3D4RA

Crystal structure of a duf2118 family protein (mmp0046) from methanococcus maripaludis at 2.20 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
158
structure length
158
Chain Sequence
HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Domain of Unknown Function from the Pfam-B_34464 Family
publication title Crystal structure of Domain of Unknown Function from the Pfam-B_34464 Family (NP_987166.1) from Methanococcus maripaludis JJ (DSM 2067) at 2.20 A resolution
rcsb
source organism Methanococcus maripaludis
molecule tags Unknown function
total genus 24
structure length 158
sequence length 158
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09891 DUF2118 Uncharacterized protein conserved in archaea (DUF2118)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d4rA02
2.40.128.400 Mainly Beta Beta Barrel Lipocalin Lipocalin 3d4rA01
3U9SA 2B8FA 1HQMC 2EJGC 1Y8NB 2B8GA 1G291 1E2ZA 4L8JA 3FMCA 1OXSC 2K32A 2E76C 1ONLA 1OXTA 3PUWA 2PPBC 1OXUA 2D62A 2E75C 3MXUA 4TQUS 3VA7A 2A68D 1DCZA 2V4DA 1DXMA 5KNCA 4IFDG 3CRKC 2KCCA 3GQBA 3P20A 4KKUA 1VDZA 4HR7B 2A6EC 1CFMA 5K36G 4G7ZC 1IW7C 1CI3M 3D31A 1FYCA 3WDNA 4IQZA 1Q1EA 2A6HD 3PUVA 3A7LA 1E2WA 2DN8A 3I72A 1V43A 5C0XG 1A6XA 5BN3A 3PUXA 1K8OA 2A68C 2BA0A 3L7ZC 2KA7A 3OOCA 2AUKA 5KNDA 4BA1I 1GHKA 2D5DA 3CRLC 3N6RA 1OXXK 3M85A 3A8KE 2F1MA 3PUZA 2DNEA 1O78A 5JEAH 2IT1A 3MFYA 1GUTA 1IW7D 4KKSA 4BA2I 5KNBA 2LMCB 1VCIA 1Q1BA 3KLRA 3W3AA 3T51B 4XIGS 2O5JC 1LABA 2A6HC 2YYZA 2D2CC 4TKOB 4G7OC 3HGBA 4JBWA 5A35A 1T5EA 1VF7A 1VF5C 4I7ZC 1GUGA 4OGQC 4KHZA 1V8QA 4KN4C 2O5IC 1Z6HA 3ND9A 3DXJC 3LWUA 1Q12A 1TKWB 1GUNA 2NN6G 1GHJA 1SMYC 2EJFC 1YNNC 4H0LC 2QF7A 1HPCA 1BDOA 