3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Unknown function
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
1Z6HA 2DNCA 3FMCA 3M85A 3A8KE 1TKWB 3CRKC 3MXUA 4JBWA 4BA1I 1Q12A 1YNJC 4IQZA 1HTPA 2E75C 1OXXK 4KHZA 4DK0A 1E2ZA 2EJFC 4LJZC 2AUJD 1GUNA 1O78A 3QIAA 2NN6H 1OXTA 3CRLC 1H9SA 3L7ZC 2E74C 1OXVA 1DXMA 1OXUA 2Q8IB 2F1MA 1CTMA 2KA7A 3VR2A 3NE5B 4H13C 1T5EA 3VR6A 1Y69U 1E2WA 1H9JA 5BN5A 5K36H 2AUKA 5JEAG 5C0XH 2BA1A 3I73A 3VR4A 3N6RA 1HQMC 1GUGA 1Z7TA 4DNTB 1FR3A 1LACA 2PCFB 2L5TA 4G7OC 5KNBA 3ND8A 3OOCA 3TZUA 4L8JA 5BN3A 1IYUA 3BG3A 2JE6I 3A8JE 5C0XG 1Y8OB 2JXMB 4G7HC 2CW0C 4LK1C 5A35A 1VCIA 2K33A 2O5IC 4BA2I 1IYVA 1O7LA 2DN8A 3EQLC 3SDZA 3I72A 3LWUA 3PV0A 3MFYA 4KKTA 2BA0A 3RLFA 1GUTA 1B9NA 1HPCA 3GD7A 1ZKOA 3OW7A 1DCZA 1G291 1PMRA 2B8FA 2EVBA 1Y8NB 3M4YA 4KI0A 2A68D 2A6EC 2EJMA 3D31A 4OGQC 3VR5A 3A7AB 3LNNA 5JEAH 2JEAI 4KN7C 3PUXA 4H0LC 2O5JC 4OO1H 3T53B 3I4LA 4I7ZC 1DD2A 4TKOB 1VF5C 4KMUC 3P20A 5KNDA 1K8OA 2JEBI 1OXSC 2R6GA 4PV1C 1A6XA 1H9SB 1EWHA 2D62A 1YNNC 4TQUS 1V43A 5BN4A 3VA7A 3WDNA 3KLRA 1Y8PB 3IKJA 1Q90A 1QJOA 1SMYC 2BE5D 2NN6G 3AB9A 4HR7B 1V8QA 3M7NA 1IW7C 2D2CC 1Q1BA 2A68C 1Q1EA 3H94A 3ND9A 4DNRB 1LABA 3PUVA 2B8GA 1BDOA 1VF7A 3DXJC 4DK1A 4OO1G 3QG1A 1K8MA 3PUWA 4JK1C 2A69D 2A6HD 4RCNA 5KNCA 4KKUA 4KKSA 1HCZA 2PNRC 4KN4C 1GHKA 4XTCS 2QF7A 2A6ED 5K36G 2D5DA 1GUOA 1CI3M 3T51B 4G7ZC 1GHJA 2K32A 3A8IE 3OPOA 2PPBC 2EDGA 3HGBA 1FYCA 2BDOA 2IT1A 1GUSA 3PUZA 3FPPA 3SE0A 4IFDG 3U9SA 2AWOA 1TU2B 2LMCB 4XIGS 2BE5C 1E2VA 1VDZA 1ZYRC 2DNEA 1IW7D 2A69C 2A6HC 3QJYA 3T56B 2E76C 3D4RA 3BDOA 1I6VC 2YYZA 3A7LA 1H9RA 3IFTA 2K7VA 1CFMA 1GJXA 3GQBA 3PUYA 4H44C 2EJGC 1H9MA 4IFDH 1B9MA 2KCCA 3VR3A 2NN6I 1H9KA 2ZT9C 2V4DA 3W3AA 4GZYC 1ONLA
chains in the Genus database with same CATH superfamily
4A3CH 1EZ8A 1EIYB 4LF6Q 4X65Q 3PO3B 3Q34A 2GVAA 4ORYA 4JI5Q 4IMNA 4BA1I 2ZXOA 1Y53X 1EQVA 2QO4A 4UU2A 1WJJA 1VQCA 2ZTEA 1D1KA 1RHPA 2HKDA 3HOWH 2O2LD 4B9WA 2JA5H 1G5WA 3W2DA 4DV4L 1DFVA 3SLTA 3P6FA 4H02A 1ASZA 2E5LQ 3I4NH 2XGTA 4TRDA 3URYA 4ZK9B 1DXMA 4Z28A 2CFMA 3HOVG 5M5WB 1WUBA 4AZPA 1X89A 2QCPX 3P6HA 1UE5A 1N32Q 1EIGA 2OEOA 1GT4A 4NW2A 4A3JH 5HZQA 2UXCL 1A3YA 2OWOA 1SWPA 1A18A 3BVMA 5FLMH 5IRWA 3BZCA 3KF8A 5KNBA 3S16H 1T8VA 1BBWA 4POGA 1HNWL 2FKJA 1QZGA 1LT3D 3VHHA 4B08A 4QIWB 2UUCL 4DV3L 3PQUA 1BM5A 3P24A 1IYVA 3SZIA 1S2PA 1LTBD 4O3ZA 3MFYA 3OWFA 4BY7G 1JJCB 3QB3A 3CC2A 3VG7A 2B8FA 1JV4A 1I05A 4PJ2A 1NQMA 4UAIA 1WBIA 1CA5A 2AQ2B 3CP0A 1PXUA 4ILWA 5D3IB 1EZ6A 2QEXA 3V05A 3SK4A 3RZOB 5AQ6A 1I4GA 2KVMA 2A2GA 3S2HB 3CBSA 3ZW1A 1FJGQ 3KYHC 1MK5A 1X71A 1YJNA 3CCVA 2BSZA 2OXPA 4Y7NH 3IFBA 4P73A 5LJHA 1Q1BA 3AFPA 2EQSA 4HPAA 1LABA 2D0PA 5L37A 4A3BH 1N0SA 3WJGA 2XKLA 3GTOH 1XTDA 2A5HA 2AT8X 5DAUA 3I4MG 2UXCQ 4CDFC 4AZQA 3HOUH 5HURA 4R9WA 3B2HA 4B3MQ 2JA6H 3J7AV 1S5DD 4NXNQ 4CPHA 1CKMA 3R8BA 2SEBD 4BY7H 4G7ZC 1C8CA 1JOOA 3A8IE 4YCUA 1YIVA 2UUCQ 2VQFL 1FNUA 5I9PA 5IP9H 5IYBG 3PMFA 1EUOA 1SWFA 3APXA 3KBGA 1EY0A 4HPCA 1G85A 3V8UA 4B55A 5BVTA 1E00A 2F52A 1VWFB 1STBA 1STNA 4RGMA 2XRQD 2MGSA 3BS1A 1ZNEA 1LF7A 1M4VA 1K0SA 4L3RA 1CBIA 1GX9A 1RSTB 1SNCA 4B3RQ 5CYUA 3MXGA 2F4VL 1PYWD 4X3KA 5M3FH 1MEPA 3F6ZB 4CKCA 3QR8A 3W3AA 1TWAB 3TREA 3TRZA 4HSPA 2WB1E 4A3BB 2OVAA 5JVG3 4A3EH 3FMCA 3RZDH 1I94L 2P5ZX 1IHZA 4EQ5A 3GTOB 2ZAGA 1SE3A 5EPQA 3D95A 2YTYA 2YTVA 4ORSA 4LZUA 4KHZA 4CJ0B 3FYFA 1VQAA 4J1MA 1PRTB 1IW2A 1SWLA 2QGQA 4DUYQ 4B3TL 1SY3A 4OS0A 1NAPA 1OXUA 1CTMA 1K28A 2KA7A 3DMUA 5IYBH 4FF2A 3VR2A 1STYA 4A75A 1HMTA 1GXDC 1EIOA 1NR4A 2VFCA 2OQ0A 2HYSA 3MHBA 4HIOA 1AW7A 2OVDA 4U8UN 5M5XB 4IFDJ 2F3WA 2FHLA 1VQEA 1JBHA 5CMDA 2F0LA 1RODA 4DR3Q 4LW1A 1CHQD 1AELA 4DV0Q 4JI6Q 3EYCA 5CBEE 1V1QA 3PIOA 4L8JA 4UHVA 2HD3A 4GJSA 1RD9D 3H91A 2OFBA 1VQ7A 3RE6A 1ESFA 3CQRA 1JJ2A 2JE6I 1Y9LA 4KT5A 1V1PA 2RTHB 4LK1C 3HWDA 3NELA 3NBHA 3EQLC 3SDZA 5KIXA 4O2DA 1ICNA 3RLFA 1R0UA 3GTJB 3F9DA 4JO6A 1G291 4QY7A 5LJBA 4O4SA 1TS3A 4DV2Q 2NVYB 4KJOA 1ADLA 4DR1Q 4KN7C 1PH9A 3TN2A 2B2VA 2VXWA 1QWDA 2MHVA 2NWGA 4X6AH 5CBAE 3S14B 3KF8B 4PV1C 3X3NA 3Q23A 4YGHA 4HJ7A 4A8ZA 1EY4A 1PFSA 4IUVA 4HPDA 4HEDA 1LNMA 2FRSA 3VA7A 4KHVA 4A93H 3OTOL 2DJGC 4DKAC 2GJ5A 2MO1A 4YVBA 3VG4A 2NN6G 1I50B 4WFVA 1NP1A 3WWVA 1B7YB 1IKJA 1I4XA 4DR1L 1WD0A 2VUMH 2VUMG 5ELEA 1JJXA 4YY3Q 2QO6A 1BWYA 3KJPA 3PDFA 1L1OA 1K8AC 1JZUA 3CCQA 4EQPA 2K6AA 4JI6L 2N78A 2RTFB 4NDXA 4DXGA 3TS2A 3GTJH 1Y0GA 3GTGH 4YCHA 4LUOA 3LX0A 1KRTA 1TXLA 4HWMA 2BDOA 1NTGA 2OFRX 2K01A 5E4XA 2Z6BA 1TXYA 4JPBW 1Y1VH 3A0JA 2BS6A 2AWOA 1JWSD 4GH7A 4ZFXA 1XTCD 3VHMA 3CPFA 2K5WA 5CV9A 1XWEA 1PFBA 2MO0A 3IFTA 1F9RA 1B4OA 5IP7H 3GQBA 2CQAA 1VWAB 4IB8A 1L1OB 4IABA 5C4ZA 1MDCA 3CPWA 4U8UO 5CV5A 4KD3A 2RD7C 3FIQA 1X8QA 1SYEA 4BBSG 4ZR2A 2OF1A 3MAQA 3I17A 2X8TA 4DR6L 1HA6A 1K83H 4IB6A 1YNJC 3NPPA 3RY1A 3HWEA 3GTMB 1JYDA 4DV7L 3EC5A 2Q2IA 3LHNA 1XPUA 4LJZC 4ZYSA 1QE6A 2ZJQA 1KT6A 4ZH6A 1VWEB 2NYZD 4FXKC 3STBD 2LSSA 3EFXD 4DR4Q 4F88A 3RKGA 1LO5D 2Z6KC 3OMGA 1L1OC 1EWIA 4BBOA 2EYFA 2RSNA 1PBYA 5D3DA 4U9CA 3VR6A 4DF7A 5GAEC 1QCBD 5K36H 2Y0SE 2Y3FA 3VR4A 5F2DA 3MX7A 3PECA 2WAQB 2OT2A 3CBCA 2OFMX 3OHXC 4JI3L 3TP5A 2MFIA 4HJAA 1YJWA 4CJ2C 1N33L 1SJHD 2R7ZG 2K33A 3K81C 2M9VA 1VQNA 3D4WA 5IO7A 1HNZQ 1EY5A 3SZHA 3A56A 3O19A 1X3QA 1FGUA 4KI0A 3P6DA 1TWCB 3ELXA 1GUWA 2VQFQ 2B2TA 4DAYB 4K6LA 2LBAA 3VYRA 3F8AA 1E1OA 1VWMB 4A3FB 1OXSC 2X8SA 3TGAA 2OZQA 1MJCA 1B2TA 3GDEA 1W5RA 4ZHGA 1SWJA 2MPMA 3JAMc 2H4OA 1PH6A 5FLXE 5ELFA 5C4JH 3M7NA 3GE2A 4CPIA 1BXTA 2XSCA 1BRQA 1SSOA 1HFGA 4DK1A 1LELA 3RWXA 4BCSA 4ID2A 5FENA 2KTDA 3M7GA 2K75A 3BX8A 2Y0SB 1E02A 3H0GG 3HG9A 1SYCA 4A60A 1TS2A 5KGUA 2OY1O 2NNEA 1N34L 4IBAA 5FJ8H 4CPHB 2IX0A 4ZRZA 1RIPA 4JI1L 4YBUA 2FINB 3T2XA 2CHBD 3C76X 3HGBA 2DJFA 3D0FA 1LYLA 5FQ8E 3HKZB 3PUZA 2I07B 4OONA 1S72A 4MNOA 2KCTA 3BU9A 4Q0FA 4MIUA 4YGZA 2A1AA 3HEJA 4C1NI 4GN4B 1JWMD 1QFVA 3J80i 3C77X 1IW7D 3T56B 2A8VA 2ASNX 1OPBA 1X3GA 3CW2C 4EX5A 3CCJA 2PI3O 2EJGC 3ZW1B 4KCAA 4JNJA 4IALA 4NMZA 3DM3A 1GT3A 4GNXB 4RGOS 3UDGA 4ID6A 3UE0A 2RKSA 1OEJA 3A55A 2E2JB 3MC0B 1B1ZA 3PIP3 4X64L 1SRHA 4GOPC 5FLMG 5B5FA 1KDCA 2WKCA 5IO5A 2AQ1B 1PLFA 5M5YB 2B29A 4LF8L 1E2ZA 2EJFC 3FA7A 3S15B 1XMOQ 4ZGFA 3NXWA 4IAWA 5BYPA 3BU1A 3T2WA 3VHIA 3F8TA 2F73A 3L0OA 2F1MA 1W6JA 1HUNA 4IOCA 5K06A 1TQOA 1K9MC 1XNQQ 4ULLA 2ENBA 2Z9HA 2GN5A 4LFAQ 5JJIA 4AZOA 3GTKH 4YMYA 1SNMA 4X3SA 4JI8L 1N9WA 1NCVA 2X69A 1STEA 3I73A 1X9NA 1VWQB 4O4XA 4RH6A 1SWKA 1O1UA 1X8UA 2C1QA 5IE8A 3TBIB 3HKZG 1CM9A 1HR0L 3UEUA 1EALA 1X65A 3Q6SA 1ZNLA 5J39A 3GTPB 2G78A 1A62A 2ZXPA 4JI5L 2E2JH 1LFOA 1XCAA 2UZ2A 5GAGC 4LMQD 3STMX 4JC0A 3MXPA 4DV2L 3NQIA 3P7JA 1WVLA 4BVMA 3ZW0B 3HOUG 1LCVA 3NQ3A 3PEDA 2LKVA 2AF5A 3PH5A 4Z2PA 1UEAB 3SVMA 4XMCA 2NNDA 4P2CB 3E0JA 3S24A 3C3LA 3L3OC 1X8OA 1HR0Q 1CSPA 2VUMB 3OBLA 3FR5A 3T4AC 4AH6A 1KD1C 1BCPF 1EWHA 1ICWA 3EIVA 4G4KA 4K5WA 2KHSA 2VNUD 1T5XD 1E24A 5HBSA 4RFBA 2CBSA 1KRSA 1GVPA 3MWYW 3IL8A 1I6HH 3FR2A 2C35B 3W1BA 1VF7A 3MXNA 3J81L 1PTOF 3QG1A 4CDDA 2KHIA 4KY7A 4JI2L 1NMFA 1A3TA 1KABA 5GQOA 3PO3G 4Y0SA 4LNQA 3WYQA 4XT3B 1PTOH 4RCNA 2NVXH 1AEXA 2WAQE 2NP1A 1KHIA 2RTNB 1PTOD 1NBXA 5KICA 1KAWA 2A6ED 4YKOA 