B 3J81L 1PRTB 4QCLA 2B2UA 3H09A 4QUFA 1SNCA 3TDQA 2FJ2A 3R8BA 5K5PA 5HAEA 1VMPA 4Y0RA 5M5WB 1RBPA 4LQZA 2F1MA 5M3MB 2CQAA 3D6WA 4GETA 3PECA 4K19A 1L0YB 4A3GB 4QF4A 3P02A 5IGBA 2XWBB 2R74A 3H0GB 5DNFA 5T1GA 2Q8TA 5HZ5A 1T5EA 2QILA 2CW0C 3HTYA 4FF4A 3NWTA 1TVQA 2SEBD 4JK1C 4BVMA 2C5CA 4HPDA 4FF1A 4KJNA 4KT5A 4RUUA 1SDFA 2DN8A 1NP1A 4NW2A 1AP0A 1Q1BA 5L8OA 2NZ1D 3HKZB 4ZHGA 4G4KA 5EPLA 2Q39A 4IFDH 1SYEA 5E4XA 2JA8B 4WHIA 1EIGA 2NVXB 1IW2A 3HOWB 1J9OA 1O7LA 1LPJA 1AB0A 3HOZB 4ORSA 3VYSA 5KYIA 4TQ2A 1S5FD 2BHVA 1JR0D 3J7AV 4AZNA 1I4UA 1WVLA 3VR2A 1XKIA 5EEDA 1LICA 5CV7A 1BJ7A 2NB0A 4DN4M 1VCIA 3FA8A 4ABNA 1KLUD 3KFGA 3ZQ3A 2JYOA 4V0BA 5HCCC 4IFDI 4FQBB 4HEDA 3NP1A 1SNDA 1ILPA 1QABE 2NYZD 3U9SA 5I2XA 3RZDB 1DV9A 2VB3X 1FNUA 5HGTA 4UU3A 4XMDA 3PIP3 1A18A 3C1EA 1BNZA 5HZ6A 3BDRA 3D97A 4KHVA 3KBGA 1TS4A 4OS3A 2KHSA 1S5BD 1F2MA 3NK9A 1XTCD 5M3FB 4FNFA 3MWYW 5HTDA 1Y8NB 2D5DA 2L9HA 4B9XA 3HWDA 3DWPA 5FK9C 3GE2A 4L6TB 1STAA 2WACA 3BX8A 1DONA 4FF3A 4ALBA 3A8KE 3J81E 2K01A 4QAEA 3S1RB 4OMWA 2GTFX 2A5HA 2SOBA 1WD1A 1ILQA 4A93B 5EBDA 5JR8A 3RZYA 3WVMA 3ZI8A 1F9PA 2YYZA 3PUYA 2E2IB 3IL8A 1WTRA 1BBPA 5KIDA 4DAPA 1I50B 4KC7A 3PQSA 1E2ZA 3WOVA 4DFAA 5HCEC 1E0BA 3CRLC 3B2KA 3URYA 3VPJE 3EFXD 5JJZA 1PMPA 1XCAA 2BLGA 1EIOA 5CBEE 5EKKA 1STYA 2IFBA 3UI2A 2RN4A 4O4OA 2XSTA 4DXFA 2NVYB 5C0XG 5C4JB 5BN5A 2RBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8P B;  3A7L A;  3SE0 A;  3T51 B;  3FPP A;  3PUZ A;  2JXM B;  4DNR B;  3T53 B;  3I4L A;  1YNJ C;  5BN4 A;  5JEA G;  1VF7 A;  1PMR A;  4IQZ A;  1BDO A;  2IT1 A;  4HR7 B;  1K8M A;  1E2V A;  3VR2 A;  1OXV A;  4G7H C;  1K8O A;  2JE6 I;  1GJX A;  1ZYR C;  4JBW A;  2V4D A;  1Q1E A;  2ZT9 C;  4XTC S;  3VA7 A;  4LJZ C;  4TKO B;  2A6E D;  3PUX A;  1TKW B;  1VCI A;  1OXS C;  1Q12 A;  2BE5 D;  3OPO A;  2E74 C;  3OW7 A;  1GUG A;  3VR4 A;  2AUK A;  2A69 C;  3M85 A;  2K7V A;  1CTM A;  3M4Y A;  1HTP A;  1H9R A;  1Y8O B;  2PCF B;  2BDO A;  4BA1 I;  3NE5 B;  3VR5 A;  1H9K A;  1OXU A;  3EQL C;  1G29 1;  4G7Z C;  1GUS A;  1LAB A;  1Z7T A;  1GUN A;  3M7N A;  3MFY A;  1DD2 A;  3VR3 A;  1H9S B;  2B8G A;  3IKJ A;  3U9S A;  1IW7 D;  4H0L C;  4KN4 C;  3FMC A;  1EWH A;  2EJM A;  3AB9 A;  2L5T A;  2LMC B;  2PNR C;  5K36 H;  2DNE A;  3PUV A;  1QJO A;  2AUJ D;  2KCC A;  4GZY C;  5BN5 A;  3ND8 A;  2A68 C;  1FYC A;  2BA0 A;  