3QIAA 1EWHA 3VR3A 2BDOA 5BN5A 1H9KA 1DD2A 1B9MA 1Y8OB 1K8MA 2AUJD 3VR5A 4OO1G 3AB9A 3T56B 3OW7A 4JK1C 1FR3A 1Y8PB 3EQLC 3LNNA 1PMRA 4LJZC 1B9NA 1Y69U 1ZYRC 3T53B 4IFDH 1GUSA 1H9SA 2DNCA 3SDZA 3H94A 2NN6I 3PV0A 4H13C 4DNTB 2BA1A 5K36H 3SE0A 1GJXA 3M7NA 2PCFB 4DK1A 2A69C 1H9SB 1Q90A 2EDGA 1CTMA 4KN7C 5C0XH 4GZYC 1H9JA 3TZUA 2E74C 1GUOA 2EJMA 3IFTA 2PNRC 4LK1C 4XTCS 3A7AB 3RLFA 3VR6A 3I73A 2K7VA 2BE5D 3BDOA 3ND8A 4KMUC 2A69D 3A8JE 4OO1H 3NE5B 2K33A 2L5TA 2EVBA 2AWOA 1TU2B 2JXMB 3A8IE 5JEAG 3GD7A 1QJOA 3OPOA 1IYVA 2Q8IB 1Z7TA 3PUYA 4DNRB 2JE6I 3FPPA 4DK0A 1ZKOA 1LACA 3QJYA 4KKTA 5BN4A 2R6GA 2JEAI 3M4YA 3D4RA 4RCNA 3I4LA 1E2VA 1HTPA 3IKJA 1H9RA 2JEBI 2BE5C 4H44C 4PV1C 3VR4A 1I6VC 4G7HC 3VR2A 2ZT9C 3QG1A 1H9MA 1YNJC 2NN6H 2A6ED 1O7LA 1IYUA 2CW0C 1HCZA 3BG3A 1OXVA 4KI0A
chains in the Genus database with same CATH superfamily
3WJBA 2EJGC 1BOSA 3CR6A 2EE1A 3CCLA 2RTCB 4XXEA 1OXSC 2X8SA 2MFIA 1HFNA 1JZUA 4A60A 2RTIB 1GUWA 4ZHDA 1TWFH 3K81C 2MNAA 1NP1A 4QF4A 4DV4Q 1JMCA 3M4OB 4DAPA 4Z2VA 2L11A 3APXA 2NB0A 4X6AH 4OX9Q 4X66Q 1QZGA 2B2VA 2FR3A 1F2LA 5CV4A 2R92B 1PRTB 5BR8L 1RODA 1QY1A 1PBYA 3HWDA 4IPDA 3FPUB 4L5QA 1EYCA 3SAOA 1P16A 4LMQD 4IMOA 5C0NA 4K14A 1JOOA 3ULJA 2F1MA 4ZGFA 2G5LA 4AYHA 4TQ2A 4KHPQ 1PFBA 2O62A 4XMGA 4O3ZA 4LAAA 1TS2A 1JWMD 2M9VA 3CQZH 1D1KA 3WYPA 3GTPB 3KJPA 2IX3A 2VB2X 1X8UA 4C3HB 3HGBA 4P72A 4ZLTF 1KDBA 4Y7NH 3HOWB 3CCJA 5IGDA 4KHZA 4ZJ0A 3KFIA 2WEXA 1C9OA 3FHWA 3S2HH 4ZHGA 4V0BA 1N7YA 2WIIB 3QO2A 4ZUIA 3FRPB 1EY4A 2QF7A 1KZWA 2B63G 3H0GB 1GT3A 4JBKA 2CVRA 5DAUA 3Q0AA 4EKVA 2OVAA 2NVQH 3QR8A 5IWAL 2XKLA 2JA5H 1VQ5A 1NBXA 3JSQA 1GKHA 3F8AA 4JGLA 1XKIA 2AL0X 5IYDG 3H94A 4MTKA 2HLVA 2Q2TA 3PO3H 5KGUA 1N0SA 