1XKIA 3WYPA 1DGSA 1L0XB 2JN3A 4HCSA 2R7ZB 3CQNA 4NNTA 3K5NA 2FHNX 4A3KB 2KW1A 3RUZA 3K7UC 4KY6A 1XNRQ 2Z4IA 2D0OA 3FA9A 2AL0X 1UZ2X 1VYFA 3HOZG 1W4TA 4JVZA 1VMPA 1E2VA 1BBXC 2IZDB 3DSZA 4HPBA 1PH4A 1D2BA 2OF9A 3QJYA 1LT6D 5CGKA 1KNAA 1TY2A 2C9OA 2AT6X 4NXNL 3NWSA 3A7LA 3F2UA 1LCWA 2B2UA 4ZCKA 3RSWA 5H9AA 4Y7NB 4H44C 2A5BA 2ZAIA 2JP1A 4HN7A 4IPDA 4IFDH 4RUUA 4P71A 3TEHB 4A3DG 4ZUIA 4X62Q 2FTBA 3C46A 3I55A 1SNOA 4QGXA 2NVTH 5L8OA 2DNCA 1PYSB 3SZJA 3SLJA 1HFNA 2ZTDA 1HA5A 1HNXL 1STRB 3TZSA 2RTJA 3A8KE 4ZJ0A 1U4LA 2JJQA 1Q12A 1X8NA 4ZUJA 5A2QL 3Q24A 4LAAA 4MEEA 3A5UA 1SJED 4FNFA 1SXYA 2F0NA 2JW1A 1W6KA 1GX3A 5T1IA 2VW9A 4NV7A 2X4MA 3GAQA 2W2FA 5LL6X 2CCZA 3O2YA 3KLWA 1D5XC 1UWVA 2Q8IB 5I2YA 3J7ZC 5JVH3 1NR2A 2LBVA 3OIQA 3WJCA 4WFUA 2PZTA 3BZDB 2H1EA 3CKFA 2DUDA 1Y69U 5BN5A 2JOZA 2BHVA 5F6ZA 2X8FA 2BA1A 1IBKL 3LTWA 2AH7X 5C5MA 5LJDA 1YWCA 2JA8B 1HH2P 3WJFA 2E2HH 1BSQA 3HP3A 1TWAH 2F4IA 4JCVE 4K14A 1B3AA 1IXRA 3S1MB 2XN9C 1SY1A 2RN4A 4B3RL 2CW0C 1DD2A 2XRSD 4KK7A 3CD6A 1B8AA 1VWNB 4TNNA 4LF7Q 1HPCA 2MUYA 3GD7A 1RTNA 2FLJA 3BDLA 2EVBA 3TSSA 1Y8NB 4NB3A 4DV0L 4BX5A 4OGQC 2EJMA 3CHBD 1HBQA 4RCOA 4AZRA 5C3WA 3CKIB 2F03A 3S1RH 4TLJA 4ME5A 3NADA 2HQEA 1U4MA 2N8NA 1A6XA 1LCZA 1E0BA 1SY0A 5I6YA 4TQUS 1PMPA 1SLFB 3WDNA 4DFAA 2NZHA 1ET9A 1AFPA 5FFHA 2KEEA 4NYRA 3TP7A 4B3TQ 1IW7C 3KFFA 3U0DA 4QNIA 1FGBD 3RNUA 4C3JH 3K5LA 4PMWA 4WHIA 4CDCC 5IP7G 4X3UA 2GC9A 4GLVB 4XQNA 2CVRA 1I4UA 3M4OH 2E5LL 3FHWA 4KKSA 1G8ZD 1BBUA 2ACOA 4C3HG 1HTLD 3VE2A 1DZKA 2K04A 4JOIA 5C44G 2FR3A 4IOAA 4BX7B 5HA0A 3IAYA 2QOSC 2JMBA 4PZ8A 1OSPO 1PYBA 3M4QA 3PF5A 3ELZA 1UNSA 1GKAB 3RR5A 2I5ZO 3SE0A 3ZW2A 4X65L 4AQYQ 4FDBA 2QKIC 1JE4A 1SRGA 4GN3B 4DK6C 4MVEA 4UP8A 3NPOA 3CC4A 1YP6A 3LGJA 1PZID 2DY8A 4KC8A 3E6ZX 2F0QA 2RA6A 3S1NH 4A93B 3GV6A 1EQDA 5JJZA 3B2LA 3U50C 2ACPX 1KNEA 4FF4A 1LLRD 4ZHHA 1I78A 5IGDA 5LMNQ 2BLGA 3TQYA 3CR6A 4ZH9A 4F8MA 3M85A 2OYBO 1Q46A 3NTIA 2QO5A 4ODGA 4GLAC 1LV9A 1SFOH 2JN4A 4LFCQ 2C4IA 3WZPA 4IMOA 1XMOL 2JA5B 3JQOA 4OMWA 1FJ1E 4WRDA 3NBXX 4CDCA 4HAEA 1IKEA 1KL5A 2LKKA 3I4NB 1RSUB 2OY5O 1GUNA 4C3IB 2Y32A 3VYUA 2Z8LA 5DG4A 5H9NA 1MJEA 2L1BA 2WSJA 3ZW0A 4GNXC 1O7YA 5ELBA 3GV3A 1Y55X 4MVLA 1D5ZC 1WTWA 2ANSA 1X6OA 1V9PA 5HGTA 1H9JA 1MGSA 1WTOA 1RXJA 3J81c 4ZGUA 4QJFA 2CWPA 3KDFA 1L0YB 5LL6S 4EKVA 1D3SA 1YUPA 3ZUOA 2I46A 1LACA 3WOVA 3BVZA 4BS9A 2A13A 3FEWX 1TS5A 2UUBL 5CV4A 1KDBA 1SE2A 1X54A 2PZWA 4UDUC 2F0HA 3J7A5 2Q8TA 3DWQA 1UAPA 4BBRG 1VCIA 1O7ZA 1ZXTA 4TQ2A 3EJIA 1FNVA 2EYJA 2BA0A 4RHSA 1K24A 1YHBA 5EAYA 2IZGB 5JD2A 3J81j 3STNA 5C6AA 1NJIC 5KRUA 1CBSA 2A6EC 1LUZA 2QEJC 4NLJA 1STAA 1LTGD 5C3EB 1XNRL 2CH4W 1SREA 3CMEA 1V1OA 1MX8A 5ELCA 1CKOA 2I5MX 2RDFA 2FKGA 4EQAC 2NVXB 2KCNA 3F2BA 4FGIB 2D62A 4A3IG 4JG2A 3T1YQ 1MM9A 1Q90A 1UE1A 3HOLA 3UDFA 3EN2A 1G51A 3AB9A 1FELA 2Z4HA 1B56A 3FA6A 2R7ZH 3R2TA 2B8GA 1YNXA 2ZJPA 1KT3A 3HK1A 4Y0RA 4RA8A 5B5GA 5CV8A 3CWKA 2K23A 3S1QH 4DUYL 1PHJA 4QQ1A 1Q86C 5HCCC 3WJEA 3WBGA 3S17H 2EE1A 5LJCA 1FNWA 2F4VQ 2EY5A 2JA7G 2EYHA 1EIHA 5IO6A 2WQ9A 3FMZA 3CCLA 5IWAQ 1CJ5A 3NHHA 4MTKA 2K32A 2A0AA 4AYBG 3U9OA 1O7IA 3KQ0A 1DYQA 3T1HL 2HHHQ 4FVMA 1BVSA 1NQNA 4GD9A 5CYBA 4IJLA 5C3EH 2RQXA 2HZRA 4R4TA 1K3BC 1TU2B 4LF9L 4A3EB 3RZDB 3F1ZA 5EEEA 1E22A 2OY8A 5B2AO 5JJLA 2N88A 1DV9A 2A6HC 5M3FB 1JOQA 1WTXA 1TW4A 2ICEC 1P6PA 4U8UM 1EYDA 2UYWA 2MP1A 1EWCA 4RMFA 1JCKB 2ZT9C 2Z1CA 3KFHA 3A74A 1E06A 1Z6HA 4YWMA 1PTSA 5F58A 2IZKA 3VGWA 2Q2UA 4PZ7A 2NVQH 1MHWC 3SK6A 3OMCA 1HTPA 2K5HA 1HXZA 4FP5D 2F0KA 3HOXB 1SWUA 2X6LA 1QY1A 2R3ZA 2PMZE 2OQKA 5EPKA 3PSIA 3OD9A 3CRLC 4GUZA 3B6YA 1U9RA 4EFGA 5C4XH 1G2TA 4Z2VA 1PZKD 1DZMA 3WXQA 1KC8C 2W2AA 4CHTB 1BR9A 2B63G 3L2PA 4FF3A 2VZAA 3U4ZA 1FE3A 4BJ8A 1EY8A 4EVOA 1LICA 1ZNDA 3S26A 1Z7TA 1RAVA 2PCFB 5JAVA 4B9XA 4PMCA 3TZUA 5HGQA 4QGUA 4A3MG 4A3MH 2F0OA 1IL2A 1FDQA 1PBOA 3VE1A 4NKLA 1BJ7A 2G8CO 4GE1A 1N8RC 2WR6A 1I4QA 4QZUA 1IKMA 4A3DH 2EYLA 2QILA 3I72A 1HY2A 1S7DA 4XMEA 4K2LA 2GVBA 4U68A 1Q7YC 4FF1A 2WUTA 1EYCA 2JYOA 1XMQL 3H6MA 5BVQA 1O1VA 1OBQA 1SWNA 2W2BA 3I4MH 1PV4A 1LIDA 4ODDA 4QCLA 2IHFA 3A7AB 4GNWA 3PUXA 3S14H 4IUTA 4YY3L 4I65A 3HOWG 4GK9A 1VF5C 5FLXc 4JBJA 1TVQA 4L63B 2BH2A 2FS7A 3D3RA 2L12A 3EA6A 5JPNC 2F3VA 4D6BA 3W1GA 3E3XA 3FDCA 1HJPA 3M3YH 4BY1B 1Y14B 3KK7A 2Z6KA 1WYDA 2A68C 2K05A 3L4RA 1Q1EA 2F0VA 3PUVA 3NTKA 1HNWQ 2ZTCA 2FS6A 1TS4A 4HMJA 3MBTA 5KEEA 4RWSC 3IRBA 1BO0A 1Y1VB 1JMCA 1K73C 2PW7A 4KKUA 3GTPH 2SDFA 1EY6A 3PPTA 4INNA 4LFCL 1GM5A 3D6WA 2KENA 2AT3X 2AMMX 5HZ9A 4N7DA 4OXPA 5KHPA 1GUOA 3PH6A 4L5RC 3T51B 3RLOA 2WP8J 2PPBC 1ML7A 4DV1Q 2EDGA 2HIVA 1PH5A 2IT1A 2L15A 1N36L 2RCQA 3TS0A 3MM0A 1LPJA 1VQMA 1B70B 1GKAA 1HMRA 3G7XA 5FKAC 2FWVA 3FLLA 4XMHA 3WJBA 4XIGS 4XT1B 2WFWA 4BOEA 3I0AA 2LXKA 1SROA 1JJUA 1KLUD 3P6GA 3ZZVA 5CV6A 1VQ4A 1BCPC 1SFOB 1KQWA 3VPJE 4BX7A 2XWBB 1F9PA 4DV7Q 3ZYYX 2UXBQ 1NUCA 3DLLA 1GJXA 2B2TC 1WOCA 1B9MA 2KCCA 3S5XA 4QIWE 5HZ6A 4Q5VA 1OTCA 2UUBQ 5H9LA 1ESRA 2KQ3A 2FXQA 5DM63 1VQ5A 4UP7A 5J1ZA 5FOBB 1DF8A 3U9PC 4CDFA 1BOSA 1IL8A 4EDEA 5EBCA 2BH8A 1QG5A 1SXUA 2I5VO 3S2HH 2BDNA 1CHPD 5HZ8A 1Y1WB 1SAPA 4ZHFA 3K7AB 2L67A 4NP5A 4YH0A 3AYHB 3QIAA 3T13A 2HMBA 1W6FA 1JJJA 2GTLN 4K5VA 3JAML 2JK8A 3I91A 1RL2A 1X3PA 2EIFA 4JI4Q 1NE3A 1BF4A 3KF6A 4DR5Q 4BY7B 4KLKA 3I90A 1KT4A 1LKEA 3NQ9A 1SNPA 4LZVA 1JICA 4K8JA 4FBOA 2L9CA 1HQMC 3OW2A 4P72A 1FR3A 4JBMA 4CSBA 2K1BA 1EYGA 1YWAA 3X3MA 4YKMA 3RDMA 1LTID 1I04A 1IYUA 2HZQA 1KGLA 4HMIA 5IXGA 4ME3A 5C0NA 4P75A 1STHA 4YDBA 4DK3C 1GO3E 1Q8IA 2DN8A 4FO2A 5D48A 1SY2A 5JPMC 2R7DA 3PV0A 3VDYA 3EBWA 4LKPA 1OEEA 3F2CA 3D96A 1PFMA 1SBBB 4DGZA 3PO2B 2A3FX 5D8JA 2PYKA 1JB7A 4TSSA 1ASYA 1N7YA 2ICIA 2AMCB 2EOTA 3PGZA 2EY2A 5FO8B 1QQSA 2MF6A 2MWHA 4KMUC 3P20A 1CZWA 3ERQA 2JEBI 4OWWB 3S2DB 1PA6A 4FYDA 1CBRA 1RBPA 1SWGA 4AIMA 2XIWA 2HNXA 4Z6JA 5C4JB 2L4NA 3IKJA 5IOCA 2V1CC 1N4JA 3S17B 1QJOA 1SMYC 1X8PA 2AT5X 2CAMA 3FKIG 3ITPA 2XSTA 4ARHA 2DGYA 2D2CC 1ZRYA 2KBNA 1B44D 1EY7A 4BX6A 2IZEB 3SOTA 1WCMB 3H94A 3ND9A 3CAMA 3K57A 4LF5Q 3CMPA 2RF4A 2HLVA 4TJZA 3A54A 2RCTA 3AKNA 1YHQA 5KNCA 5M5XH 4ML7B 1GHKA 1DZJA 3TGBA 4L5TA 4O3YA 2F09A 2QF7A 2A2UA 1SE8A 5M3MG 4CKEA 4Y59A 1CKNB 1R9TH 1XYIA 1VQ8A 3GTLH 4K19A 1F2YA 3Q22A 3PO2H 5I9OA 1SXXA 5ELOA 4APVA 4LF5L 3VA5A 1VWLB 1PH1A 3R2IA 1SWRA 1EXSA 1BRPA 1N36Q 2CQOA 3HOZH 2B3GA 1ERXA 2B2WC 2G5LA 4O3XB 2VY3A 1VWKB 4S3SA 2IZFB 2YU9B 4XQQA 2YYZA 2E2IH 1JOKA 1H9RA 1SYFA 3J81E 3KJOA 1S5ED 5I6WA 5IT9c 3HOXH 5E4WC 4ALPA 2RTIB 2RTRB 2WPUA 3ZUIA 4EXZA 3AU7A 5DNFA 4COTA 2V4DA 1WCMH 1YI2A 1ERBA 2A8GA 1LUQA 4CKBA 3DWAA 2QW7A 2E2DC 1TKWB 2AKQA 3HWGA 4IPGA 2EZVA 3K8AA 4H7BA 3PO3H 5H8TA 4GLXA 4F7XA 4G57A 4QAEA 3BY0A 1SDFA 4YWLA 1EYAA 5FLXL 3FRPB 3BVGA 1OXTA 1WTPA 4DPGA 3KZAA 4R0BA 2WB1B 1VS0A 3MVFA 2SOBA 1LTLA 1ZYRD 4I3CA 1LDQA 2WKDA 4H13C 1T5EA 1AE3A 3VG5A 2R92B 3LWEA 5IT9E 1GGLA 3NWTA 3SR1A 1E3PA 1S5FD 2KECA 2I0QA 1VWPB 1BLRA 1AVEA 2ALYB 4QGVA 5EGTA 1EOTA 3OOCA 3GTGB 4GKJQ 1SRIA 2CH4A 1WTVA 2PQEA 4GNYA 4UP9A 1VQ9A 1DM0B 5IODA 3BG3A 3QWNA 3A8JE 2JXMB 1I5FA 1R4PB 1TWFB 4YHHL 3HOYB 2UU9L 2YTXA 3LWUA 1KZXA 5I2XA 1TVXA 5NUCA 1A2UA 4ZLTF 2FJ2A 2UXDL 1A8VA 2SNSA 2K5VA 1DJRD 1VWCB 4C2MB 