3LNN A;  3T56 B;  4DK1 A;  4H13 C;  1Y8N B;  2D5D A;  1DCZ A;  4BA2 I;  5K36 G;  3N6R A;  1I6V C;  2E76 C;  4IFD G;  3KLR A;  3ND9 A;  3CRK C;  1B9N A;  4KKU A;  3BG3 A;  1GUO A;  2R6G A;  2A6H D;  2QF7 A;  3LWU A;  1SMY C;  1H9J A;  3A8K E;  1OXX K;  1ONL A;  1TU2 B;  2F1M A;  4KN7 C;  4RCN A;  2DNC A;  3OOC A;  4KKS A;  4KHZ A;  2PPB C;  1GHJ A;  1DXM A;  4KKT A;  2Q8I B;  1OXT A;  1IYV A;  4TQU S;  4G7O C;  2A69 D;  5BN3 A;  2BE5 C;  1O78 A;  2AWO A;  2D2C C;  1HPC A;  2KA7 A;  3BDO A;  5KNC A;  1B9M A;  1E2W A;  2EJG C;  2A6E C;  5A35 A;  3I73 A;  4DK0 A;  2O5I C;  3L7Z C;  1GUT A;  2D62 A;  2JEB I;  1VDZ A;  3MXU A;  4L8J A;  1IYU A;  2YYZ A;  3QG1 A;  1T5E A;  2CW0 C;  1Y69 U;  2NN6 I;  3GQB A;  3PUY A;  2B8F A;  4JK1 C;  4H44 C;  3HGB A;  3P20 A;  2A68 D;  3A7A B;  4DNT B;  3PV0 A;  3QIA A;  1V8Q A;  1CFM A;  2DN8 A;  1E2Z A;  1Q90 A;  1GHK A;  1CI3 M;  1Q1B A;  2JEA I;  3CRL C;  4OO1 H;  2K32 A;  4XIG S;  1A6X A;  3D4R A;  3QJY A;  1H9S A;  3A8J E;  3GD7 A;  2EJF C;  5KND A;  4KMU C;  4KI0 A;  2O5J C;  1HQM C;  1ZKO A;  1LAC A;  1YNN C;  1IW7 C;  3DXJ C;  4OGQ C;  3RLF A;  2K33 A;  2A6H C;  3SDZ A;  3H94 A;  4IFD H;  2E75 C;  3I72 A;  5C0X H;  1Z6H A;  3W3A A;  1VF5 C;  4OO1 G;  3VR6 A;  1HCZ A;  4I7Z C;  3WDN A;  2EVB A;  3PUW A;  1V43 A;  1O7L A;  1FR3 A;  2BA1 A;  5KNB A;  3A8I E;  5JEA H;  3TZU A;  5C0X G;  4PV1 C;  2NN6 H;  3D31 A;  1H9M A;  4LK1 C;  3IFT A;  2NN6 G;  2EDG A; 
#chains in the Genus database with same CATH topology
 2ZTE A;  2YV5 A;  1TXY A;  2MUY A;  2OEO A;  2K50 A;  1HR0 W;  4R4C A;  2G9H D;  4X64 Q;  3IRB A;  3I17 A;  3PED A;  1VQ7 A;  1B50 A;  2UXD Q;  1JWM D;  1OXV A;  2XGT A;  5IO6 A;  1LTA D;  3NXW A;  2R61 A;  2OCE A;  1GM5 A;  5COR A;  4JI7 Q;  3NEL A;  1J6Q A;  3KJO A;  1EUJ A;  2V1C C;  1ICM A;  4Z2V A;  3U50 C;  2IHF A;  3UE0 A;  1QFT A;  3P75 A;  1SXT A;  1WUB A;  1VQF A;  4C1N K;  4OWW B;  1B56 A;  4MIR A;  4GU8 A;  1LTS D;  1F2L A;  1VWF B;  2CWA A;  4CGY B;  2WEX A;  2RTE B;  1MUP A;  1SMY D;  2FGS A;  5JD2 A;  2IW3 A;  3H3V C;  3PO3 G;  1VQD A;  1SA8 A;  3NPP A;  4NXN Q;  3S14 B;  1K3B A;  1EIF A;  4KY6 A;  4BY1 G;  1IW7 D;  2Y0S E;  4KN4 C;  1SLJ A;  3WOE A;  1CZW A;  1TS5 A;  3KLS A;  2R92 G;  1VWD B;  4R4I A;  3BS2 A;  2K52 A;  3M3Y H;  1OEK A;  1R9T H;  3Q0A A;  3LHN A;  1X32 