1KAWA 4C3IB 5B29A 1HMRA 2OT2A 2VQEL 2RTQB 4UP8A 4AYBE 3C77X 3ZZVA 1WTPA 3T6FA 4ME5A 1AW7A 4AQYQ 1PBOA 2FTBA 3IFTA 1ZNHA 1QUQB 2K7VA 2OXPA 4GNXA 2B2UC 4K5WA 4UU3A 1EI5A 3W1BA 4ZHFA 4NP1A 3MC0B 4YY3L 3R3OA 2KQ3A 2Z6KA 1Q82C 3A0JA 2A0AA 2QOMA 1HA5A 5GAEC 1IYVA 3OPOA 1SXTA 1EXSA 1T9HA 4ZHCA 3VPJE 5F6BA 1XTDA 3PUYA 3PDFA 1HNXL 4NMZA 2AQ3B 1GM5A 2CM9A 3RZOB 2BE5C 4H44C 2WWPA 1U0XA 1FL0A 4CJ2C 5G3LF 4QGXA 1SREA 3R2IA 3SLOA 3C1EA 4ZQ3A 5F58A 4K6LA 3AU7A 4JBMA 2NN6H 3S1RB 1K8AC 4PMCA 3PIP3 1ASZA 3ER0A 4YHHQ 1XYIA 1KNAA 4RAUC 2FGSA 1IFCA 2NUCA 1DC9A 4POFA 3ULPA 1VQDA 3G48A 5J1ZA 3SHLA 4DK6C 1EIYB 2VNUD 2X34A 1AZQA 1SRUA 1X8PA 1OXUA 2EY1A 3G7LA 4LFCL 1F2ZA 5DM63 4WFVA 5BVQA 4U673 1D3SA 4QGUA 1OEEA 3K80C 4FF1A 2N88A 1YEZA 3GQBA 3CCMA 3GAQA 4HR7B 1MOYA 4G7ZC 1VWBB 3MA2B 4XYOA 3ITPA 3Q23A 1VWGB 3WDNA 2K50A 3ZI8A 3HS0C 1MHWC 2ZTEA 3TBIB 2E2IH 3BU2A 1ALBA 1GKAA 1VWQB 3KF6A 5JEAJ 5K5PA 1LT5D 1JJCB 2L55A 1YZ6A 2UUBQ 3NK9A 3WWVA 1A15A 5AJ3Q 2G78A 2JU3A 2UYWA 2J7ZA 1WYDA 4H02A 4KKSA 3CKGA 4BA2I 5KNBA 1ILQA 2X8FA 5C4XB 3BLGA 1KZXA 4DAYA 2KOLA 3U03A 1EIGA 1T5EA 3KF8B 4OHJA 1NC9A 3TZDA 4XMHA 3BU1A 4BBSB 1AQBA 4OXPA 3ND9A 5D65A 3HOYH 4DR6L 1O1VA 1SWLA 4H7BA 3Q22A 4JI7Q 3GTMB 5I2XA 1Y1VB 2F4VL 2BDOA 1DD2A 1X55A 3HOLA 1STSB 3LX0A 4GN3B 4A3EB 3GTJB 1KL9A 5M5XB 1IBML 4IALA 1FR3A 3SK5A 5JVG3 5F6ZA 4JI3L 2NVTH 4TVAB 4D6AA 3OD9A 2IZIA 2R7DA 3Q6SA 1SMPI 4ZH6A 1G91A 4QNIA 4EQPA 2OF1A 4JI1L 1QB5D 4DUZQ 4DV2Q 2K5DA 3KDFB 2XTIA 5I9PA 1PFMA 4YWMA 4YWKA 4LFAL 1CSQA 1Y53X 4DV6Q 3PH5A 4G57A 4AYBG 1VWNB 4U68A 2UZ2A 2RTGB 1ZYRD 2OFAA 2IZGB 1KAAA 5EEDA 1TS4A 4MIRA 2GVBA 5B27A 5H9NA 1F9RA 1TIID 3WZNA 2HDLA 3I73A 3NTKA 1HNWL 3BS1A 1A2TA 1LM0A 2CWPA 1W4TA 