1Z9FA 3K59A 3UE1A 5IGBA 1JQPA 2E8GA 4ZHDA 5IYCG 2L55A 1K8GA 1GOZA 2B2YA 3HOVH 1SYDA 2CM9A 1I94Q 2MJ8A 1II3A 4DN4M 4O3WA 1VWJB 3G71A 5M3MH 3FVQA 2RTDB 4LF4Q 4JYAL 2L5PA 4LUZA 5EPJA 5B3MO 1MVGA 2NB0A 2RTQB 4QMGA 4GNXA 2GH7A 1TOUA 1K8MA 1SRUA 3RLNA 4QL5A 2IX3A 2CZUA 4I9SA 5LMUQ 4DV5Q 4A3GB 4DU9A 3EW1A 1C4QA 5CR3A 2D9UA 1L2FA 1C9OA 2RSOA 4QF4A 2NNQA 4C5PA 1FJGL 3SLOA 1B4MA 3ZQ3A 5K36G 1NGLA 1JQYD 3CMAA 3FEKA 5C3XA 5B11O 1LT5D 2R93G 3C1EA 3QO2A 3D4DA 1VQGA 2IZLB 4RG1A 1ENAA 2LMCB 1KOIA 4N8X1 4Z27A 5LJGA 5DEHA 2BE5C 2K28A 4WFN3 3OE3A 1WFQA 3EMMA 5IRAA 3T1YL 4LFBL 3BDOA 2Q4NA 1TWCH 3SK5A 3IA8A 2EY6A 4M8AA 3HOEA 2OTLA 3NK9A 3K7AH 1AH9A 2B63B 3K58A 4XMGA 3KFUA 1ONLA 4TKHA 4OWTB 3BDRA 1F9SA 4U673 2LB6A 2OF8A 3RN5A 1PRTC 2PI2E 1VQIA 3CRKC 3MXUA 3ZJYC 1EFWA 2OFAA 2A74C 4NXML 3TP6A 4CK4A 3GP7A 3V2TA 5D14A 1VQBA 1WD1A 4IFDI 1E7ZA 1J9OA 4XDXA 4GETA 2WV6D 4YFRA 2TSSA 4QYNA 1QG7A 1PH8A 1STSB 1A15A 3M9BA 1OXVA 4JOIC 2Q2TA 4A3IH 2KTSA 3AMUA 4HIDA 3NE5B 1NP4A 4KJNA 4DR2Q 2JU7A 2I5LX 1YNND 1AQBA 1B53A 2HUGA 4RKBA 3QOLA 1ET6A 2K52A 1SWEA 3APUA 3HTYA 3KBXA 1DF3A 1IFBA 3OIPA 4DNEA 4G7OC 4JI7L 2RDGA 4QYPA 1HZCA 2RVLA 4MHEA 5HA1A 1HNZL 2YG2A 1Y8OB 3KOJA 1QNKA 4BBRH 1RXHA 1VWOB 3TMEA 1PH3A 1B0OA 3NSWA 3H09A 2VQEQ 1LIEA 2RHQB 3CCMA 1HBPA 2X56A 3G48A 5GADC 5EDBA 1C0AA 3RDQA 3E5SA 2F0SA 3VR5A 3ICEA 3X00A 2O5JC 2OL7A 4A1HA 4XQJA 1DOLA 2F3IA 3J80E 1VQOA 3S5VA 4TKOB 2IJ0A 1VQPA 4C3JG 1T9HA 4DR7Q 2VQEL 5C5LA 1IYJB 4A3LG 4JI8Q 3DTQA 3VU1A 2PW5A 1SWAA 3UEXA 5IIFA 1SWOA 4KH8A 4LKTA 1I50H 1G6ZA 2CBRA 4OO1G 2IZAA 2N49A 3QOJA 4KD4A 4AQYL 5LMNL 1JORA 3PK2A 4I3BA 4OELB 1YWDA 2VB3X 1AVDA 2CW0D 5LKFA 4Y5DA 3K6OA 4A3DB 3MVVA 4DR7L 3D6CA 3RBYA 1SLGB 3EBKA 2K03A 1S44A 5JOBA 1TY0A 2F0TA 4RUNA 4KTAA 1GHJA 4R8NA 2F0DA 4AYHA 3QQ2A 4HJ9A 1CSQA 1IFCA 3Q0AA 4J6HA 4K0KQ 3BLGA 4OELA 5F2BA 4L5SA 5HWZA 4AYBE 2G5DA 5D47A 4UU3A 4PMBA 1ZYRC 3MFGA 1KTKA 4DUZQ 4BQUA 1DZPA 5EDCA 4I7AA 3D4RA 3RDUA 4YIJA 4R4OA 3STBC 3M3YB 1KT5A 1H9KA 3K0YA 5LJEA 3FDTA 1SN8A 4JBKA 2X32A 5HCDC 4OHJA 1WCMG 4PZ6A 1PTOC 1ALBA 4BX6B 3JAMi 3HRZC 2J0TD 1YBYA 4K8IA 4ABNA 2OTJA 1JT8A 2IL8A 5DLQE 4C3IG 5CHKA 1TWHB 1P8LA 1S5CD 1OXXK 4ZAIA 2QM9A 1K83B 2DJGA 1J5EQ 4JV5Q 1CQFA 2NN6H 4LUVA 5B10O 3FEPA 5F6BA 2F0IA 1EEFD 1G2SA 4TKBA 3PF4A 5A2QE 2O4XA 3O13A 3PO2G 3APVA 2JA6B 3VG6A 2UUAQ 3TF6A 4KIIA 3ZWEA 1LTRD 2F0JA 1KL3A 1CUKA 3G7LA 1QB5D 1BCPB 1HRJA 1YNJD 1SR3A 1CT1D 4DCBA 4DV3Q 3FP9A 4DR3L 3SGIA 4C2MH 1VWHB 2IZHB 4JI1Q 3PQIA 4RHRA 5H1SE 2QCBA 4R4QA 1HNXQ 5AJ3Q 4AYBB 4CDEC 1A2DA 2QOMA 4DA2A 4QB4A 1ICFB 4BA2I 3KLSX 4QUFA 5FJ8G 2POAA 4O42A 1OEKA 1SWHA 1YIJA 1AZQA 2YV5A 1TWHH 3R93A 3CF5A 1ICMA 2NZ1D 2P8GA 2AVIA 2QA4A 1IKLA 2Q9SA 2A68D 4OL7A 4DV6L 3D31A 3APWA 2F0GA 2FFKB 5I4DA 1MIUA 1ZNKA 1WTHA 4OO1H 4KHPQ 5CE4A 5EZ2A 1K8OA 1U4PA 1DZ1A 2KUMA 2NVTB 1N9YA 4A3GH 1J5EL 3RZYA 1V43A 1LTTD 4EQNA 3FW4A 2BE5D 1D6EC 2JA7H 5IWAL 1JWUD 4HR7B 1EEID 1NMGA 4V190 2Q2PA 1ZEQX 5L8NA 5GROA 5JR8A 1NNXA 2WWPA 1BDOA 3DXJC 1JE5A 2R61A 1SNDA 1Q81C 1AVGI 3C1FA 1LM0A 1MD2D 2A73B 4NNSA 3D97A 1Q3LA 1A3VA 2HCCA 1XXGA 2EU7X 1OO9B 3TZDA 4A3JG 4FXDA 2C1SA 3F2DA 2CZTA 1ENCA 1YVCA 4RGTA 5LMNW 4JI3Q 1VPRA 2M4LA 4YCEA 4ZQ3A 2K14A 5AFWA 2KHJA 4I3DA 1KL9A 4O0AA 2E4JA 3N52A 4HCEA 2ZXRA 4UPAA 4YCWA 1LTSD 4X64Q 3H3VH 3FW5A 1R4QB 1F2LA 3JAME 3CCUA 5EEDA 4CDDC 1BKBA 1YP7A 4YWKA 4LF8Q 1VWIB 1LIFA 2F0UA 3PUYA 1D8LA 1H9MA 1Y1VG 1KQSA 3NUCA 2OVSA 2JA6G 2ZSCA 1IJ8A 1CZGA 3Q8DA 1JC7A 5IGCA 3IFDA 3N91A 5C4XG 1XNQL 1EPBA 1WTRA 1CBQA 3I4NG 4FBVA 1KFFA 2XTIA 2L9HA 3E3CA 2ZJRA 4JBWA 1GM6A 2KOLA 4C3HH 4DQ3A 2MHDA 3T6LA 4GS3A 2BC3A 3H3VI 3OWEB 1ENFA 4GOPB 2PQAB 1YJ9A 2RTGB 5C4XB 4OS8A 3E0EA 4NP1A 3HOWB 1JJGA 1H9SA 3L7ZC 1CKNA 3CKGA 2E74C 4A3FG 4JV5L 4R1JA 1SA8A 1NSNS 2NZOA 4U46A 1PVOA 2PMZB 2Q39A 1P16A 3DM1A 1S3OA 4P74A 5M5WH 4AW8A 3UEWA 4A93G 2ALLX 2BCOA 1QVFA 1FD7D 4WJ3M 4GGZA 2B39A 2Q8RE 3OTOQ 4A1YA 2UUAL 1U0LA 2YU9H 1AB0A 1O80A 1H95A 3NBIA 1H91A 1J6QA 3RD4A 5IGEA 1G91A 1L6MA 4GGRA 5IGGA 1VMCA 2VS1A 1QVCA 1RXKA 1UYNX 2XVSA 1JYJA 2K62A 1SEBD 2M2LA 2RCFA 3NBHB 4EQOA 1E2TA 2IFBA 2EXDA 3CCSA 2LFNA 2F0MA 1Z47A 4A3JB 4NLIA 2TMPA 1GUTA 4C3HB 3OW7A 1PMRA 1QFTA 2JGSA 5D65A 4TKJA 3M4YA 2R92G 2MJIA 4M6SA 4YFPA 3UEVA 3H3IA 5KYIA 2UXBL 3B2IA 3VG2A 1NC9A 1KXLA 1KQXA 5KNDA 2R73A 1SNQA 2R6GA 4IURA 4U3QA 5BN4A 4F87A 4DUZL 4BGFA 5BR8Q 1C48A 3AEHA 1K3BA 4O4OA 2RTMA 4DV1L 3SXHA 1TT2A 3GTMH 1N9MA 2FHTA 5BVSA 3CXCA 5FQ6E 1GT1A 4BBSB 1EFID 5J22A 1BUVT 4C3IH 1I6HB 4BWGB 3PUWA 4CV7A 1KT7A 3UDIA 2A69D 1HCZA 1PFNA 3T16A 1U0XA 2VFBA 3NX1A 5CC4A 2O62A 1BEBA 3FPUB 4QZTA 4O9SA 5D45A 1N43A 4JI4L 2D5DA 3HOUB 2UXDQ 4C56C 1T0VA 2Q2HA 3K5OA 3RY2A 5L8IA 4IJHA 2RTOB 4A3EG 2VL6A 4HJ8A 1FYCA 4YHHQ 5HTDA 3NTHA 4A4IA 3FPPA 2EY1A 4A3KH 4Z9CB 1PEEA 1U4RA 4CPFA 2PZUA 5AJBA 1HQPA 4N7CA 1KXOA 4NPSA 1UEBA 2WINB 4EGVA 4B3SQ 1SLJA 2A69C 3C78X 1DONA 2E76C 1GKHA 1U5KA 3VR3A 2Y3EA 5EQ0A 3ER0A 4YCVA 2OY7A 5KIDA 3D8GA 2LXJA 2L11A 4XYQA 1WTQA 1N33Q 4NV8A 5HZ5A 3FELA 1Y1WH 4DR5L 4MZ9A 4L6TB 4IQZA 4FXGC 2RTBB 3HPEA 3FKIB 4DK0A 4ORRA 3HS0C 5HAEA 2AUJD 2MNAA 3U58A 1O78A 3Q6LA 2MM3A 1V1PB 5LMUL 4QUCA 4DV5L 1XJVA 4GKKL 1YWBA 4LF9Q 2RTLA 5G3LF 3J80c 3PIO3 1B3QA 2IZBA 5COYA 1BCPD 4IUUA 4LF7L 2AUKA 3TP8A 1F2MA 4L1NA 1UE6A 3CC7A 5G3LD 2BOSA 3KF6B 3EROA 1J8IA 3WVMA 4DNTB 5E1FA 1Q82C 1VQLA 1IIUA 2ES2A 4MVKA 4PG3A 1EPAA 1A0IA 5KYLA 4XXEA 4B3SL 1BSYA 3BX7A 3KVNA 2FGSA 2SNMA 1SMXA 5FO7B 5C0XG 4A3KG 2G79A 4LFBQ 4N9PA 5L3YA 3RDSA 5H9KA 1O7LA 2EXZA 2ID0A 4HFOA 4ZHCA 1B9NA 4R4IA 4K6DA 2IHEA 1RLBE 2G9HD 1Y52X 2BS5A 2RCNA 1QNUA 3P1HA 1A57A 3VG3A 1MKHA 4MN3A 3H0GB 1SLEB 3S2DH 3P6EA 3OJYC 3SEBA 2FMCA 1M90C 1PDQA 4DR2L 1F2ZA 5IT9L 3RDXA 1FTPA 4BXXG 1G6PA 1UREA 2OCEA 1I06A 1Y8PB 3S15H 4MVIA 3KDFB 3S9WA 4C3JB 1CQVA 4J15A 1ILPA 2NVYH 4HSVA 4DNRB 5BR8L 4QGWA 3MEFA 5HTEA 4ZCBA 2KD2A 4FBRA 3NEMA 1T68X 3GTKB 3R3OA 1N34Q 4GOPA 2KT4B 1ILQA 1R9TB 3GTLB 5ELNA 2PY1A 2RA4A 3S60A 1UUPA 1VQDA 4RAUC 3FA8A 1CI3M 1HQQA 1I3QH 1PH7A 2IZCB 5FO9B 1JMXA 1QABE 2WEXA 3HOYG 3WZNA 1HZAA 4JGLA 2OL6O 2JQOA 3H0GH 3U9SA 5LHY1 1QILA 4OX9Q 1X3FA 4OEMB 2E2IB 5IRUA 1N32L 2WACA 5C44B 5IYDH 3P6CA 4CDEA 1I6VC 1SMYD 3MTSA 1I4HA 2R7FA 2K7VA 2HDMA 3I4OA 1BNZA 1EU4A 2IW3A 4AZMA 2DY7A 3S16B 3P02A 5K68A 1W3SA 4GZYC 4GKJL 1SWQA 1RDPD 4DAPA 4Y0PA 1AP0A 2B2YC 2K50A 2PNHA 4QRLA 2WB1G 2L0CA 3EBEA 2L68A 2K5QA 3BYTB 4ZKCB 1MUPA 5HY6A 1EI5A 4GKCA 4WBKA 1SE4A 3WJDA 3AUMO 5DM73 3W5OA 1AE2A 1LT4D 1MX7A 4NYQA 5E3FA 1PRTF 3DWPA 4K0KL 3KFIA 1PTOB 4IN3A 4LF4L 4JYAQ 2RHSB 4LFAL 2AT0X 4ON1A 3RDOA 3RZOH 2ZM6L 2F0EA 2F0PA 1PRTD 4KY5A 4X3TA 1DOMA 4NW4A 3EW2A 1KIXA 3T6FA 4DR6Q 4ALBA 1EUJA 5JEAG 5E7NA 5C0XH 1EQTA 5C44H 1Z24A 3WZOA 3J7AF 1I4PA 2NTSA 5EKKA 1F9QA 3UDXA 4B3ML 3BZKA 1MSHA 2L5TA 2JA9A 2FR2A 4OX9L 4MIRA 2R93B 4IZ8A 1TWFH 2M00A 2X6GA 5C4HA 3HOYH 1ZNGA 2BT9A 3BSZE 5DPQA 1VWDB 4XYOA 2NTTA 3TDQA 3FR4A 1WI5A 4YFQA 1E1TA 3LV4A 3I8ZA 3MEHA 4HTHA 2O5IC 1Y9TA 2PI2A 3G6JB 3J7YW 2EYMA 2CM4A 1GX8A 1A3UA 3ZI8A 1BQQT 4WORA 1SYBA 4E6IA 4A3GG 1DCZA 5M3MB 2GTFX 1KAAA 2Y0SG 2K4KA 1LDOA 1VWBB 5F1EA 2DJFC 3AQQA 3PIPA 2ASBA 1STPA 3LNNA 2PQAA 5C0XI 1NY4A 1S4ZA 2RBMA 1VWRB 