A;  2N93 A;  1HY2 A;  1SBB B;  1WOC A;  3TP8 A;  2A68 C;  2RTK A;  4CJ1 B;  3MM0 A;  3CBS A;  1G6Z A;  4V19 0;  3E0J A;  3H15 A;  3T2X A;  3KF6 B;  1X55 A;  3PMF A;  3N6R A;  3ND9 A;  1SLG B;  3I0A A;  1JJJ A;  1TOU A;  2LY7 A;  4Z9C B;  4DV5 L;  3MG5 A;  2VB2 X;  3PGZ A;  3CU7 A;  5FLX E;  1FGB D;  5H8T A;  2GN5 A;  4DR1 L;  4GLX A;  5E4W C;  1DFV A;  5K68 A;  2Y0S G;  3KFU A;  3I90 A;  1W2B A;  1KQX A;  3RDO A;  1JJX A;  4IJL A;  3HWE A;  3K5L A;  5NUC A;  2NP1 A;  2NUC A;  1MKH A;  5CV8 A;  4HSV A;  3SR1 A;  2ZJQ A;  1D5X C;  1TWH B;  1K0R A;  1BVS A;  1FTP A;  4DQ3 A;  5IYC G;  2QCP X;  2FKJ A;  2Y3E A;  3FYF A;  3GTO H;  2B2Y C;  2KED A;  3APV A;  3SK8 A;  2AHO B;  1Z9F A;  2IZA A;  4HCE A;  4B3T Q;  3CR6 A;  2F01 A;  3J80 L;  2H5X A;  4KLK A;  3EJI A;  4FXG C;  4CKE A;  3FHW A;  1TOW A;  1LT5 D;  5LMN Q;  1QNU A;  1G5W A;  2K32 A;  1YHA A;  1SNP A;  4YKM A;  2RQX A;  3OJY C;  1VQH A;  2QGQ A;  2YG2 A;  4OEM A;  4JO6 A;  1ZKO A;  3NAD A;  4YBP A;  5A2Q L;  3S17 B;  1LLR D;  1GX9 A;  2FIN B;  1KL5 A;  4ZH9 A;  1PH1 A;  2RVL A;  4J8Q A;  5IP7 H;  4QGV A;  5TSS A;  5EKL A;  1E3P A;  3VR6 A;  2ZM6 Q;  5IGC A;  3ZW1 A;  3KF8 A;  1E06 A;  4A60 A;  2EU7 X;  3WJE A;  3U03 A;  4OL7 A;  3OIP A;  5LJG A;  4O3Z A;  3STN A;  3HOV G;  4HPA A;  2O2L D;  4PV1 C;  5J3B A;  1SJE D;  4OWT B;  1X8P A;  2G78 A;  2PI2 A;  1XNR L;  2Q2M A;  1MSG A;  5EPK A;  4WBK A;  1HUM A;  3T53 B;  4GJS A;  4ARH A;  4ES7 A;  1K0S A;  3FA9 A;  1PMR A;  2BH2 A;  5H9A A;  3WJB A;  1LID A;  2R93 B;  4A75 A;  2IX1 A;  1PTO H;  1AQB A;  1IZ6 A;  1LTG D;  1GX8 A;  5BVT A;  1GJX A;  3VG3 A;  1GUW A;  1VWC B;  3S2D H;  4JI3 L;  1GKA B;  4DV6 L;  3MEF A;  1BQQ T;  1Q12 A;  2WEW A;  2CH4 W;  4B3T L;  3VR4 A;  4Z27 A;  3PP6 A;  4YDA A;  1HTP A;  4DV7 Q;  2X46 A;  1V1O A;  1TWA B;  5JVG 3;  4JI8 L;  1SAP A;  4IRW A;  4LNQ A;  1ICF B;  2SDF A;  4K8I A;  2ZAI A;  1AEL A;  2TSS A;  1JWS D;  2IL8 A;  2HMB A;  1GUN A;  1C0A A;  3SZI A;  1YP7 A;  1RF2 D;  3I56 A;  5FKA C;  3HOY H;  4LF4 L;  4KD4 A;  1C48 A;  1W6J A;  2X32 A;  4N8F A;  2WQA E;  2B2U C;  3J81 j;  4QL5 A;  4AZQ A;  1EWH A;  1LCV A;  1R0U A;  1N4J A;  3CPW A;  5HZQ A;  2F4I A;  5FQ7 E;  2OVE A;  1SXX A;  4I65 A;  4LF9 L;  1IL2 A;  1W3S A;  3ND8 A;  1YNX A;  2CM9 A;  4TSS A;  1GT5 A;  5B5F A;  2RSN A;  4AH6 