2HCIA 4I3DA 5C3EG 4GNWA 4DNIA 5C5MA 4RGOS 1AH9A 2EVBA 1TWAH 1XTCD 3A8IE 3NBHA 3MXNB 4N8FA 2RTFB 4OIJA 1SLDB 2VL6A 4L5RC 1R4PB 3K57A 2N93A 2HQEA 2YG2A 4OELA 4DR2Q 2R6GA 3I4LA 3P6EA 1LTAD 1BO0A 1EQVA 1B50A 4BQUA 1KQXA 1WTHA 5EAYA 3VG2A 2QW7A 4C3JH 2IX0A 1ICMA 3NPOA 1W5RA 2XIWA 3U9PC 5D3IB 3KFGA 5D45A 3MBTA 4I9RA 1V1PB 2B8FA 2CQAA 4Z9CB 1HTLD 4J15A 1E2ZA 2W2BA 1BCPF 1ONLA 3H6MA 2A2GA 5B11O 1PTOD 2X69A 3D8GA 3MFGA 4APVA 5HGQA 1B2TA 1WTWA 2K14A 3U9OA 1BCPC 2ASNX 3RNUA 2K28A 4WORA 4YVBA 1CFMA 2PNHA 1TVXA 2E2HB 1BXTA 2MHVA 2B2WA 5LKEA 1IW7C 2NP1A 2ZM6Q 1S44A 4JI8Q 4O3XB 3DM3A 4KLKA 1G8ZD 4DUYL 3H09A 3S15B 1E02A 4I95A 2F0JA 3WXQA 5HZQA 1RDPD 5ELFA 4P71A 1IIUA 1VWFB 1B7YB 2Q9SA 5JR8A 5C44G 4IB6A 1HXLA 4GN5A 2ATWA 2JMBA 1L1OA 1NE3A 4N7DA 2I07B 4IOCA 4TRDA 4PNYA 3FR5A 2CBSA 4YGHA 1O7IA 2Q4NA 1G7NA 1HN2A 4RGTA 3HK1A 2F52A 3S1QH 4ZAIA 2AH7X 1I4QA 2JA7B 1VF5C 1I50H 1NTGA 2H4OA 2R7ZG 3K7AB 1BBUA 1RHPA 2Q2MA 4GN4B 1CZGA 3EW2A 1D2UA 1S72A 4A3MH 1PLFA 4NXML 2F0DA 3I4OA 3GTKH 2IL8A 3KOJA 3QIAA 3K5LA 1K8GA 3J81i 3CC4A 4A3CH 5DPQA 4K5XA 1OBQA 2QOSC 1S2PA 3AB9A 4LUOA 4B3TL 2G9DA 3A5ZB 1SYBA 1VQ9A 3J81L 2VUMB 4LF4L 5CC4A 4A3FG 3HTYA 2Q39A 5CE4A 2WKDA 4OMWA 1BEBA 5EGTA 2WV6D 1SRIA 2VQEQ 5D48A 5LKFA 4IUPA 1LV9A 2WFWA 2KECA 1Q90A 2Q2IA 5FO8B 3GTQH 3CHBD 4Q5VA 2IZHB 1PA6A 5C0XH 1E3PA 3NPPA 2A5BA 4XTCS 3DHQA 1RXHA 2X46A 4NW2A 1RJTA 5HBSA 1SN8A 4BX5A 1HBQA 4JBJA 5H9AA 4QYPA 5HZ8A 1KC8C 1Y0GA 3R2TA 5LJCA 4MVKA 1NSNS 5FO7B 3CCSA 1TR5A 1HNXQ 1SE2A 3TZSA 3PGZA 1VQOA 5BVSA 1GXAA 4MZ9A 3SEBA 1I6HB 1ZNKA 5J39A 2OCEA 2V1CC 1VS0A 1ZKOA 3FR4A 2K1BA 3TN2A 1A2DA 4YDBA 3FVQA 5C3WA 1WD1A 2N49A 2NNQA 3ZUOA 1D1IA 1L0YB 2NZ1D 1LIFA 1VYGA 4UY8C 3UDXA 