4YDAA 3GTQH 4BBSH 2X45A 3BU2A 4CJ1B 4L5QA 5C0XJ 4MISA 2GTLM 2N93A 1CK1A 2Q2MA 4A3FH 1D1IA 3KLRA 3WOFA 1EOVA 3G4SA 1S40A 4K2KA 2X34A 1G7NA 4CPEA 2B2UC 3NP8A 3HOXG 2LFOA 4DR4L 3BDCA 3UI2A 1VQFA 1L0WA 2OL8O 2IWHA 4LQZA 2KEDA 1BSOA 4ORXA 3S1QB 4Z2OA 1D2UA 5AJ3L 5ISRA 4A76A 4KHPL 1SRFA 3MG5A 2A6HD 3B2KA 5JJKA 1DOKA 3AEVA 4PSQA 5F7GA 3SAOA 1UYOX 2EPBA 3ULLA 4I60A 2JA8H 1EU3A 1QZHA 1SXTA 3CQZB 2X46A 4BXXH 3BRNA 4ES7A 3OPOA 5M3FG 1HN2A 1KL4A 3NQKA 5B27A 3J80L 3K0XA 1SWSA 2IZIA 2KJXA 4GDZA 2WAQG 5CV7A 2MO5A 2E2HB 4JI7Q 3UAQA 3NQTA 5IY0A 1EIIA 1VDZA 4FQBB 2DNEA 1TWGB 2VB2X 4N8FA 3H15A 4N9TA 1M8AA 3HZXA 4PNYA 2IY5B 2IPKD 1QUQB 2JU8A 1YEZA 3FKIH 1IBKQ 2DM5A 5GAHC 4D6AA 4O49A 4GZVA 2AKWB 3MXNB 3WOEA 5M9OA 2RTAA 1SRJA 1GT5A 2HT1A 2YMSA 2B2VC 1SMPI 1TR5A 4WJ4A 3RN2A 1FL0A 3O22A 5J3BA 2K5DA 5EBDA 1RJTA 2E75C 4C1NK 5EKLA 1Y1WG 4O1NA 1MSGA 1S5BD 1AN8A 4HIKA 2RTEB 3ONAB 5EJWA 5ELDA 2I5HA 2F01A 4AZNA 4CBVA 1HQRD 1X55A 3HWFA 4JHQA 4ORUA 1Q8KA 1FENA 1JIWI 4IAXA 1AZPA 3CCRA 1C7YA 4DV4Q 4GU8A 1OBPA 1YHAA 5JEAJ 3NENA 1QVGA 3E9IA 3JC66 4HIMA 3BJUA 4O4UA 1E2WA 3NP1A 3MA2B 5M5YH 4UY8C 2HCIA 1XMQQ 3STKA 1TWGH 3PQSA 1IZ6A 3KUPA 1D5MC 1MBYA 1VQKA 3NX2A 4R8IA 3N6RA 2CKZB 1UE7A 3K5MA 4PQXA 4OKAA 3ND8A 2GA4B 3HKZE 1O8VA 5BN3A 4BBRB 4LWCA 5LKEA 4GN5A 3DHQA 3DUZA 4G7HC 5A35A 3AKMA 1LIBA 4KKTA 2AWNA 2ATWA 4OO1I 4GRJA 3E9HA 3U03A 1EQQA 1VQHA 3HFZB 2UU9Q 1NBWA 5AEOA 1X3EA 4IUQA 5JEAH 3I56A 4CGYB 4JI0Q 4H0LC 3I4MB 1GD7A 4KC7A 4DAMA 3AFQA 3VYSA 2F0WA 3I4LA 3I70A 3T53B 2WEWA 5B29A 2RTCB 1ZNHA 5D4AA 1CRBA 1MOYA 3V96A 1OBUA 2G7BA 1H9SB 3J81i 2EYOA 1YNNC 2RQ0A 2N55A 4DQ4A 4XMDA 3T1DA 1ACDA 4OIKA 2H5XA 1V8QA 2EYPA 1EL0A 3OSOA 1K3RA 2JA5G 4X66Q 1VYOA 1I3QB 1JMZA 3RE5A 1A2TA 4RKLA 4BY1H 3HKSA 3QKGA 4DXFA 2NUCA 1PH2A 1CA6A 2VDFA 2J4XA 4JK1C 1TIID 2R92H 4KN4C 1PZJD 2QDBA 4XTCS 4A3CG 3OYYA 1HZBA 4JW0A 3BS2A 3A5ZB 3RMHA 1KLGD 3U4VA 3K3LA 4GDAA 3I7FA 4X66L 1QUQA 1QY0A 1SWBA 4K5XA 5FAZA 1U17A 4IFDG 4JI2Q 2KCMA 2LS01 2ZM6Q 3T1HQ 5TSSA 4Y52H 3MZ5A 4KV6A 3DEOA 2WQAE 3G6EA 5EPLA 2LY7A 4GJVA 2WIIB 1B8EA 4M1UB 4JI0L 1E5PA 2J7ZA 3H3VC 4TVAB 4MTNA 1IBMQ 1I4RA 2NN6I 2Z0SA 1XX8A 4ALOA 2A5CA 1FVIA 1STGA 4R4CA 1CFMA 2MQHA 3NR3A 3CU7A 3L9AX 4DV6Q 1B50A 3HOVB 1VYGA 3PP6A 1X32A 2NBFA 4WJWA 2AQ3B 1DC9A 1QY2A 1HHVA 4BX5B 4IB9A 1HUMA 1QWYA 1SYGA 3SHLA 2RDHA 1BBPA 4NXMQ 2B2WA 2JSOA 3SK8A 1SWDA 4X62L 4A3BG 3I2ZA 4QQBX 3KLSA 4A3LH 1IBLL 2R93H 2OVEA 3EM0A 1YZ6A 1VQ6A 1EY9A 1RCVD 4IUPA 2FT9A 1VQJA 4HJ5A 5K67A 5CSEA 2RTKA 1EW3A 1SWCA 4J8QA 4IO9A 2PO4A 5K5PA 3BYYB 1GUGA 3KFGA 4OS3A 2HIXA 2N3SA 5FQ7E 4M7MA 3M4PA 1HXYD 4OIJA 5HCEC 2C5CA 4DAYA 3B2JA 1I9HA 1IBLQ 3GTQB 5IGFA 4XMFA 3ULPA 4I95A 4IPHA 3S1MH 2HQLA 2XWJB 2JA8G 1RTOA 1IBML 1W2BA 5EKIA 1YITA 1QOHA 3K80C 1RKNA 1ZKOA 1EIFA 4IUNA 2JA7B 1A63A 5CORA 2G9DA 3PCOB 2IX1A 3ULJA 1OPAA 2X55A 2JEAI 1KZWA 2R74A 3ERSX 3WZQA 1FEMA 2B63H 4I7ZC 5AJCA 1F77A 5IP9G 1RF2D 4BY1G 3FIDA 4LF6L 1SWTA 1HXLA 3JS1A 4OMXA 4YGGA 4ORWA 2A19A 1XPOA 2NVQB 4IRWA 4GKKQ 3CCEA 4IPCA 4IB7A 3CQZH 2AHOB 4POFA 4A3IB 1X56A 3S1RB 5LJKA 1M1KC 2F0FA 5IYCH 5FK9C 5T1GA 3I3CA 4DAVA 1HMSA 1K0RA 5IYDG 1LTAD 2QDLA 5C3EG 2PNRC 1VWGB 4OWXB 1EQRA 1SXWA 1D7QA 1JR0D 3GO5A 2LA7A 1HZ9A 2HHHL 1SLDB 4EEJA 1XPRA 3TGCA 1G74A 4I9RA 2HDLA 1JB3A 2K5NA 3C2PA 2IZJA 1GUSA 3HOZB 2FMMA 3VYTA 4A3MB 3M4OB 3DEPA 4GGTA 4OEMA 1TOWA 2GTLO 3EVQA 1HR0W 3P75A 4I6SA 4YBPA 2R56A 4RGNA 2QMIA 4Y0QA 1MI2A 4DNIA 2CWAA 2XNAC 1U18A 2JU3A 4ZKBB 3D9WA 1KDAA 1NDJA 4V0BA 3S1NB 3JSQA 3FENA 1ML0D 1GXAA 2RTPB 1PM1X
chains in the Genus database with same CATH topology
1EZ8A 3PO3B 4ORYA 4IMNA 4BA1I 2ZXOA 1EQVA 2QO4A 4UU2A 1D1KA 1RHPA 2O2LD 4B9WA 1G5WA 3W2DA 1DFVA 3P6FA 4TRDA 3URYA 4ZK9B 1DXMA 5M5WB 4AZPA 1X89A 2QCPX 3P6HA 1EIGA 2OEOA 1GT4A 4NW2A 5HZQA 1A3YA 1A18A 3BVMA 3KF8A 5KNBA 1T8VA 1LT3D 4B08A 4QIWB 3PQUA 1BM5A 3P24A 1IYVA 1S2PA 1LTBD 4O3ZA 3MFYA 3OWFA 3QB3A 3VG7A 2B8FA 1JV4A 1I05A 4PJ2A 4UAIA 1CA5A 2AQ2B 1PXUA 4ILWA 5D3IB 1EZ6A 3V05A 3SK4A 3RZOB 5AQ6A 1I4GA 2KVMA 2A2GA 3S2HB 3CBSA 3ZW1A 1X71A 2OXPA 3IFBA 5LJHA 1Q1BA 4HPAA 1LABA 1N0SA 3WJGA 2XKLA 2A5HA 2AT8X 5DAUA 4AZQA 5HURA 4R9WA 3B2HA 3J7AV 1S5DD 3R8BA 2SEBD 4G7ZC 1C8CA 1JOOA 3A8IE 1YIVA 1FNUA 5I9PA 1EUOA 3PMFA 4HPCA 5BVTA 3APXA 3KBGA 1EY0A 1G85A 3V8UA 1E00A 1STBA 1STNA 4RGMA 2XRQD 2MGSA 3BS1A 1ZNEA 1LF7A 1M4VA 4L3RA 1CBIA 1GX9A 1SNCA 5CYUA 3MXGA 1PYWD 4X3KA 3F6ZB 4CKCA 3W3AA 1TWAB 4HSPA 4A3BB 2OVAA 5JVG3 3FMCA 1IHZA 3GTOB 2ZAGA 1SE3A 5EPQA 3D95A 4ORSA 4LZUA 4KHZA 4CJ0B 3FYFA 4J1MA 1PRTB 1IW2A 1SY3A 4OS0A 1NAPA 1OXUA 1CTMA 2KA7A 3DMUA 4FF2A 3VR2A 1STYA 1HMTA 1EIOA 1GXDC 1NR4A 4U8UN 2HYSA 3MHBA 2OVDA 1AW7A 5M5XB 4IFDJ 2F3WA 1JBHA 5CMDA 2F0LA 1RODA 1AELA 1CHQD 3EYCA 5CBEE 4L8JA 1RD9D 3H91A 1ESFA 3CQRA 2JE6I 1Y9LA 4KT5A 1V1PA 3HWDA 4LK1C 3NBHA 3EQLC 3SDZA 5KIXA 1ICNA 3RLFA 1R0UA 3GTJB 3F9DA 1G291 5LJBA 4O4SA 1TS3A 2NVYB 4KJOA 1ADLA 4KN7C 3TN2A 2B2VA 2VXWA 1QWDA 2MHVA 2NWGA 5CBAE 3S14B 3Q23A 4PV1C 3X3NA 4YGHA 4A8ZA 1EY4A 4IUVA 4HPDA 4HEDA 1LNMA 2FRSA 3VA7A 4KHVA 2GJ5A 3VG4A 2NN6G 1I50B 4WFVA 1NP1A 1IKJA 1I4XA 1WD0A 5ELEA 1JJXA 1BWYA 2QO6A 1JZUA 4EQPA 2K6AA 4NDXA 4DXGA 4YCHA 3LX0A 1TXLA 4HWMA 2BDOA 2OFRX 2K01A 5E4XA 2BS6A 2AWOA 1JWSD 4GH7A 4ZFXA 1XTCD 2K5WA 5CV9A 1XWEA 1PFBA 3IFTA 1F9RA 1B4OA 3GQBA 2CQAA 4IB8A 4IABA 5C4ZA 1MDCA 4U8UO 5CV5A 4KD3A 2RD7C 3FIQA 1X8QA 1SYEA 4ZR2A 2OF1A 3MAQA 3I17A 2X8TA 1HA6A 4IB6A 1YNJC 3NPPA 3HWEA 3GTMB 1JYDA 3LHNA 4LJZC 4ZYSA 1QE6A 1KT6A 4ZH6A 2NYZD 4FXKC 3EFXD 4F88A 3RKGA 1LO5D 3OMGA 2EYFA 2RSNA 5D3DA 4U9CA 3VR6A 4DF7A 1QCBD 5K36H 3VR4A 5F2DA 3MX7A 3PECA 2WAQB 2OT2A 3CBCA 2OFMX 3OHXC 3TP5A 4CJ2C 1SJHD 2K33A 2M9VA 3D4WA 5IO7A 1EY5A 3A56A 3O19A 1X3QA 4KI0A 3P6DA 1TWCB 3ELXA 1GUWA 2B2TA 4K6LA 2LBAA 3VYRA 3F8AA 2X8SA 4A3FB 1OXSC 3TGAA 2OZQA 1B2TA 4ZHGA 2MPMA 2H4OA 5FLXE 5ELFA 3M7NA 3GE2A 1BXTA 2XSCA 1BRQA 1SSOA 1HFGA 4DK1A 3RWXA 5FENA 2KTDA 3M7GA 3BX8A 2Y0SB 1E02A 3HG9A 1SYCA 4A60A 1TS2A 5KGUA 2NNEA 4IBAA 2IX0A 4ZRZA 4YBUA 2FINB 2CHBD 3C76X 3HGBA 5FQ8E 3HKZB 3PUZA 2I07B 3BU9A 4Q0FA 4MIUA 4YGZA 3HEJA 4C1NI 1JWMD 1QFVA 3C77X 1IW7D 3T56B 2ASNX 1OPBA 2EJGC 3ZW1B 4KCAA 4IALA 4NMZA 1GT3A 4RGOS 4ID6A 1OEJA 2RKSA 3A55A 2E2JB 3MC0B 1B1ZA 3PIP3 1KDCA 2WKCA 5IO5A 2AQ1B 1PLFA 5M5YB 1E2ZA 2EJFC 3FA7A 3S15B 4ZGFA 3NXWA 4IAWA 5BYPA 3BU1A 2F73A 2F1MA 1W6JA 1HUNA 5K06A 1TQOA 4ULLA 2ENBA 4AZOA 4YMYA 1SNMA 4X3SA 1NCVA 2X69A 1STEA 3I73A 4O4XA 4RH6A 1O1UA 1X8UA 3TBIB 1CM9A 3UEUA 1EALA 3Q6SA 1ZNLA 5J39A 3GTPB 2G78A 2ZXPA 1LFOA 1XCAA 4LMQD 3STMX 3MXPA 3NQIA 3P7JA 1WVLA 4BVMA 3ZW0B 3PEDA 3NQ3A 2LKVA 3PH5A 1UEAB 3SVMA 4XMCA 2NNDA 4P2CB 3E0JA 3C3LA 3L3OC 1X8OA 2VUMB 3OBLA 3FR5A 3T4AC 1BCPF 1EWHA 1ICWA 4G4KA 4K5WA 2KHSA 2VNUD 1T5XD 5HBSA 4RFBA 2CBSA 3MWYW 3FR2A 3IL8A 3J81L 1VF7A 3MXNA 1PTOF 3QG1A 4KY7A 4Y0SA 1A3TA 1KABA 4XT3B 1PTOH 4RCNA 1AEXA 2NP1A 1PTOD 5KICA 2A6ED 4YKOA 1XKIA 1L0XB 2JN3A 4HCSA 2R7ZB 3CQNA 4NNTA 3K5NA 4A3KB 2KW1A 3RUZA 4KY6A 2Z4IA 3FA9A 2AL0X 1UZ2X 1VYFA 1VMPA 1E2VA 1BBXC 3DSZA 4HPBA 1D2BA 3QJYA 1LT6D 5CGKA 1KNAA 1TY2A 2C9OA 2AT6X 3A7LA 3NWSA 3F2UA 2B2UA 3RSWA 5H9AA 4Y7NB 4H44C 2ZAIA 2JP1A 4HN7A 4IFDH 