A;  5D4A A;  1L1O B;  1DCZ A;  2Z6K A;  1MX7 A;  2VQE Q;  2KUM A;  1PZJ D;  4DNE A;  1FNW A;  3DM3 A;  3KUP A;  1NY4 A;  3M9B A;  4KKU A;  3ZW0 B;  4P2C B;  4QZU A;  3BX7 A;  4IMO A;  3G6J B;  4ZUJ A;  1SFO B;  4KHZ A;  2PPB C;  2F0I A;  5LMN L;  1MEP A;  2DJG A;  3R2I A;  2F0Q A;  2OFA A;  1EY8 A;  4ME3 A;  3SZH A;  1N32 L;  3UEW A;  1X89 A;  4CPH A;  4FBV A;  1B1Z A;  1UEA B;  4NP5 A;  4X3S A;  1EPA A;  4GNX B;  2OTJ A;  1IKL A;  5FO7 B;  1B9M A;  3B6Y A;  4DUY Q;  1KD1 C;  3VHM A;  2AQ1 B;  4CDF C;  2B63 H;  3EMM A;  4C5P A;  5KHP A;  4I3B A;  2ENB A;  1TXL A;  1BSY A;  5HA1 A;  1JE5 A;  2LBV A;  2KQ3 A;  1TWF B;  1VWI B;  1WTW A;  2X69 A;  1ASY A;  4GUZ A;  4L5S A;  5C0X J;  4RH6 A;  3WJG A;  2D0P A;  1PTO F;  4JI0 Q;  3ZZV A;  1XMO L;  3CC7 A;  4NW4 A;  2XNA C;  4XIG S;  4LFC L;  1Y0G A;  3K5N A;  2XRQ D;  3QJY A;  3NBX X;  2O5J C;  2A5B A;  2K5W A;  1TQO A;  3TRE A;  4C56 C;  1HBP A;  2FT9 A;  3DEP A;  2FTB A;  1GXA A;  2K33 A;  2L1B A;  3WYP A;  3GTQ B;  4KH8 A;  5M9O A;  5C0X H;  3PIO A;  3J7Y W;  2AT0 X;  5J1Z A;  5C3E H;  3WDN A;  1EL0 A;  2K62 A;  5EPQ A;  2CH4 A;  1WFQ A;  3T1D A;  4JNJ A;  5EGT A;  4CPI A;  2H4O A;  4NV7 A;  2HCC A;  1DZJ A;  2NN6 G;  3MAQ A;  1CQV A;  1KAA A;  1RL2 A;  3QOL A;  4YGZ A;  4AIM A;  3RN2 A;  3SOT A;  1YNJ C;  1S7D A;  4R1J A;  1PRT D;  4UHV A;  5FLX c;  1U0X A;  2NND A;  4L5Q A;  4LF6 Q;  5B11 O;  4JV5 Q;  1X3Q A;  1JYJ A;  4CDF A;  4XTC S;  3RE5 A;  3VA7 A;  1BCP C;  4A3M B;  4LF8 Q;  3K5O A;  3O19 A;  3T2W A;  3V2T A;  4JI6 Q;  4XDX A;  3D4D A;  5C6A A;  3A0J A;  1EWI A;  5C4X G;  1JB3 A;  4Z6J A;  2QDL A;  2EYJ A;  1PH4 A;  2AUK A;  5HBS A;  3TF6 A;  3E3C A;  2CFM A;  3QWN A;  1LTR D;  2F3I A;  1UUP A;  2HDL A;  1B70 B;  4U67 3;  1YVC A;  2F0V A;  2JU8 A;  3LV4 A;  3DUZ A;  5ISR A;  4GKK L;  2KT4 B;  1Y1W B;  1IFC A;  3SLO A;  5M5W H;  2NVQ B;  2ZJP A;  2KTD A;  2RHQ B;  4LZV A;  1U4L A;  2EE1 A;  4RMF A;  4X62 L;  5LJB A;  4YY3 L;  2N88 A;  5ELF A;  4NXM Q;  3FKI G;  4GLV B;  2NVT H;  2VZA A;  3NTK A;  4KHP L;  5C4H A;  2ZXO A;  5C44 B;  1F9R A;  1I6H B;  4NKL A;  4P74 A;  2EYF A;  1DZ1 A;  4ZHF A;  3V05 A;  4HIM A;  2B2V C;  2BA0 A;  5C44 H;  5D45 A;  3P24 A;  3BLG A;  2Q4N A;  3L2P A;  2X55 A;  2M2L A;  1UZ2 X;  3KLR A;  2JA5 H;  1TVX A;  3HOZ G;  2IHE A;  4UPA A;  4ZR2 A;  