3VE1A 2JYOA 5JJKA 1BCPB 1DF8A 4BBRG 5HZ5A 3K5OA 4KI0A 1SYFA 2X4MA 1S5DD 4UU2A 4OKAA 2F0IA 1A3VA 3I3CA 2FINB 4ZYSA 4PJ2A 4LFCQ 3CMAA 1OSPO 3TP7A 1GGLA 1RXKA 2RQ0A 4L3RA 1Y1WB 1AVDA 4YFRA 5FLXc 4IFDG 2PZTA 4KHVA 1DFVA 1I4UA 4B3MQ 1KDCA 1OPAA 1ZNGA 3O13A 2VDFA 4V190 2IX1A 4QL5A 5KYIA 4AZMA 2EPBA 4OIKA 1JV4A 4IUUA 4KD3A 5FLXE 4KY5A 1EPBA 4QZUA 3STMX 4I6SA 3A7LA 2QILA 1VWHB 4AZNA 4CDDC 4IFDI 2CAMA 2A68C 4AW8A 5CMDA 2F0WA 3S14B 3SZHA 3VG6A 1SEBD 1N33L 4QCLA 2E2DC 1S40A 4Y52H 4B3RL 2WEWA 1QILA 1DGSA 3N52A 5FJ8G 4FBRA 3MM0A 4HPDA 1GUTA 1SWPA 3T51B 2A6HC 3SR1A 1NR4A 3PECA 3H91A 2UXDQ 4JBWA 1II3A 2CFMA 1PFNA 4JC0A 4O0AA 4DV4L 1ZXTA 1D2BA 1RSUB 1DONA 1XXGA 1Z6HA 3DXJC 2UU9Q 1Q12A 4X66L 2SNSA 4XQQA 1GD7A 5F2BA 1YNNC 5FO9B 2FHNX 5FKAC 1DOLA 4QIWE 5BN5A 1SYDA 4DAVA 4Z2PA 1X3PA 3S17H 2EY6A 2XSTA 1X56A 2RN4A 3B2JA 2PI3O 5LJGA 2NVYH 3V05A 2E2JH 3LV4A 4R0BA 1PMRA 3X3NA 3DSZA 4JI1Q 1ZYRC 3G71A 4LF9L 3CAMA 3FEWX 4U46A 3KLSA 2KHIA 1RLBE 4ZCBA 2BA1A 1PZKD 4ZR2A 1YWAA 1S5BD 4ULLA 1FENA 1YJ9A 3SK6A 4GNXC 2LXJA 1I4XA 3MZ5A 4HSVA 4QYNA 1H9JA 5GADC 3CW2C 2PNRC 2Z6KC 2CWAA 3U0DA 3HOZB 1LDQA 3FMZA 4I3BA 1M8AA 3KJOA 2ALYB 1SDFA 3A8JE 4JOIA 4I65A 4A93B 3TP6A 2CKZB 4CKBA 1LTID 4DGZA 1NMFA 3EIVA 2BT9A 2TSSA 4NDXA 1YITA 1E1OA 3P02A 1VWPB 2ZTDA 3I4MG 2QEJC 3J80c 5IP7H 3AFPA 4FF3A 3QJYA 5LL6X 1XNQL 2JW1A 2W2AA 3HOVH 5EPKA 2F0MA 4JI2L 1EY9A 2RDGA 1KQSA 2ZXOA 1A2UA 5CBEE 4X3UA 4ORXA 2F0NA 3J80E 2BLGA 1H9MA 3A55A 5M3MH 2Z4IA 4BX7A 3H3VC 3M3YB 1EZ6A 3TRZA 3UEWA 5LJBA 4J1MA 3F2BA 2K75A 1SWTA 2FMCA 1LIBA 5H9LA 5IO7A 2GN5A 4BWGB 3HOXH 2HT1A 2OF9A 2OFRX 4BY1G 2B8GA 4AQYL 3RBYA 1Q8IA 2OQ0A 4BY7G 1VWKB 5EDBA 1VWOB 2PQAA 1FGBD 4IB7A 4A3KH 4XQJA 4A3GH 1GX3A 