4RUUA 4ZUIA 2FTBA 3C46A 1SNOA 4QGXA 2DNCA 1HFNA 1HA5A 3TZSA 3A8KE 4ZJ0A 1U4LA 1Q12A 1X8NA 4ZUJA 5A2QL 3Q24A 4LAAA 2JW1A 1SJED 4FNFA 1SXYA 2F0NA 1W6KA 5T1IA 3GAQA 2W2FA 5LL6X 3O2YA 1D5XC 2Q8IB 5I2YA 5L8OA 5JVH3 2LBVA 1NR2A 3WJCA 3OIQA 4WFUA 2PZTA 3BZDB 2H1EA 1Y69U 5BN5A 2JOZA 2BHVA 5F6ZA 2X8FA 2BA1A 2AH7X 5C5MA 5LJDA 1YWCA 2JA8B 3WJFA 1BSQA 3HP3A 4K14A 2F4IA 1B3AA 3S1MB 2XN9C 1SY1A 2RN4A 2CW0C 1DD2A 2XRSD 4KK7A 4TNNA 1HPCA 2MUYA 3GD7A 1RTNA 2FLJA 3BDLA 2EVBA 3TSSA 1Y8NB 4OGQC 2EJMA 3CHBD 1HBQA 4RCOA 4AZRA 5C3WA 3CKIB 2F03A 4TLJA 4ME5A 3NADA 2HQEA 1U4MA 1A6XA 1E0BA 1SY0A 5I6YA 4TQUS 1PMPA 3WDNA 4DFAA 1ET9A 1AFPA 5FFHA 2KEEA 4NYRA 3TP7A 1IW7C 3KFFA 3U0DA 4QNIA 1FGBD 3K5LA 4PMWA 4WHIA 4X3UA 2GC9A 4XQNA 2CVRA 1I4UA 4KKSA 1G8ZD 2ACOA 4C3HG 1HTLD 3VE2A 1DZKA 2K04A 2FR3A 5HA0A 3IAYA 2QOSC 2JMBA 3ELZA 1UNSA 1GKAB 3SE0A 3ZW2A 2QKIC 1JE4A 4MVEA 3NPOA 1YP6A 1PZID 2DY8A 4KC8A 3E6ZX 2F0QA 2RA6A 4A93B 3GV6A 1EQDA 5JJZA 3B2LA 2ACPX 1KNEA 4FF4A 1LLRD 4ZHHA 5IGDA 3CR6A 2BLGA 4ZH9A 4F8MA 3M85A 3NTIA 2QO5A 4ODGA 1LV9A 4IMOA 2JA5B 3JQOA 4OMWA 4WRDA 3NBXX 4HAEA 1IKEA 2LKKA 3I4NB 1GUNA 4C3IB 3VYUA 2Z8LA 5DG4A 5H9NA 2L1BA 2WSJA 3ZW0A 1O7YA 5ELBA 3GV3A 4MVLA 1D5ZC 1WTWA 2ANSA 5HGTA 1H9JA 1MGSA 1WTOA 4ZGUA 1L0YB 5LL6S 1D3SA 1YUPA 3ZUOA 2I46A 1LACA 3WOVA 3BVZA 4BS9A 2A13A 3FEWX 1TS5A 5CV4A 1KDBA 1SE2A 4UDUC 2PZWA 2F0HA 2Q8TA 3DWQA 1UAPA 1VCIA 1O7ZA 1ZXTA 4TQ2A 3EJIA 1FNVA 2EYJA 2BA0A 4RHSA 3STNA 5C6AA 5KRUA 1CBSA 2A6EC 2QEJC 4NLJA 5C3EB 1LTGD 1STAA 1V1OA 1MX8A 5ELCA 2RDFA 4EQAC 2NVXB 2KCNA 4FGIB 2D62A 1Q90A 3HOLA 3AB9A 1FELA 2Z4HA 1B56A 3FA6A 3R2TA 2B8GA 1KT3A 3HK1A 4Y0RA 4RA8A 5CV8A 3CWKA 2K23A 4QQ1A 5HCCC 3WJEA 3WBGA 2EE1A 5LJCA 1FNWA 2EY5A 2EYHA 1EIHA 5IO6A 2WQ9A 3FMZA 1CJ5A 3NHHA 2K32A 2A0AA 3U9OA 3KQ0A 1DYQA 4FVMA 5CYBA 2RQXA 2HZRA 1TU2B 4A3EB 3RZDB 5EEEA 2N88A 1DV9A 5M3FB 2A6HC 1JOQA 1WTXA 1TW4A 2ICEC 1P6PA 4U8UM 1EYDA 2MP1A 1EWCA 1JCKB 2ZT9C 2Z1CA 3KFHA 1E06A 1Z6HA 5F58A 3SK6A 3OMCA 1HTPA 4FP5D 2F0KA 3HOXB 2X6LA 1QY1A 2R3ZA 5EPKA 3OD9A 3CRLC 1U9RA 4EFGA 1G2TA 1PZKD 1DZMA 3WXQA 2W2AA 4CHTB 1BR9A 4FF3A 1FE3A 1EY8A 4EVOA 1LICA 1ZNDA 3S26A 1Z7TA 2PCFB 5JAVA 4B9XA 4PMCA 3TZUA 3VE1A 1FDQA 1PBOA 2F0OA 4NKLA 1BJ7A 4GE1A 2WR6A 1I4QA 4QZUA 1IKMA 2EYLA 2QILA 3I72A 1S7DA 4XMEA 4K2LA 4U68A 4FF1A 2WUTA 1EYCA 2JYOA 3H6MA 5BVQA 1O1VA 1OBQA 2W2BA 1LIDA 4ODDA 4QCLA 3A7AB 4GNWA 3PUXA 4IUTA 4I65A 4GK9A 1VF5C 1TVQA 4L63B 2FS7A 3D3RA 2L12A 3EA6A 5JPNC 2F3VA 4D6BA 4BY1B 3KK7A 2A68C 2K05A 3L4RA 1Q1EA 2F0VA 3PUVA 3NTKA 2FS6A 1TS4A 4HMJA 3MBTA 5KEEA 4RWSC 1BO0A 1Y1VB 2PW7A 4KKUA 2SDFA 1EY6A 3PPTA 4INNA 3D6WA 2AT3X 5HZ9A 2AMMX 4N7DA 5KHPA 1GUOA 3PH6A 3T51B 2WP8J 2PPBC 1ML7A 2EDGA 2IT1A 2RCQA 1LPJA 1GKAA 1HMRA 3G7XA 5FKAC 2FWVA 3FLLA 4XMHA 3WJBA 4XIGS 4XT1B 4BOEA 3I0AA 3P6GA 1KLUD 3ZZVA 5CV6A 1SFOB 1BCPC 3VPJE 1KQWA 2XWBB 1F9PA 3ZYYX 1NUCA 1GJXA 2B2TC 1B9MA 2KCCA 3S5XA 5HZ6A 4Q5VA 5H9LA 1ESRA 2KQ3A 5DM63 5J1ZA 5FOBB 3U9PC 1BOSA 1IL8A 4EDEA 5EBCA 1QG5A 1SXUA 2BDNA 1CHPD 5HZ8A 1Y1WB 1SAPA 4ZHFA 3K7AB 2L67A 4NP5A 4YH0A 3QIAA 3T13A 2HMBA 1JJJA 2GTLN 4K5VA 3JAML 3I91A 1X3PA 1BF4A 4BY7B 1KT4A 1LKEA 3I90A 3NQ9A 4LZVA 1SNPA 1JICA 4K8JA 4FBOA 2L9CA 1HQMC 1FR3A 4CSBA 2K1BA 1YWAA 3X3MA 4YKMA 1LTID 1I04A 1IYUA 2HZQA 1KGLA 4HMIA 5C0NA 1STHA 4YDBA 1Q8IA 2DN8A 4FO2A 5D48A 1SY2A 5JPMC 3PV0A 3EBWA 4LKPA 1OEEA 3D96A 1PFMA 1SBBB 4DGZA 3PO2B 2A3FX 5D8JA 2PYKA 4TSSA 2ICIA 2EOTA 2EY2A 5FO8B 1QQSA 2MWHA 4KMUC 3P20A 1CZWA 3ERQA 2JEBI 3S2DB 4FYDA 1CBRA 1RBPA 2XIWA 2HNXA 5C4JB 2L4NA 3IKJA 5IOCA 2AT5X 4ID2A 3S17B 1QJOA 1SMYC 1X8PA 2XSTA 4ARHA 3ITPA 2D2CC 1ZRYA 1B44D 1EY7A 3SOTA 1WCMB 3H94A 3ND9A 3K57A 3CMPA 2HLVA 4TJZA 3A54A 2RCTA 3AKNA 5KNCA 4ML7B 1GHKA 1DZJA 3TGBA 4O3YA 2F09A 2QF7A 2A2UA 4CKEA 1XYIA 4K19A 1F2YA 3Q22A 5I9OA 1SXXA 3VA5A 3R2IA 1EXSA 1BRPA 1ERXA 2B2WC 4O3XB 4S3SA 2YU9B 4XQQA 2YYZA 1SYFA 1H9RA 1JOKA 3J81E 1S5ED 5I6WA 3ZUIA 5E4WC 4EXZA 3AU7A 5DNFA 4COTA 2V4DA 1ERBA 4CKBA 3DWAA 2E2DC 1TKWB 2AKQA 3HWGA 2EZVA 4H7BA 5H8TA 4F7XA 4G57A 4QAEA 3BY0A 1SDFA 1EYAA 5FLXL 3FRPB 3BVGA 1OXTA 1WTPA 3KZAA 4R0BA 2WB1B 3MVFA 2SOBA 1ZYRD 4I3CA 2WKDA 4H13C 1T5EA 3VG5A 2R92B 3LWEA 5IT9E 1GGLA 3NWTA 3SR1A 1S5FD 2KECA 1BLRA 4QGVA 5EGTA 1EOTA 3OOCA 3GTGB 1WTVA 2PQEA 4GNYA 1DM0B 5IODA 3BG3A 3QWNA 3A8JE 2JXMB 1TWFB 1R4PB 3HOYB 3LWUA 1KZXA 5I2XA 1TVXA 5NUCA 1A2UA 4ZLTF 2FJ2A 2SNSA 1DJRD 4C2MB 3K59A 5IGBA 4ZHDA 2L55A 1GOZA 2B2YA 1SYDA 2CM9A 2MJ8A 1II3A 4DN4M 4O3WA 3FVQA 2L5PA 5EPJA 1MVGA 2NB0A 4QMGA 1TOUA 1K8MA 2CZUA 2IX3A 4I9SA 4A3GB 4DU9A 1C4QA 5CR3A 2D9UA 2RSOA 1B4MA 4QF4A 2NNQA 3ZQ3A 5K36G 1NGLA 1JQYD 3FEKA 5C3XA 1LT5D 3C1EA 3QO2A 3D4DA 1ENAA 2LMCB 1KOIA 5LJGA 5DEHA 2BE5C 2K28A 4WFN3 3OE3A 3EMMA 3BDOA 2Q4NA 3SK5A 3IA8A 2EY6A 4M8AA 3HOEA 3NK9A 2B63B 3K58A 4XMGA 1ONLA 4TKHA 3BDRA 1F9SA 4U673 2LB6A 1PRTC 3CRKC 3MXUA 2A74C 3TP6A 4CK4A 3GP7A 3V2TA 5D14A 1WD1A 4IFDI 1J9OA 4XDXA 4GETA 2WV6D 4YFRA 2TSSA 4QYNA 1QG7A 1A15A 1OXVA 2KTSA 3AMUA 3NE5B 1NP4A 4KJNA 2JU7A 1YNND 1AQBA 1B53A 2HUGA 4RKBA 3QOLA 1ET6A 3HTYA 3APUA 3KBXA 1DF3A 1IFBA 3OIPA 4G7OC 2RDGA 4QYPA 2RVLA 4MHEA 5HA1A 2YG2A 1Y8OB 1QNKA 3TMEA 1B0OA 3NSWA 3H09A 1LIEA 1HBPA 5EDBA 3E5SA 2F0SA 3VR5A 2O5JC 4A1HA 4XQJA 1DOLA 3J80E 3S5VA 4TKOB 2IJ0A 4C3JG 5C5LA 3DTQA 3VU1A 2PW5A 3UEXA 5IIFA 4KH8A 4LKTA 1G6ZA 2CBRA 4OO1G 3QOJA 4KD4A 1JORA 4I3BA 1YWDA 2VB3X 2CW0D 5LKFA 3K6OA 4A3DB 3MVVA 3RBYA 3D6CA 3EBKA 2K03A 1S44A 5JOBA 1TY0A 2F0TA 4RUNA 4KTAA 1GHJA 4R8NA 2F0DA 4AYHA 1IFCA 3Q0AA 4J6HA 3BLGA 5HWZA 5D47A 4UU3A 4PMBA 1ZYRC 3MFGA 1KTKA 4BQUA 1DZPA 5EDCA 3D4RA 4YIJA 3M3YB 1KT5A 1H9KA 3K0YA 5LJEA 3FDTA 5HCDC 4OHJA 1ALBA 1PTOC 3HRZC 2J0TD 4K8IA 4ABNA 2IL8A 4C3IG 1TWHB 1S5CD 1OXXK 4ZAIA 2QM9A 1K83B 1CQFA 2NN6H 3FEPA 5F6BA 2F0IA 1EEFD 1G2SA 4TKBA 5A2QE 2O4XA 3O13A 3APVA 2JA6B 3VG6A 3TF6A 4KIIA 3ZWEA 1LTRD 2F0JA 3G7LA 1QB5D 1BCPB 1HRJA 1YNJD 1CT1D 4RHRA 4AYBB 1A2DA 4DA2A 4QB4A 4BA2I 3KLSX 4QUFA 2POAA 4O42A 1OEKA 1AZQA 3R93A 1ICMA 2P8GA 2NZ1D 1IKLA 2Q9SA 2A68D 4OL7A 3D31A 3APWA 2F0GA 2FFKB 5I4DA 1ZNKA 4OO1H 5CE4A 5EZ2A 1K8OA 1U4PA 1DZ1A 2KUMA 2NVTB 3RZYA 1V43A 1LTTD 4EQNA 3FW4A 2BE5D 1D6EC 1JWUD 4V190 1EEID 4HR7B 2Q2PA 1ZEQX 5L8NA 5JR8A 2WWPA 1BDOA 3DXJC 2R61A 1SNDA 1AVGI 3C1FA 1MD2D 2A73B 4NNSA 3D97A 1Q3LA 1A3VA 2HCCA 1XXGA 2EU7X 1OO9B 3TZDA 4FXDA 2CZTA 1ENCA 4RGTA 1VPRA 2M4LA 4YCEA 4ZQ3A 5AFWA 4I3DA 2E4JA 3N52A 4HCEA 2ZXRA 1LTSD 3FW5A 1R4QB 1F2LA 3JAME 5EEDA 1YP7A 1LIFA 2F0UA 3PUYA 1H9MA 3NUCA 2OVSA 1CZGA 1JC7A 5IGCA 3IFDA 3N91A 1EPBA 1WTRA 1CBQA 4FBVA 2L9HA 3E3CA 4JBWA 1GM6A 2KOLA 4DQ3A 2MHDA 3OWEB 1ENFA 5C4XB 4OS8A 4NP1A 3HOWB 1H9SA 3L7ZC 2E74C 1SA8A 1NSNS 2PMZB 2Q39A 3DM1A 4AW8A 3UEWA 2ALLX 2BCOA 1FD7D 2B39A 2Q8RE 4A1YA 1AB0A 1O80A 3NBIA 1H91A 3RD4A 5IGEA 1G91A 1L6MA 5IGGA 1VMCA 2XVSA 1JYJA 2K62A 1SEBD 2M2LA 4EQOA 2IFBA 2LFNA 2F0MA 1Z47A 4A3JB 4NLIA 2TMPA 1GUTA 4C3HB 3OW7A 1PMRA 1QFTA 3UEVA 5D65A 4TKJA 3M4YA 2MJIA 4M6SA 4YFPA 3H3IA 5KYIA 3B2IA 3VG2A 1KQXA 5KNDA 2R73A 1SNQA 2R6GA 4IURA 4U3QA 5BN4A 4F87A 1C48A 4O4OA 3SXHA 1TT2A 2FHTA 5BVSA 5FQ6E 1GT1A 4BBSB 1EFID 5J22A 1BUVT 1I6HB 4BWGB 3PUWA 4CV7A 1KT7A 2A69D 1HCZA 