3HOX H;  4IJH A;  3MC0 B;  1URE A;  1W5R A;  4KN7 C;  4OKA A;  1KZX A;  1I50 H;  1XMO Q;  3CP0 A;  5D48 A;  2HIV A;  1ACD A;  4LFC Q;  5EAY A;  4GH7 A;  1PFM A;  1SWJ A;  3ULL A;  2X34 A;  3EW1 A;  2EYL A;  2KA7 A;  4IZ8 A;  2O5I C;  2VQE L;  3B2H A;  5JPN C;  4L8J A;  2JMB A;  3ELX A;  2WAQ G;  4BCS A;  3QG1 A;  1NNX A;  4Y59 A;  4ZHH A;  3NBH B;  2GTL M;  1ICW A;  1G74 A;  4POG A;  1QY2 A;  3A7A B;  4GDZ A;  2R93 G;  5H1S E;  4MVI A;  5F6Z A;  1YHQ A;  1HQR D;  1N32 Q;  5AFW A;  1QUQ A;  1SWA A;  3STM X;  3SZJ A;  4IAB A;  3G6E A;  4CK4 A;  2EJF C;  5KND A;  4BS9 A;  1SLD B;  1PH8 A;  3EBK A;  3HOV B;  2PMZ B;  3V8U A;  3EIV A;  4JBJ A;  4M6S A;  2IZK A;  1P16 A;  5JAV A;  3VDY A;  4J1M A;  2RTF B;  1II3 A;  3A8I E;  3BVZ A;  2UU9 Q;  4L63 B;  3S17 H;  1W6F A;  1H9M A;  3J80 i;  2X8F A;  3BU9 A;  1U0L A;  3CQZ B;  2QOM A;  4X64 L;  4YFQ A;  4YFR A;  2I5M X;  3HOW G;  1NQM A;  3JS1 A;  5D3I B;  2FXQ A;  4S3S A;  5ELB A;  3BZC A;  3C1F A;  1SRH A;  1KLG D;  1B2T A;  5AJC A;  2C35 B;  4GOP C;  3NUC A;  3BU1 A;  2KEC A;  1BXT A;  2KD2 A;  1KC8 C;  3SLT A;  5C3E G;  3I4N G;  1XJV A;  4TKH A;  1G51 A;  4AQY L;  1SYG A;  2ZT9 C;  2QO6 A;  4TJZ A;  5F2D A;  4HAE A;  3U4V A;  1SWL A;  1WCM G;  3RMH A;  3D0F A;  2JJQ A;  4K2K A;  1A3T A;  4O42 A;  1J5E Q;  5IT9 E;  3S16 B;  2L0C A;  4C2M B;  4O2D A;  5M5Y B;  1DF8 A;  1LFO A;  2PCF B;  3NE5 B;  1CKM A;  2WP8 J;  1EYA A;  4GOP B;  2M4L A;  4HPB A;  1FEL A;  2RTP B;  5JPM C;  3MA2 B;  4PQX A;  2HQE A;  3PIP A;  2Q2U A;  1TY0 A;  3MFY A;  5IO5 A;  4O4S A;  2WB1 B;  2DY8 A;  2B8G A;  4YWL A;  2JA6 H;  1B0O A;  1PH9 A;  4P72 A;  2EYP A;  4JI3 Q;  4B3R L;  1X8U A;  1ESF A;  2A73 B;  4XQJ A;  2E8G A;  4UP7 A;  2BT9 A;  3W1G A;  3LTW A;  4B3M L;  3S24 A;  2EYM A;  3NSW A;  2XKL A;  1E7Z A;  2J7Z A;  1JJ2 A;  1V9P A;  4H13 C;  4WJ4 A;  5H9N A;  2K03 A;  1LCW A;  2B2T C;  4IB6 A;  2I07 B;  3UAQ A;  1IKJ A;  4GDA A;  1RDP D;  2PZW A;  4BBO A;  1JZU A;  4WFN 3;  2VFC A;  2H1E A;  1X9N A;  3S1Q B;  1JMX A;  5CE4 A;  1C8C A;  2E2H B;  1N34 L;  1XX8 A;  2L12 A;  1FJG L;  1HUN A;  2P5Z X;  2F0E A;  2MJI A;  3FW4 A;  1IYV A;  1SWE A;  2HLV A;  1SYC A;  3NR3 A;  1EXS A;  1JJC B;  1N34 Q;  1FJG Q;  1KOI A;  4GKC A;  4TRD A;  3MHB A;  4F87 A;  4NMZ A;  5KIX A;  4OON A;  5C4Z A;  5D8J A;  3G7L A;  4OMX