4GDAA 1ASYA 2OF8A 3B2HA 2FT9A 2Y0SG 3BZDB 1PHJA 4YCVA 4INNA 5EQ0A 4ZGUA 2E4JA 3K0YA 4YDAA 1NNXA 4WHIA 2YV5A 3NADA 3NQKA 5K36H 4XT3B 4I9SA 5C3XA 4O42A 4PZ8A 1TQOA 2BH2A 1PEEA 1TWHB 1I78A 5BN3A 2DJFA 1IHZA 3WZPA 1PTOH 2RD7C 4IB8A 2Q2PA 3EROA 5EEEA 4ES7A 1UREA 4YHHL 3S1NB 3KYHC 3IFDA 3PUZA 1OTCA 4A3BB 1SMYD 1Y14B 5CV8A 1GT5A 1K3RA 3KLSX 3CBSA 3I4NH 1K9MC 5M5WB 2FKGA 4ZKBB 1E22A 3PPTA 2BCOA 1C48A 3HOUB 4JI0Q 4BXXG 5DNFA 2QO6A 4YGZA 3NEMA 1ENCA 1W2BA 3Q6LA 3A54A 3UI2A 2LXKA 3ZW0B 1GUNA 4G4KA 5B10O 1STYA 4A3JB 1EWCA 1KDAA 3QWNA 1U4PA 2VY3A 4ML7B 1F2YA 4KD4A 2ZJPA 4B3TQ 3CMEA 2B2TC 1SWQA 1SWOA 3CBCA 4I60A 4AIMA 2UUBL 4A3LH 4GNXB 1ICFB 1JJ2A 5AJ3L 3SDZA 5C4JB 4C1NK 1NQMA 4DNTB 1HNZL 2WACA 1H91A 2K5VA 4NXNQ 1GJXA 5GROA 2Q2UA 1UE1A 1HQRD 4KC8A 1HUMA 2EDGA 3RN2A 1AP0A 1T8VA 2UUAQ 2KW1A 4IZ8A 3RY2A 3VHMA 3ZYYX 1C7YA 4DV3L 1N32Q 4FP5D 3EBEA 4A1HA 1YIVA 3T1DA 1KT6A 3ND8A 1UWVA 2HUGA 4DPGA 3FR2A 3BU9A 2CH4W 2ZSCA 4QGWA 1X65A 4JI7L 5HWZA 2QMIA 2R73A 4CDCA 4CDEC 2R92G 3RLNA 1X71A 3KVNA 2A19A 1EIIA 1TS5A 2A74C 2WP8J 4O3WA 5IT9c 5JPNC 1DV9A 3SZIA 3NTIA 3FW5A 1J6QA 1I06A 1H9RA 2KT4B 2LFNA 3FKIB 4DUZL 4DV2L 5IO5A 1BQQT 3VGWA 1PM1X 1JMXA 1KRTA 4LZVA 4DV6L 1AN8A 5IT9E 3C78X 2M4LA 2RA6A 4DF7A 3CQNA 2JA8H 3T16A 4KY7A 1SAPA 4CDFC 2EOTA 3F1ZA 4C3HG 4HJAA 1N9YA 1ENFA 4FF2A 2X55A 3HOWG 3F8TA 5IE8A 4PMBA 5JAVA 2CCZA 5B3MO 1LLRD 4A3IH 1TOWA 2NVXH 1YNJD 4DNEA 2L4NA 2B2WC 4GJVA 4OWXB 3VG4A 4KKUA 1SFOB 3H0GG 3MXGA 3WZOA 3IRBA 2MM3A 4A8ZA 4DR2L 2RDFA 3CP0A 1RSTB 2EYPA 4ID2A 5FLMG 2JA6B 1Q1EA 3DWQA 1V43A 1SNDA 1CHQD 1P8LA 2ASBA 2IZJA 2CH4A 4C1NI 3KBXA 1VWLB 2QCPX 5F7GA 2RTKA 2WUTA 1X8QA 4C3IG 1EY5A 3E9IA 3CF5A 1X32A 3S1MH 4DCBA 4ABNA 2IY5B 4FNFA 