1PFNA 3T16A 1U0XA 3NX1A 5CC4A 2O62A 1BEBA 3FPUB 4QZTA 4O9SA 5D45A 2D5DA 3HOUB 1T0VA 4C56C 3K5OA 5L8IA 1FYCA 5HTDA 3NTHA 3FPPA 2EY1A 4Z9CB 1PEEA 1U4RA 2PZUA 5AJBA 1HQPA 4N7CA 1KXOA 2WINB 4EGVA 2A69C 3C78X 1DONA 2E76C 3VR3A 5EQ0A 5KIDA 3D8GA 2L11A 4XYQA 1WTQA 5HZ5A 3FELA 4L6TB 4IQZA 4FXGC 3FKIB 4DK0A 4ORRA 3HS0C 5HAEA 2AUJD 1O78A 3Q6LA 2MM3A 1V1PB 4QUCA 1YWBA 5G3LF 3PIO3 5COYA 1BCPD 4IUUA 2AUKA 3TP8A 1F2MA 4L1NA 5G3LD 2BOSA 3EROA 1J8IA 3WVMA 4DNTB 5E1FA 1IIUA 4MVKA 1EPAA 5KYLA 4XXEA 1BSYA 3BX7A 2SNMA 5FO7B 5C0XG 2G79A 4N9PA 5H9KA 1O7LA 2EXZA 2ID0A 4HFOA 4ZHCA 1B9NA 4K6DA 1RLBE 2G9HD 2BS5A 1QNUA 3P1HA 1A57A 3VG3A 4MN3A 3H0GB 3P6EA 3OJYC 3SEBA 2FMCA 1PDQA 1F2ZA 5IT9L 1FTPA 1UREA 1I06A 1Y8PB 4MVIA 3S9WA 4C3JB 1CQVA 1ILPA 4HSVA 4DNRB 4QGWA 5HTEA 4ZCBA 2KD2A 4FBRA 1T68X 3GTKB 3R3OA 2KT4B 1ILQA 3GTLB 1R9TB 2PY1A 3S60A 2RA4A 1UUPA 4RAUC 3FA8A 1CI3M 5FO9B 1QABE 2WEXA 4JGLA 3U9SA 5LHY1 1QILA 2E2IB 2WACA 5C44B 3P6CA 1I6VC 1SMYD 3MTSA 1I4HA 2K7VA 1BNZA 2HDMA 1EU4A 2IW3A 4AZMA 2DY7A 3S16B 3P02A 4GZYC 1RDPD 4DAPA 4Y0PA 1AP0A 2B2YC 4QRLA 2L0CA 2L68A 2K5QA 3BYTB 4ZKCB 1MUPA 1EI5A 4GKCA 4WBKA 1SE4A 3WJDA 5DM73 1LT4D 1MX7A 4NYQA 5E3FA 1PRTF 3DWPA 3KFIA 1PTOB 4IN3A 2AT0X 4ON1A 2F0EA 2F0PA 1PRTD 4KY5A 4X3TA 1DOMA 4NW4A 4ALBA 5JEAG 5C0XH 1Z24A 1EQTA 3J7AF 1I4PA 2NTSA 5EKKA 1F9QA 1MSHA 2L5TA 2FR2A 4MIRA 2R93B 4IZ8A 2M00A 2X6GA 5C4HA 1ZNGA 2BT9A 3BSZE 5DPQA 4XYOA 2NTTA 3TDQA 3FR4A 4YFQA 3LV4A 2O5IC 3I8ZA 3MEHA 4HTHA 1Y9TA 3J7YW 3G6JB 2EYMA 2CM4A 1GX8A 1A3UA 3ZI8A 1BQQT 4WORA 1SYBA 4E6IA 1DCZA 5M3MB 2GTFX 1KAAA 5F1EA 3LNNA 5C0XI 1S4ZA 2RBMA 4YDAA 2X45A 4CJ1B 5C0XJ 4MISA 2GTLM 2N93A 1CK1A 2Q2MA 1D1IA 3KLRA 3WOFA 4K2KA 1G7NA 2B2UC 3NP8A 2LFOA 3BDCA 3UI2A 2IWHA 4LQZA 2KEDA 1BSOA 4ORXA 3S1QB 1D2UA 5ISRA 2A6HD 3B2KA 5F7GA 1DOKA 3SAOA 4PSQA 2EPBA 1EU3A 1SXTA 3CQZB 2X46A 3BRNA 4ES7A 3OPOA 1HN2A 3NQKA 5B27A 3J80L 2KJXA 4GDZA 5CV7A 2MO5A 2E2HB 3UAQA 3NQTA 1EIIA 1VDZA 4FQBB 2DNEA 1TWGB 2VB2X 4N9TA 1M8AA 3HZXA 4PNYA 2IPKD 2JU8A 2DM5A 4D6AA 4O49A 4GZVA 3WOEA 5M9OA 1GT5A 2YMSA 2B2VC 1SMPI 1TR5A 3O22A 2K5DA 5EBDA 1RJTA 2E75C 4C1NK 5EKLA 4O1NA 1MSGA 1S5BD 1AN8A 3ONAB 5EJWA 5ELDA 4AZNA 4CBVA 1HQRD 3HWFA 4ORUA 1FENA 1JIWI 4IAXA 1AZPA 4GU8A 1OBPA 5JEAJ 4O4UA 1E2WA 3NP1A 3MA2B 2HCIA 3STKA 3PQSA 3KUPA 1D5MC 1MBYA 3NX2A 4R8IA 3N6RA 3K5MA 4PQXA 3ND8A 2GA4B 1O8VA 5BN3A 4BBRB 5LKEA 3DHQA 3DUZA 4G7HC 5A35A 3AKMA 1LIBA 4KKTA 2AWNA 4OO1I 4GRJA 3U03A 5AEOA 4IUQA 5JEAH 4CGYB 4H0LC 3I4MB 4KC7A 3VYSA 2F0WA 3I4LA 3I70A 3T53B 2WEWA 5B29A 1ZNHA 5D4AA 1CRBA 3V96A 1OBUA 2G7BA 1H9SB 2EYOA 1YNNC 2RQ0A 2N55A 4DQ4A 4XMDA 3T1DA 1ACDA 4OIKA 1V8QA 2EYPA 1EL0A 3OSOA 1I3QB 1A2TA 4RKLA 3QKGA 4DXFA 2NUCA 1CA6A 2J4XA 4JK1C 1TIID 4KN4C 1PZJD 2QDBA 4XTCS 3BS2A 3RMHA 1KLGD 3K3LA 1QY0A 4K5XA 5FAZA 1U17A 4IFDG 2LS01 5TSSA 3MZ5A 4KV6A 3DEOA 2WQAE 5EPLA 2LY7A 2WIIB 1B8EA 4M1UB 1E5PA 2J7ZA 3H3VC 1I4RA 2NN6I 1XX8A 4ALOA 1STGA 1CFMA 3NR3A 3CU7A 3L9AX 1B50A 3HOVB 1VYGA 3PP6A 1X32A 2NBFA 4WJWA 2AQ3B 1DC9A 1QY2A 1HHVA 4IB9A 1HUMA 1QWYA 1SYGA 3SHLA 2RDHA 1BBPA 2B2WA 2JSOA 3SK8A 3KLSA 2OVEA 3EM0A 1EY9A 1RCVD 4IUPA 2FT9A 1EW3A 4J8QA 2PO4A 5K5PA 3BYYB 1GUGA 3KFGA 4OS3A 5FQ7E 4M7MA 5HCEC 1HXYD 4OIJA 2C5CA 4DAYA 3B2JA 3GTQB 5IGFA 4XMFA 4I95A 2XWJB 1RTOA 5EKIA 1QOHA 1RKNA 1ZKOA 4IUNA 2JA7B 5CORA 2G9DA 2IX1A 1OPAA 2JEAI 1KZWA 2R74A 1FEMA 4I7ZC 5AJCA 1F77A 1RF2D 4OMXA 3JS1A 4YGGA 4ORWA 2NVQB 4IB7A 4A3IB 3S1RB 5LJKA 2F0FA 5FK9C 5T1GA 3I3CA 4DAVA 1HMSA 1LTAD 2PNRC 1SXWA 1JR0D 3GO5A 2LA7A 4EEJA 3TGCA 1G74A 4I9RA 2HDLA 1JB3A 3C2PA 1GUSA 3HOZB 2FMMA 3VYTA 4A3MB 3M4OB 3DEPA 1TOWA 2GTLO 3EVQA 3P75A 4I6SA 4YBPA 2R56A 4RGNA 2QMIA 4Y0QA 1MI2A 2XNAC 1U18A 2JU3A 4ZKBB 1KDAA 4V0BA 3S1NB 3JSQA 3FENA 1ML0D 1GXAA 1PM1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6H A;  2DNC A;  3FMC A;  3M85 A;  3A8K E;  1TKW B;  3CRK C;  3MXU A;  4JBW A;  4BA1 I;  1Q12 A;  1YNJ C;  4IQZ A;  1HTP A;  2E75 C;  1OXX K;  4KHZ A;  4DK0 A;  1E2Z A;  2EJF C;  4LJZ C;  2AUJ D;  1GUN A;  1O78 A;  3QIA A;  2NN6 H;  1OXT A;  3CRL C;  1H9S A;  3L7Z C;  2E74 C;  1OXV A;  1DXM A;  1OXU A;  2Q8I B;  2F1M A;  1CTM A;  2KA7 A;  3VR2 A;  3NE5 B;  4H13 C;  1T5E A;  3VR6 A;  1Y69 U;  1E2W A;  1H9J A;  5BN5 A;  5K36 H;  2AUK A;  5JEA G;  5C0X H;  2BA1 A;  3I73 A;  3VR4 A;  3N6R A;  1HQM C;  1GUG A;  1Z7T A;  4DNT B;  1FR3 A;  1LAC A;  2PCF B;  2L5T A;  4G7O C;  5KNB A;  3ND8 A;  3OOC A;  3TZU A;  4L8J A;  5BN3 A;  1IYU A;  3BG3 A;  2JE6 I;  3A8J E;  5C0X G;  1Y8O B;  2JXM B;  4G7H C;  2CW0 C;  4LK1 C;  5A35 A;  1VCI A;  2K33 A;  2O5I C;  4BA2 I;  1IYV A;  1O7L A;  2DN8 A;  3EQL C;  3SDZ A;  3I72 A;  3LWU A;  3PV0 A;  3MFY A;  4KKT A;  2BA0 A;  3RLF A;  1GUT A;  1B9N A;  1HPC A;  3GD7 A;  1ZKO A;  3OW7 A;  1DCZ A;  1G29 1;  1PMR A;  2B8F A;  2EVB A;  1Y8N B;  3M4Y A;  4KI0 A;  2A68 D;  2A6E C;  2EJM A;  3D31 A;  4OGQ C;  3VR5 A;  3A7A B;  3LNN A;  5JEA H;  2JEA I;  4KN7 C;  3PUX A;  4H0L C;  2O5J C;  4OO1 H;  3T53 B;  3I4L A;  4I7Z C;  1DD2 A;  4TKO B;  1VF5 C;  4KMU C;  3P20 A;  5KND A;  1K8O A;  2JEB I;  1OXS C;  2R6G A;  4PV1 C;  1A6X A;  1H9S B;  1EWH A;  2D62 A;  1YNN C;  4TQU S;  1V43 A;  5BN4 A;  3VA7 A;  3WDN A;  3KLR A;  1Y8P B;  3IKJ A;  1Q90 A;  1QJO A;  1SMY C;  2BE5 D;  2NN6 G;  3AB9 A;  4HR7 B;  1V8Q A;  3M7N A;  1IW7 C;  2D2C C;  1Q1B A;  2A68 C;  1Q1E A;  3H94 A;  3ND9 A;  4DNR B;  1LAB A;  3PUV A;  2B8G A;  1BDO A;  1VF7 A;  3DXJ C;  4DK1 A;  4OO1 G;  3QG1 A;  1K8M A;  3PUW A;  4JK1 C;  2A69 D;  2A6H D;  4RCN A;  5KNC A;  4KKU A;  4KKS A;  1HCZ A;  2PNR C;  4KN4 C;  1GHK A;  4XTC S;  2QF7 A;  2A6E D;  5K36 G;  2D5D A;  1GUO A;  1CI3 M;  3T51 B;  4G7Z C;  1GHJ A;  2K32 A;  3A8I E;  3OPO A;  2PPB C;  2EDG A;  3HGB A;  1FYC A;  2BDO A;  2IT1 A;  1GUS A;  3PUZ A;  3FPP A;  3SE0 A;  4IFD G;  3U9S A;  2AWO A;  1TU2 B;  2LMC B;  4XIG S;  2BE5 C;  1E2V A;  1VDZ A;  1ZYR C;  2DNE A;  1IW7 D;  2A69 C;  2A6H C;  3QJY A;  3T56 B;  2E76 C;  3D4R A;  3BDO A;  1I6V C;  2YYZ A;  3A7L A;  1H9R A;  3IFT A;  2K7V A;  1CFM A;  1GJX A;  3GQB A;  3PUY A;  4H44 C;  2EJG C;  1H9M A;  4IFD H;  1B9M A;  2KCC A;  3VR3 A;  2NN6 I;  1H9K A;  2ZT9 C;  2V4D A;  3W3A A;  4GZY C;  1ONL A; 
#chains in the Genus database with same CATH topology