A;  3VGW A;  4AZM A;  1IBK L;  1S2P A;  1SWH A;  1YWC A;  2RTL A;  4ORR A;  1NE3 A;  3JAM i;  1EWC A;  1VDZ A;  5ELE A;  3U9O A;  2L4N A;  5J39 A;  2Y3F A;  2KEE A;  1VWH B;  3RNU A;  1UE5 A;  2EY1 A;  4ODG A;  5C0X I;  4EQO A;  1BBX C;  3P7J A;  4LFA Q;  1SRE A;  2AMM X;  1TT2 A;  2OL6 O;  1EFI D;  3U58 A;  2WII B;  2JSO A;  4ZJ0 A;  4FO2 A;  1FL0 A;  2KHJ A;  4M7M A;  3D6C A;  4O3X B;  3I91 A;  3VG6 A;  1LAC A;  3K7A H;  3SDZ A;  4DUY L;  5C4X B;  1JOO A;  1X8O A;  1EEF D;  1IJ8 A;  2E75 C;  5B27 A;  3NQI A;  3OYY A;  1C7Y A;  3RUZ A;  2K1B A;  2BS5 A;  3KFF A;  4JYA Q;  1B4O A;  2RF4 A;  4FP5 D;  1HCZ A;  4KCA A;  1WYD A;  1HR0 Q;  4MVL A;  2BC3 A;  5FQ8 E;  1ET6 A;  4PJ2 A;  4OXP A;  3L4R A;  3TEH B;  1A63 A;  2JXM B;  3PSI A;  2RTB B;  3EN2 A;  3FEL A;  4FVM A;  3O22 A;  2I5H A;  4BY1 B;  1HMR A;  3CCM A;  4YMY A;  1YZ6 A;  2RTD B;  2UZ2 A;  2FS6 A;  2XN9 C;  4N7C A;  4YH0 A;  1ML0 D;  4IUT A;  2MGS A;  3C3L A;  4UP9 A;  4A3E H;  1KDA A;  1LM0 A;  3TP6 A;  4LJZ C;  3TZS A;  4HJ7 A;  4ORY A;  3AUM O;  2E74 C;  3NBI A;  1VQJ A;  1GOZ A;  1EI5 A;  1EZ8 A;  4YKO A;  2Q2T A;  4Z2O A;  1ROD A;  2WKD A;  2RSO A;  1YWD A;  1TR5 A;  2BDO A;  4BA1 I;  1QVG A;  1EU3 A;  4EQP A;  1GM6 A;  5D47 A;  1AE3 A;  2F3V A;  4RG1 A;  1M8A A;  2G79 A;  4CSB A;  1NP4 A;  5GRO A;  1YIT A;  4X3T A;  1X65 A;  4ODD A;  4C3J G;  1Q46 A;  2F0W A;  3M7N A;  3IA8 A;  2LKV A;  4NDX A;  2LFN A;  3X3M A;  3QKG A;  3UEU A;  2Y0S B;  1YHB A;  3WJD A;  2F0J A;  4P75 A;  4A3G G;  1SRF A;  2Z6K C;  3GTP H;  5DM6 3;  2IZC B;  4QGX A;  3WXQ A;  1IYJ B;  1SE2 A;  3NTH A;  3S5V A;  4EEJ A;  3HOL A;  5IP9 H;  4OS8 A;  4R0B A;  3E3X A;  5C3E B;  2HHH L;  4YDB A;  1QCB D;  1XPR A;  2WAQ E;  4YIJ A;  4YWK A;  1VWQ B;  1JBH A;  2E2J H;  2AT5 X;  4XYQ A;  1VS0 A;  2AKQ A;  4IFD G;  3AMU A;  4OIJ A;  1B9N A;  1V1P A;  1U4P A;  3AFQ A;  2R6G A;  3RBY A;  3CKG A;  3OTO Q;  5CV6 A;  3FEN A;  5E3F A;  3CBC A;  3E9I A;  3FID A;  1Q8I A;  2RCQ A;  1DXM A;  3BU2 A;  1UE6 A;  3CMP A;  2FMM A;  3Q34 A;  1I6H H;  2BH8 A;  3SHL A;  1STG A;  1HZB A;  2OXP A;  3H0G H;  5IYB G;  1MJE A;  1RAV A;  1KXO A;  1E2W A;  3H91 A;  5H9L A;  3CCQ A;  1HHV A;  1FE3 A;  1X3G A;  1V1P B;  3MXU A;  3O2Y A;  5C3X A;  4ZK9 B;  1T9H A;  5C3W A;  5KYL A;  1JIW I;  3NQ3 A;  4FBR A;  1CA5 A;  4QJF