4FXGC 1SMXA 2GTLO 2QDBA 2EXDA 1LABA 2D2CC 4G7OC 1C0AA 5HCEC 1SYCA 1BUVT 3S9WA 1WVLA 2B2YC 1N34Q 3J7AF 1EEID 3NSWA 4Z28A 3UE1A 4OEMA 1JJUA 1CZWA 1A3UA 1VWAB 5M3FB 1M1KC 2N55A 2ZM6L 1AVEA 2ZJRA 1SWHA 3QKGA 3M9BA 4JI8L 3OYYA 3NBIA 2Z0SA 1LICA 4JK1C 2EYMA 4LF9Q 1EL0A 1BRPA 5C4ZA 2RCQA 2WAQB 3HP3A 1HFGA 1LTGD 3EFXD 4CSBA 3S2DB 4HMJA 2AQ1B 2PW5A 4H13C 3VDYA 3RZYA 3WJDA 2F0KA 2F0EA 3NBHB 1MGSA 3NXWA 4NP5A 2K4KA 4CPHA 1EW3A 4OL7A 5IGEA 3X3MA 3PIPA 4B9WA 3ZJYC 3MWYW 2PI2E 2R93B 3PO2B 3PCOB 4IB9A 4XMEA 3CPWA 2VS1A 3RDQA 4JI5Q 4TJZA 2K52A 1I3QB 1JICA 1UUPA 3UAQA 3BDOA 1HQQA 3P75A 1HA6A 1SY1A 4HN7A 2LY7A 4CPFA 3HWGA 1KRSA 1RAVA 3RZDH 2CW0D 1HH2P 1XNQQ 3D97A 4YBPA 2LFOA 1E5PA 4DNRB 1LTBD 4JI2Q 3K5MA 1YHBA 1SWUA 2AMCB 4YFPA 2EQSA 4LF5Q 2FJ2A 1EUJA 4RCNA 3VR4A 1SY0A 1STBA 5IYCG 4BJ8A 2QEXA 3FELA 2ICIA 3K7UC 4K8IA 1BR9A 5C4XG 1TWFB 3HKZB 5I2YA 2F0PA 5LL6S 2B63H 4MN3A 1HQMC 3EVQA 1G291 4L8JA 1HY2A 4IABA 5KIDA 1A3TA 1E24A 2K32A 4CBVA 4BBSG 4JV5Q 5LMNQ 5LMUQ 1LPJA 1EOVA 1PYWD 5F1EA 2ACPX 1EUOA 5IRUA 5IYDH 3KUPA 3MHBA 4A3DG 1Y1VG 1EQTA 3GV6A 2RTMA 2FS7A 3FLLA 3E6ZX 5GAGC 2HQLA 3CCQA 4HWMA 5IYCH 1K0RA 2AWNA 2E5LQ 4FXKC 4DV0L 3B2IA 2HZRA 4UP7A 1HBPA 2R74A 2L5PA 3PUXA 2GA4B 2Z4HA 4GD9A 1DZKA 3CQZB 2KA7A 3JAMc 1FVIA 1KT7A 3V2TA 1T68X 3M85A 4Y7NB 1NR2A 4IUTA 3I90A 2BS6A 1S4ZA 2I5HA 3MFYA 3S2HB 2LMCB 3W3AA 3JAME 4HIMA 1TS3A 4A3DH 2HHHQ 1X3FA 3DMUA 1JOQA 1SWAA 4Y59A 1RF2D 1VF7A 3E0EA 4B3ML 4OGQC 2NVQB 1YVCA 2O5IC 4ALBA 2JA5B 2MF6A 4F8MA 5A2QL 1JB7A 3T4AC 3W1GA 2YTXA 4UDUC 1LIDA 3QB3A 2EIFA 3T13A 1CBQA 1SLGB 4CJ0B 3EC5A 1DM0B 3PO3B 2OY8A 4TLJA 2NBFA 5K68A 1Y8OB 4OO1G 1PYBA 3APWA 5E3FA 3W5OA 4IMNA 1WUBA 5E4WC 1HHVA 1QVGA 2A1AA 1HNZQ 1HMTA 