 4A3C H;  1EZ8 A;  1EIY B;  4LF6 Q;  4X65 Q;  3PO3 B;  3Q34 A;  2GVA A;  4ORY A;  4JI5 Q;  4IMN A;  4BA1 I;  2ZXO A;  1Y53 X;  1EQV A;  2QO4 A;  4UU2 A;  1WJJ A;  1VQC A;  2ZTE A;  1D1K A;  1RHP A;  2HKD A;  3HOW H;  2O2L D;  4B9W A;  2JA5 H;  1G5W A;  3W2D A;  4DV4 L;  1DFV A;  3SLT A;  3P6F A;  4H02 A;  1ASZ A;  2E5L Q;  3I4N H;  2XGT A;  4TRD A;  3URY A;  4ZK9 B;  1DXM A;  4Z28 A;  2CFM A;  3HOV G;  5M5W B;  1WUB A;  4AZP A;  1X89 A;  2QCP X;  3P6H A;  1UE5 A;  1N32 Q;  1EIG A;  2OEO A;  1GT4 A;  4NW2 A;  4A3J H;  5HZQ A;  2UXC L;  1A3Y A;  2OWO A;  1SWP A;  1A18 A;  3BVM A;  5FLM H;  5IRW A;  3BZC A;  3KF8 A;  5KNB A;  3S16 H;  1T8V A;  1BBW A;  4POG A;  1HNW L;  2FKJ A;  1QZG A;  1LT3 D;  3VHH A;  4B08 A;  4QIW B;  2UUC L;  4DV3 L;  3PQU A;  1BM5 A;  3P24 A;  1IYV A;  3SZI A;  1S2P A;  1LTB D;  4O3Z A;  3MFY A;  3OWF A;  4BY7 G;  1JJC B;  3QB3 A;  3CC2 A;  3VG7 A;  2B8F A;  1JV4 A;  1I05 A;  4PJ2 A;  1NQM A;  4UAI A;  1WBI A;  1CA5 A;  2AQ2 B;  3CP0 A;  1PXU A;  4ILW A;  5D3I B;  1EZ6 A;  2QEX A;  3V05 A;  3SK4 A;  3RZO B;  5AQ6 A;  1I4G A;  2KVM A;  2A2G A;  3S2H B;  3CBS A;  3ZW1 A;  1FJG Q;  3KYH C;  1MK5 A;  1X71 A;  1YJN A;  3CCV A;  2BSZ A;  2OXP A;  4Y7N H;  3IFB A;  4P73 A;  5LJH A;  1Q1B A;  3AFP A;  2EQS A;  4HPA A;  1LAB A;  2D0P A;  5L37 A;  4A3B H;  1N0S A;  3WJG A;  2XKL A;  3GTO H;  1XTD A;  2A5H A;  2AT8 X;  5DAU A;  3I4M G;  2UXC Q;  4CDF C;  4AZQ A;  3HOU H;  5HUR A;  4R9W A;  3B2H A;  4B3M Q;  2JA6 H;  3J7A V;  1S5D D;  4NXN Q;  4CPH A;  1CKM A;  3R8B A;  2SEB D;  4BY7 H;  4G7Z C;  1C8C A;  1JOO A;  3A8I E;  4YCU A;  1YIV A;  2UUC Q;  2VQF L;  1FNU A;  5I9P A;  5IP9 H;  5IYB G;  3PMF A;  1EUO A;  1SWF A;  3APX A;  3KBG A;  1EY0 A;  4HPC A;  1G85 A;  3V8U A;  4B55 A;  5BVT A;  1E00 A;  2F52 A;  1VWF B;  1STB A;  1STN A;  4RGM A;  2XRQ D;  2MGS A;  3BS1 A;  1ZNE A;  1LF7 A;  1M4V A;  1K0S A;  4L3R A;  1CBI A;  1GX9 A;  1RST B;  1SNC A;  4B3R Q;  5CYU A;  3MXG A;  2F4V L;  1PYW D;  4X3K A;  5M3F H;  1MEP A;  3F6Z B;  4CKC A;  3QR8 A;  3W3A A;  1TWA B;  3TRE A;  3TRZ A;  4HSP A;  2WB1 E;  4A3B B;  2OVA A;  5JVG 3;  4A3E H;  3FMC A;  3RZD H;  1I94 L;  2P5Z X;  1IHZ A;  4EQ5 A;  3GTO B;  2ZAG A;  1SE3 A;  5EPQ A;  3D95 A;  2YTY A;  2YTV A;  4ORS A;  4LZU A;  4KHZ A;  4CJ0 B;  3FYF A;  1VQA A;  4J1M A;  1PRT B;  1IW2 A;  1SWL A;  2QGQ A;  4DUY Q;  4B3T L;  1SY3 A;  4OS0 A;  1NAP A;  1OXU A;  1CTM A;  1K28 A;  2KA7 A;  3DMU A;  5IYB H;  4FF2 A;  3VR2 A;  1STY A;  4A75 A;  1HMT A;  1GXD C;  1EIO A;  1NR4 A;  2VFC A;  2OQ0 A;  2HYS A;  3MHB A;  4HIO A;  1AW7 A;  2OVD A;  4U8U N;  5M5X B;  4IFD J;  2F3W A;  2FHL A;  1VQE A;  1JBH A;  5CMD A;  2F0L A;  1ROD A;  4DR3 Q;  4LW1 A;  1CHQ D;  1AEL A;  4DV0 Q;  4JI6 Q;  3EYC A;  5CBE E;  1V1Q A;  3PIO A;  4L8J A;  4UHV A;  2HD3 A;  4GJS A;  1RD9 D;  3H91 A;  2OFB A;  1VQ7 A;  3RE6 A;  1ESF A;  3CQR A;  1JJ2 A;  2JE6 I;  1Y9L A;  4KT5 A;  1V1P A;  2RTH B;  4LK1 C;  3HWD A;  3NEL A;  3NBH A;  3EQL C;  3SDZ A;  5KIX A;  4O2D A;  1ICN A;  3RLF A;  1R0U A;  3GTJ B;  3F9D A;  4JO6 A;  1G29 1;  4QY7 A;  5LJB A;  4O4S A;  1TS3 A;  4DV2 Q;  2NVY B;  4KJO A;  1ADL A;  4DR1 Q;  4KN7 C;  1PH9 A;  3TN2 A;  2B2V A;  2VXW A;  1QWD A;  2MHV A;  2NWG A;  4X6A H;  5CBA E;  3S14 B;  3KF8 B;  4PV1 C;  3X3N A;  3Q23 A;  4YGH A;  4HJ7 A;  4A8Z A;  1EY4 A;  1PFS A;  4IUV A;  4HPD A;  4HED A;  1LNM A;  2FRS A;  3VA7 A;  4KHV A;  4A93 H;  3OTO L;  2DJG C;  4DKA C;  2GJ5 A;  2MO1 A;  4YVB A;  3VG4 A;  2NN6 G;  1I50 B;  4WFV A;  1NP1 A;  3WWV A;  1B7Y B;  1IKJ A;  1I4X A;  4DR1 L;  1WD0 A;  2VUM H;  2VUM G;  5ELE A;  1JJX A;  4YY3 Q;  2QO6 A;  1BWY A;  3KJP A;  3PDF A;  1L1O A;  1K8A C;  1JZU A;  3CCQ A;  4EQP A;  2K6A A;  4JI6 L;  2N78 A;  2RTF B;  4NDX A;  4DXG A;  3TS2 A;  3GTJ H;  1Y0G A;  3GTG H;  4YCH A;  4LUO A;  3LX0 A;  1KRT A;  1TXL A;  4HWM A;  2BDO A;  1NTG A;  2OFR X;  2K01 A;  5E4X A;  2Z6B A;  1TXY A;  4JPB W;  1Y1V H;  3A0J A;  2BS6 A;  2AWO A;  1JWS D;  4GH7 A;  4ZFX A;  1XTC D;  3VHM A;  3CPF A;  2K5W A;  5CV9 A;  1XWE A;  1PFB A;  2MO0 A;  3IFT A;  1F9R A;  1B4O A;  5IP7 H;  3GQB A;  2CQA A;  1VWA B;  4IB8 A;  1L1O B;  4IAB A;  5C4Z A;  1MDC A;  3CPW A;  4U8U O;  5CV5 A;  4KD3 A;  2RD7 C;  3FIQ A;  1X8Q A;  1SYE A;  4BBS G;  4ZR2 A;  2OF1 A;  3MAQ A;  3I17 A;  2X8T A;  4DR6 L;  1HA6 A;  1K83 H;  4IB6 A;  1YNJ C;  3NPP A;  3RY1 A;  3HWE A;  3GTM B;  1JYD A;  4DV7 L;  3EC5 A;  2Q2I A;  3LHN A;  1XPU A;  4LJZ C;  4ZYS A;  1QE6 A;  2ZJQ A;  1KT6 A;  4ZH6 A;  1VWE B;  2NYZ D;  4FXK C;  3STB D;  2LSS A;  3EFX D;  4DR4 Q;  4F88 A;  3RKG A;  1LO5 D;  2Z6K C;  3OMG A;  1L1O C;  1EWI A;  4BBO A;  2EYF A;  2RSN A;  1PBY A;  5D3D A;  4U9C A;  3VR6 A;  4DF7 A;  5GAE C;  1QCB D;  5K36 H;  2Y0S E;  2Y3F A;  3VR4 A;  5F2D A;  3MX7 A;  3PEC A;  2WAQ B;  2OT2 A;  3CBC A;  2OFM X;  3OHX C;  4JI3 L;  3TP5 A;  2MFI A;  4HJA A;  1YJW A;  4CJ2 C;  1N33 L;  1SJH D;  2R7Z G;  2K33 A;  3K81 C;  2M9V A;  1VQN A;  3D4W A;  5IO7 A;  1HNZ Q;  1EY5 A;  3SZH A;  3A56 A;  3O19 A;  1X3Q A;  1FGU A;  4KI0 A;  3P6D A;  1TWC B;  3ELX A;  1GUW A;  2VQF Q;  2B2T A;  4DAY B;  4K6L A;  2LBA A;  3VYR A;  3F8A A;  1E1O A;  1VWM B;  4A3F B;  1OXS C;  2X8S A;  3TGA A;  2OZQ A;  1MJC A;  1B2T A;  3GDE A;  1W5R A;  4ZHG A;  1SWJ A;  2MPM A;  3JAM c;  2H4O A;  1PH6 A;  5FLX E;  5ELF A;  5C4J H;  3M7N A;  3GE2 A;  4CPI A;  1BXT A;  2XSC A;  1BRQ A;  1SSO A;  1HFG A;  4DK1 A;  1LEL A;  3RWX A;  4BCS A;  4ID2 A;  5FEN A;  2KTD A;  3M7G A;  2K75 A;  3BX8 A;  2Y0S B;  1E02 A;  3H0G G;  3HG9 A;  1SYC A;  4A60 A;  1TS2 A;  5KGU A;  2OY1 O;  2NNE A;  1N34 L;  4IBA A;  5FJ8 H;  4CPH B;  2IX0 A;  4ZRZ A;  1RIP A;  4JI1 L;  4YBU A;  2FIN B;  3T2X A;  2CHB D;  3C76 X;  3HGB A;  2DJF A;  3D0F A;  1LYL A;  5FQ8 E;  3HKZ B;  3PUZ A;  2I07 B;  4OON A;  1S72 A;  4MNO A;  2KCT A;  3BU9 A;  4Q0F A;  4MIU A;  4YGZ A;  2A1A A;  3HEJ A;  4C1N I;  4GN4 B;  1JWM D;  1QFV A;  3J80 i;  3C77 X;  1IW7 D;  3T56 B;  2A8V A;  2ASN X;  1OPB A;  1X3G A;  3CW2 C;  4EX5 A;  3CCJ A;  2PI3 O;  2EJG C;  3ZW1 B;  4KCA A;  4JNJ A;  4IAL A;  4NMZ A;  3DM3 A;  1GT3 A;  4GNX B;  4RGO S;  3UDG A;  4ID6 A;  3UE0 A;  2RKS A;  1OEJ A;  3A55 A;  2E2J B;  3MC0 B;  1B1Z A;  3PIP 3;  4X64 L;  1SRH A;  4GOP C;  5FLM G;  5B5F A;  1KDC A;  2WKC A;  5IO5 A;  2AQ1 B;  1PLF A;  5M5Y B;  2B29 A;  4LF8 L;  1E2Z A;  2EJF C;  3FA7 A;  3S15 B;  1XMO Q;  4ZGF A;  3NXW A;  4IAW A;  5BYP A;  3BU1 A;  3T2W A;  3VHI A;  3F8T A;  2F73 A;  3L0O A;  2F1M A;  1W6J A;  1HUN A;  4IOC A;  5K06 A;  1TQO A;  1K9M C;  1XNQ Q;  4ULL A;  2ENB A;  2Z9H A;  2GN5 A;  4LFA Q;  5JJI A;  4AZO A;  3GTK H;  4YMY A;  1SNM A;  4X3S A;  4JI8 L;  1N9W A;  1NCV A;  2X69 A;  1STE A;  3I73 A;  1X9N A;  1VWQ B;  4O4X A;  4RH6 A;  1SWK A;  1O1U A;  1X8U A;  2C1Q A;  5IE8 A;  3TBI B;  3HKZ G;  1CM9 A;  1HR0 L;  3UEU A;  1EAL A;  1X65 A;  3Q6S A;  1ZNL A;  5J39 A;  3GTP B;  2G78 A;  1A62 A;  2ZXP A;  4JI5 L;  2E2J H;  1LFO A;  1XCA A;  2UZ2 A;  5GAG C;  4LMQ D;  3STM X;  4JC0 A;  3MXP A;  4DV2 L;  3NQI A;  3P7J A;  1WVL A;  4BVM A;  3ZW0 B;  3HOU G;  1LCV A;  3NQ3 A;  3PED A;  2LKV A;  2AF5 A;  3PH5 A;  4Z2P A;  1UEA B;  3SVM A;  4XMC A;  2NND A;  4P2C B;  3E0J A;  3S24 A;  3C3L A;  3L3O C;  1X8O A;  1HR0 Q;  1CSP A;  2VUM B;  3OBL A;  3FR5 A;  3T4A C;  4AH6 A;  1KD1 C;  1BCP F;  1EWH A;  1ICW A;  3EIV A;  4G4K A;  4K5W A;  2KHS A;  2VNU D;  1T5X D;  1E24 A;  5HBS A;  4RFB A;  2CBS A;  1KRS A;  1GVP A;  3MWY W;  3IL8 A;  1I6H H;  3FR2 A;  2C35 B;  3W1B A;  1VF7 A;  3MXN A;  3J81 L;  1PTO F;  3QG1 A;  4CDD A;  2KHI A;  4KY7 A;  4JI2 L;  1NMF A;  1A3T A;  1KAB A;  5GQO A;  3PO3 G;  4Y0S A;  4LNQ A;  3WYQ A;  4XT3 B;  1PTO H;  4RCN A;  2NVX H;  1AEX A;  2WAQ E;  2NP1 A;  1KHI A;  2RTN B;  1PTO D;  1NBX A;  5KIC A;  1KAW A;  2A6E D;  