A;  4DAM A;  2I0Q A;  1KTK A;  1VQP A;  1IBM L;  4OS0 A;  2HYS A;  4Y5D A;  5FLX L;  4L1N A;  2JEA I;  4OO1 H;  4R8N A;  5ELC A;  3T1Y L;  1YUP A;  3GD7 A;  4KD3 A;  4ZLT F;  1G2T A;  4C3H B;  3P6C A;  1IW7 C;  3CW2 C;  1MHW C;  3BYT B;  2B2Y A;  3H3I A;  1Z6H A;  1HXY D;  2KHI A;  4ORW A;  2OFR X;  2BS6 A;  1Y53 X;  1LTT D;  3ELZ A;  2CWP A;  4A3B G;  2OWO A;  3Q23 A;  1QZG A;  4QRL A;  1EQV A;  3F8T A;  1D3S A;  1E00 A;  2NBF A;  2NVT B;  4DV6 Q;  2I5V O;  3TZU A;  3S60 A;  3ZWE A;  5C4X H;  4AYH A;  2NN6 H;  2HIX A;  2K04 A;  3KK7 A;  4BBR H;  4XQN A;  1TWC H;  4A3C G;  3T51 B;  4ALP A;  1KXL A;  1KGL A;  4U3Q A;  5BVS A;  4P71 A;  1PH6 A;  3I4L A;  3AEH A;  2GJ5 A;  4UP8 A;  3EA6 A;  1SWQ A;  1LTL A;  4I9R A;  2B2W C;  1PTO C;  4LF8 L;  5M3F H;  5F6B A;  2ZM6 L;  2V4D A;  1S5C D;  1E1O A;  5HY6 A;  3J80 c;  4A3C H;  4A3E G;  1DZP A;  1MVG A;  3KYH C;  4JC0 A;  1CKN B;  1B3A A;  4WJW A;  3HP3 A;  4DR4 Q;  2WPU A;  1DF3 A;  1C4Q A;  2A74 C;  4DR2 L;  5LKE A;  1Y55 X;  1X8Q A;  4JI5 Q;  3BJU A;  3HOY G;  3I70 A;  1F9S A;  1SY1 A;  4HN7 A;  1CJ5 A;  4N9P A;  4NYR A;  2FWV A;  5LJC A;  4BXX G;  2RDF A;  1K8A C;  1B8A A;  3GTG B;  4KJO A;  1IHZ A;  5M5Y H;  2AH7 X;  4C1N I;  2F09 A;  1L0W A;  1JMC A;  1JOR A;  1ZNL A;  1ZND A;  4ZKB B;  4U8U O;  4NXN L;  5DG4 A;  1LT6 D;  1RD9 D;  1U9R A;  5FOB B;  5CV5 A;  1EEI D;  4AZP A;  4GN3 B;  5K06 A;  4YHH L;  2DNE A;  4GD9 A;  3FW5 A;  2KCC A;  1LIF A;  2AF5 A;  1SRG A;  3AFP A;  2EXD A;  1TS2 A;  4EDE A;  1Y1V G;  5CYB A;  1SWP A;  1MD2 D;  1ML7 A;  1I6V C;  5LMN W;  1NAP A;  1O8V A;  2ZTD A;  3GTL H;  1VWE B;  4QQ1 A;  4FXK C;  2Z1C A;  3I4O A;  3W1B A;  4AZO A;  2A6H D;  3LWU A;  4Q5V A;  1SMY C;  1IL8 A;  1H9J A;  3NP8 A;  4PMB A;  2EY5 A;  4RAU C;  1STR B;  2DM5 A;  4O3Y A;  1GVP A;  1LEL A;  4WRD A;  4DR2 Q;  4GN5 A;  2GVA A;  4QGW A;  4JI5 L;  3F2U A;  4G7O C;  1EYD A;  1MBY A;  2B2V A;  3BDO A;  1HPC A;  2EJG C;  4XMC A;  3K7A B;  1XPU A;  3K8A A;  4DK0 A;  3F2C A;  2ASN X;  2OF1 A;  1BO0 A;  3BVG A;  5G3L F;  4DR6 L;  2PY1 A;  3MX7 A;  1EZ6 A;  4BY7 H;  4QIW B;  1Y69 U;  3CXC A;  1SRJ A;  3SK4 A;  2WAQ B;  2IZE B;  3QIA A;  4DV7 L;  4UU2 A;  3EC5 A;  1E24 A;  2F0G A;  1VQG A;  2PI2 E;  4EGV A;  4GGT A;  2ALL X;  1HBQ A;  3A5U A;  4K5X A;  4LF7 L;  3TGC A;  5ELN A;  4BWG B;  4IOC A;  1CBQ A;  2GVB A;  2MQH A;  5GAH C;  2JOZ A;  3I72 A;  2QO5 A;  4ZQ3 A;  4U8U N;  2RA4 A;  4ZFX A;  5DEH A;  2KCT A;  1VQM A;  4MHE A;  5FEN A;  3PUW A;  1CM9 A;  4GOP A;  1N9W A;  3ULP A;  1IBL Q;  3FRP B;  1N0S A;  1JOK A;  4IAW A;  4IB7 A;  3C2P A;  1XTD A;  4O3W A;  4NLJ A;  3SE0 A;  3UDI A;  4U8U M;  1A0I A;  3VYU A;  4HTH A;  2IWH A;  2E5L L;  4BBR B;  5BN4 A;  3JC6 6;  3K58 A;  1NR2 A;  1VF7 A;  5BR8 Q;  1D7Q A;  2AT8 X;  4JBK A;  3MXN B;  3WOF A;  3SXH A;  3F6Z B;  2OY5 O;  3RDX A;  3H3V H;  1HH2 P;  4IAL A;  4G7H C;  3FKI B;  4NP1 A;  4EQN A;  4AZR A;  3IAY A;  2GC9 A;  1I94 L;  1I78 A;  3SVM A;  3NWS A;  4DR6 Q;  3TQY A;  4RKL A;  4DU9 A;  1TKW B;  1N7Y A;  2BE5 D;  3OPO A;  2FS7 A;  3RD4 A;  4RHR A;  1IXR A;  1EY5 A;  2FFK B;  1Y1W G;  1CHQ D;  1CTM A;  3VU1 A;  4LFB Q;  1DYQ A;  1HMT A;  1GX3 A;  3S2H B;  4DAY A;  1I9H A;  4TVA B;  4LKP A;  1RLB E;  4F8M A;  4A1Y A;  3SGI A;  2JA7 H;  2NNE A;  4X65 L;  4LF5 Q;  3CCR A;  1PH2 A;  1IIU A;  4X3U A;  3AEV A;  4OIK A;  3PO2 G;  1DD2 A;  3MVV A;  2HNX A;  3P6G A;  4ML7 B;  1TWG B;  5HUR A;  4GNX C;  3FP9 A;  1B8E A;  3BRN A;  1PRT F;  2RCF A;  1NC9 A;  3ZW2 A;  4FDB A;  3TME A;  1JJG A;  4QZT A;  2QDB A;  4A3D G;  1SEB D;  2ACP X;  4HPC A;  4LZU A;  4A3M H;  2A2G A;  1PVO A;  1BUV T;  3RKG A;  2MFI A;  2JQO A;  3PUV A;  4KII A;  4CHT B;  1N43 A;  1AEX A;  4FF2 A;  1Y14 B;  4WOR A;  3J7A 5;  3WBG A;  2CZU A;  4AYB E;  4IN3 A;  4LF9 Q;  4BX5 B;  3MTS A;  1SJH D;  3CCE A;  2RTO B;  2WR6 A;  1JE4 A;  3CAM A;  2F0L A;  1CQF A;  2LS0 1;  2PZT A;  4AQY Q;  4Y52 H;  1Y1W H;  1MX8 A;  3K0Y A;  4IUV A;  3PO3 B;  1PZK D;  3R3O A;  4Z28 A;  1LCZ A;  3KBX A;  1ASZ A;  1I4H A;  3PK2 A;  3X00 A;  1ZXT A;  4TQU S;  5E1F A;  2B3G A;  4HJ5 A;  3KFH A;  2RCN A;  1O78 A;  3GTO B;  4BQU A;  4A3J B;  4CKB A;  3NQT A;  3PQU A;  1VQL A;  2RTM A;  3E6Z X;  2JEB I;  4IPD A;  3KOJ A;  2QCB A;  3TP7 A;  1VMC A;  1JWU D;  2F0U A;  3VHH A;  1VQK A;  1E02 A;  1BOS A;  3FKI H;  3NPO A;  4BX5 A;  1SRU A;  3HEJ A;  4ILW A;  2ID0 A;  4DA2 A;  2W2A A;  4DV0 L;  3PV0 A;  2LSS A;  1CSQ A;  1V8Q A;  1NMG A;  5LL6 X;  1DC9 A;  1ZNK A;  2HZR A;  3AQQ A;  1YJ9 A;  2JA6 G;  3I4M G;  2PZU A;  3G48 A;  4H7B A;  2ES2 A;  2O62 A;  3ERO A;  1EIH A;  2RTG B;  3R2T A;  4KI0 A;  1W6K A;  5DAU A;  4DK6 C;  4IUN