4YKO A;  1XKI A;  3WYP A;  1DGS A;  1L0X B;  2JN3 A;  4HCS A;  2R7Z B;  3CQN A;  4NNT A;  3K5N A;  2FHN X;  4A3K B;  2KW1 A;  3RUZ A;  3K7U C;  4KY6 A;  1XNR Q;  2Z4I A;  2D0O A;  3FA9 A;  2AL0 X;  1UZ2 X;  1VYF A;  3HOZ G;  1W4T A;  4JVZ A;  1VMP A;  1E2V A;  1BBX C;  2IZD B;  3DSZ A;  4HPB A;  1PH4 A;  1D2B A;  2OF9 A;  3QJY A;  1LT6 D;  5CGK A;  1KNA A;  1TY2 A;  2C9O A;  2AT6 X;  4NXN L;  3NWS A;  3A7L A;  3F2U A;  1LCW A;  2B2U A;  4ZCK A;  3RSW A;  5H9A A;  4Y7N B;  4H44 C;  2A5B A;  2ZAI A;  2JP1 A;  4HN7 A;  4IPD A;  4IFD H;  4RUU A;  4P71 A;  3TEH B;  4A3D G;  4ZUI A;  4X62 Q;  2FTB A;  3C46 A;  3I55 A;  1SNO A;  4QGX A;  2NVT H;  5L8O A;  2DNC A;  1PYS B;  3SZJ A;  3SLJ A;  1HFN A;  2ZTD A;  1HA5 A;  1HNX L;  1STR B;  3TZS A;  2RTJ A;  3A8K E;  4ZJ0 A;  1U4L A;  2JJQ A;  1Q12 A;  1X8N A;  4ZUJ A;  5A2Q L;  3Q24 A;  4LAA A;  4MEE A;  3A5U A;  1SJE D;  4FNF A;  1SXY A;  2F0N A;  2JW1 A;  1W6K A;  1GX3 A;  5T1I A;  2VW9 A;  4NV7 A;  2X4M A;  3GAQ A;  2W2F A;  5LL6 X;  2CCZ A;  3O2Y A;  3KLW A;  1D5X C;  1UWV A;  2Q8I B;  5I2Y A;  3J7Z C;  5JVH 3;  1NR2 A;  2LBV A;  3OIQ A;  3WJC A;  4WFU A;  2PZT A;  3BZD B;  2H1E A;  3CKF A;  2DUD A;  1Y69 U;  5BN5 A;  2JOZ A;  2BHV A;  5F6Z A;  2X8F A;  2BA1 A;  1IBK L;  3LTW A;  2AH7 X;  5C5M A;  5LJD A;  1YWC A;  2JA8 B;  1HH2 P;  3WJF A;  2E2H H;  1BSQ A;  3HP3 A;  1TWA H;  2F4I A;  4JCV E;  4K14 A;  1B3A A;  1IXR A;  3S1M B;  2XN9 C;  1SY1 A;  2RN4 A;  4B3R L;  2CW0 C;  1DD2 A;  2XRS D;  4KK7 A;  3CD6 A;  1B8A A;  1VWN B;  4TNN A;  4LF7 Q;  1HPC A;  2MUY A;  3GD7 A;  1RTN A;  2FLJ A;  3BDL A;  2EVB A;  3TSS A;  1Y8N B;  4NB3 A;  4DV0 L;  4BX5 A;  4OGQ C;  2EJM A;  3CHB D;  1HBQ A;  4RCO A;  4AZR A;  5C3W A;  3CKI B;  2F03 A;  3S1R H;  4TLJ A;  4ME5 A;  3NAD A;  2HQE A;  1U4M A;  2N8N A;  1A6X A;  1LCZ A;  1E0B A;  1SY0 A;  5I6Y A;  4TQU S;  1PMP A;  1SLF B;  3WDN A;  4DFA A;  2NZH A;  1ET9 A;  1AFP A;  5FFH A;  2KEE A;  4NYR A;  3TP7 A;  4B3T Q;  1IW7 C;  3KFF A;  3U0D A;  4QNI A;  1FGB D;  3RNU A;  4C3J H;  3K5L A;  4PMW A;  4WHI A;  4CDC C;  5IP7 G;  4X3U A;  2GC9 A;  4GLV B;  4XQN A;  2CVR A;  1I4U A;  3M4O H;  2E5L L;  3FHW A;  4KKS A;  1G8Z D;  1BBU A;  2ACO A;  4C3H G;  1HTL D;  3VE2 A;  1DZK A;  2K04 A;  4JOI A;  5C44 G;  2FR3 A;  4IOA A;  4BX7 B;  5HA0 A;  3IAY A;  2QOS C;  2JMB A;  4PZ8 A;  1OSP O;  1PYB A;  3M4Q A;  3PF5 A;  3ELZ A;  1UNS A;  1GKA B;  3RR5 A;  2I5Z O;  3SE0 A;  3ZW2 A;  4X65 L;  4AQY Q;  4FDB A;  2QKI C;  1JE4 A;  1SRG A;  4GN3 B;  4DK6 C;  4MVE A;  4UP8 A;  3NPO A;  3CC4 A;  1YP6 A;  3LGJ A;  1PZI D;  2DY8 A;  4KC8 A;  3E6Z X;  2F0Q A;  2RA6 A;  3S1N H;  4A93 B;  3GV6 A;  1EQD A;  5JJZ A;  3B2L A;  3U50 C;  2ACP X;  1KNE A;  4FF4 A;  1LLR D;  4ZHH A;  1I78 A;  5IGD A;  5LMN Q;  2BLG A;  3TQY A;  3CR6 A;  4ZH9 A;  4F8M A;  3M85 A;  2OYB O;  1Q46 A;  3NTI A;  2QO5 A;  4ODG A;  4GLA C;  1LV9 A;  1SFO H;  2JN4 A;  4LFC Q;  2C4I A;  3WZP A;  4IMO A;  1XMO L;  2JA5 B;  3JQO A;  4OMW A;  1FJ1 E;  4WRD A;  3NBX X;  4CDC A;  4HAE A;  1IKE A;  1KL5 A;  2LKK A;  3I4N B;  1RSU B;  2OY5 O;  1GUN A;  4C3I B;  2Y32 A;  3VYU A;  2Z8L A;  5DG4 A;  5H9N A;  1MJE A;  2L1B A;  2WSJ A;  3ZW0 A;  4GNX C;  1O7Y A;  5ELB A;  3GV3 A;  1Y55 X;  4MVL A;  1D5Z C;  1WTW A;  2ANS A;  1X6O A;  1V9P A;  5HGT A;  1H9J A;  1MGS A;  1WTO A;  1RXJ A;  3J81 c;  4ZGU A;  4QJF A;  2CWP A;  3KDF A;  1L0Y B;  5LL6 S;  4EKV A;  1D3S A;  1YUP A;  3ZUO A;  2I46 A;  1LAC A;  3WOV A;  3BVZ A;  4BS9 A;  2A13 A;  3FEW X;  1TS5 A;  2UUB L;  5CV4 A;  1KDB A;  1SE2 A;  1X54 A;  2PZW A;  4UDU C;  2F0H A;  3J7A 5;  2Q8T A;  3DWQ A;  1UAP A;  4BBR G;  1VCI A;  1O7Z A;  1ZXT A;  4TQ2 A;  3EJI A;  1FNV A;  2EYJ A;  2BA0 A;  4RHS A;  1K24 A;  1YHB A;  5EAY A;  2IZG B;  5JD2 A;  3J81 j;  3STN A;  5C6A A;  1NJI C;  5KRU A;  1CBS A;  2A6E C;  1LUZ A;  2QEJ C;  4NLJ A;  1STA A;  1LTG D;  5C3E B;  1XNR L;  2CH4 W;  1SRE A;  3CME A;  1V1O A;  1MX8 A;  5ELC A;  1CKO A;  2I5M X;  2RDF A;  2FKG A;  4EQA C;  2NVX B;  2KCN A;  3F2B A;  4FGI B;  2D62 A;  4A3I G;  4JG2 A;  3T1Y Q;  1MM9 A;  1Q90 A;  1UE1 A;  3HOL A;  3UDF A;  3EN2 A;  1G51 A;  3AB9 A;  1FEL A;  2Z4H A;  1B56 A;  3FA6 A;  2R7Z H;  3R2T A;  2B8G A;  1YNX A;  2ZJP A;  1KT3 A;  3HK1 A;  4Y0R A;  4RA8 A;  5B5G A;  5CV8 A;  3CWK A;  2K23 A;  3S1Q H;  4DUY L;  1PHJ A;  4QQ1 A;  1Q86 C;  5HCC C;  3WJE A;  3WBG A;  3S17 H;  2EE1 A;  5LJC A;  1FNW A;  2F4V Q;  2EY5 A;  2JA7 G;  2EYH A;  1EIH A;  5IO6 A;  2WQ9 A;  3FMZ A;  3CCL A;  5IWA Q;  1CJ5 A;  3NHH A;  4MTK A;  2K32 A;  2A0A A;  4AYB G;  3U9O A;  1O7I A;  3KQ0 A;  1DYQ A;  3T1H L;  2HHH Q;  4FVM A;  1BVS A;  1NQN A;  4GD9 A;  5CYB A;  4IJL A;  5C3E H;  2RQX A;  2HZR A;  4R4T A;  1K3B C;  1TU2 B;  4LF9 L;  4A3E B;  3RZD B;  3F1Z A;  5EEE A;  1E22 A;  2OY8 A;  5B2A O;  5JJL A;  2N88 A;  1DV9 A;  2A6H C;  5M3F B;  1JOQ A;  1WTX A;  1TW4 A;  2ICE C;  1P6P A;  4U8U M;  1EYD A;  2UYW A;  2MP1 A;  1EWC A;  4RMF A;  1JCK B;  2ZT9 C;  2Z1C A;  3KFH A;  3A74 A;  1E06 A;  1Z6H A;  4YWM A;  1PTS A;  5F58 A;  2IZK A;  3VGW A;  2Q2U A;  4PZ7 A;  2NVQ H;  1MHW C;  3SK6 A;  3OMC A;  1HTP A;  2K5H A;  1HXZ A;  4FP5 D;  2F0K A;  3HOX B;  1SWU A;  2X6L A;  1QY1 A;  2R3Z A;  2PMZ E;  2OQK A;  5EPK A;  3PSI A;  3OD9 A;  3CRL C;  4GUZ A;  3B6Y A;  1U9R A;  4EFG A;  5C4X H;  1G2T A;  4Z2V A;  1PZK D;  1DZM A;  3WXQ A;  1KC8 C;  2W2A A;  4CHT B;  1BR9 A;  2B63 G;  3L2P A;  4FF3 A;  2VZA A;  3U4Z A;  1FE3 A;  4BJ8 A;  1EY8 A;  4EVO A;  1LIC A;  1ZND A;  3S26 A;  1Z7T A;  1RAV A;  2PCF B;  5JAV A;  4B9X A;  4PMC A;  3TZU A;  5HGQ A;  4QGU A;  4A3M G;  4A3M H;  2F0O A;  1IL2 A;  1FDQ A;  1PBO A;  3VE1 A;  4NKL A;  1BJ7 A;  2G8C O;  4GE1 A;  1N8R C;  2WR6 A;  1I4Q A;  4QZU A;  1IKM A;  4A3D H;  2EYL A;  2QIL A;  3I72 A;  1HY2 A;  1S7D A;  4XME A;  4K2L A;  2GVB A;  4U68 A;  1Q7Y C;  4FF1 A;  2WUT A;  1EYC A;  2JYO A;  1XMQ L;  3H6M A;  5BVQ A;  1O1V A;  1OBQ A;  1SWN A;  2W2B A;  3I4M H;  1PV4 A;  1LID A;  4ODD A;  4QCL A;  2IHF A;  3A7A B;  4GNW A;  3PUX A;  3S14 H;  4IUT A;  4YY3 L;  4I65 A;  3HOW G;  4GK9 A;  1VF5 C;  5FLX c;  4JBJ A;  1TVQ A;  4L63 B;  2BH2 A;  2FS7 A;  3D3R A;  2L12 A;  3EA6 A;  5JPN C;  2F3V A;  4D6B A;  3W1G A;  3E3X A;  3FDC A;  1HJP A;  3M3Y H;  4BY1 B;  1Y14 B;  3KK7 A;  2Z6K A;  1WYD A;  2A68 C;  2K05 A;  3L4R A;  1Q1E A;  2F0V A;  3PUV A;  3NTK A;  1HNW Q;  2ZTC A;  2FS6 A;  1TS4 A;  4HMJ A;  3MBT A;  5KEE A;  4RWS C;  3IRB A;  1BO0 A;  1Y1V B;  1JMC A;  1K73 C;  2PW7 A;  4KKU A;  3GTP H;  2SDF A;  1EY6 A;  3PPT A;  4INN A;  4LFC L;  1GM5 A;  3D6W A;  2KEN A;  2AT3 X;  2AMM X;  5HZ9 A;  4N7D A;  4OXP A;  5KHP A;  1GUO A;  3PH6 A;  4L5R C;  3T51 B;  3RLO A;  2WP8 J;  2PPB C;  1ML7 A;  4DV1 Q;  2EDG A;  2HIV A;  1PH5 A;  2IT1 A;  2L15 A;  1N36 L;  2RCQ A;  3TS0 A;  3MM0 A;  1LPJ A;  1VQM A;  1B70 B;  1GKA A;  1HMR A;  3G7X A;  5FKA C;  2FWV A;  3FLL A;  4XMH A;  3WJB A;  4XIG S;  4XT1 B;  2WFW A;  4BOE A;  3I0A A;  2LXK A;  1SRO A;  1JJU A;  1KLU