1NY4A 3GTLH 1FD7D 5E4XA 1BF4A 3B2KA 3QOJA 1Z47A 4WFUA 1X9NA 1KGLA 4OO1I 1FELA 4DV3Q 2UXDL 3G6JB 4C2MH 1VQPA 4JOIC 4FQBB 2ALLX 3GTOH 5EZ2A 4ILWA 2ZAGA 4HJ7A 1XMOQ 2UU9L 3W2DA 1JJJA 1SSOA 4OO1H 2OQKA 4IAWA 2CZUA 1NQNA 4DXGA 4LQZA 4GOPC 1NDJA 1HZCA 4F88A 5JEAG 2LSSA 5CYUA 1IJ8A 2Q8TA 3WBGA 2XWBB 1IBKQ 1CK1A 5I6WA 1WFQA 4BX6B 2PZWA 1X89A 3F9DA 4RHRA 5FK9C 2H5XA 1SY2A 2A3FX 3PQIA 1YNJC 3UE0A 5IY0A 4DA2A 4DV1Q 2PW7A 3R8BA 1DZPA 1NGLA 1Q46A 2MJIA 2NTSA 4MIUA 4A75A 2YU9H 1SWCA 1KABA 2JA7G 4HPCA 2C35B 2YTYA 1I4RA 4U8UO 3FMCA 2B29A 1OXTA 3DWPA 3C76X 1MM9A 5KNCA 1DXMA 1LTSD 2A8VA 2E2IB 1SWNA 4ON1A 4X3TA 1UEBA 4X62Q 2A6EC 4E6IA 5IO6A 3STBC 1R9TH 1B44D 3SK8A 1KFFA 1WTVA 5KHPA 4KTAA 4HJ5A 2KJXA 2ID0A 3PUVA 1IKMA 2CBRA 3DWAA 2HCCA 3D6CA 5JOBA 2VUMG 2AKWB 1GT1A 1R0UA 5D47A 1KLGD 3STKA 2F09A 3J7ZC 1JMZA 1JOKA 1B1ZA 3L7ZC 3OBLA 2AUKA 1I5FA 1GHKA 1EY7A 2F0SA 1BSOA 3VE2A 5C3EH 3GDEA 3MXPA 4EQAC 4R4OA 2Y3FA 1VQJA 1N9WA 5CV7A 3GTOB 2ZXRA 3HOYB 1UYNX 4Y0SA 1W3SA 1TWCH 3HKSA 1CT1D 4B9XA 5FQ8E 2DJGA 1SXXA 2OL8O 1JB3A 3PK2A 1YNXA 2RSNA 2I5MX 5M9OA 2WSJA 4RFBA 4O9SA 2K5QA 1X3GA 3LWUA 2NVTB 4GKKQ 5LJDA 1GHJA 1KTKA 3RR5A 4HIDA 1K0SA 1CJ5A 5EJWA 4WJ4A 3BY0A 3KFHA 4O1NA 3RDMA 3GTGB 1U17A 4RKBA 3L4RA 4IN3A 3CCEA 4JYAQ 2F4IA 3T56B 1LFOA 4RKLA 1WCMG 3O22A 1D7QA 3T53B 1VYOA 2X6GA 5HURA 4LF7Q 5C0XJ 3KBGA 1SYEA 1FDQA 4N9PA 4DV5Q 1XNRQ 2UXBQ 4EFGA 4KJNA 2R7FA 1QUQA 1NUCA 5D14A 1Z24A 3PEDA 1GVPA 4JPBW 4CJ1B 5FAZA 1TWAB 4GOPB 1Y1WG 4OONA 4JI0L 1SWKA 2E74C 2EJMA 5H9KA 4CDCC 4LK1C 3BS2A 2RKSA 4LKTA 4DXFA 4YCWA 4L5SA 2JGSA 2K04A 1O8VA 3CU7A 2MGSA 4BX7B 5EDCA 4CV7A 5C44H 3LWEA 1JE5A 1S5ED 2EXZA 4L63B 2SNMA 3BDRA 4DK3C 1NBWA 1STGA 1JQYD 1TY0A 4C3JB 4KK7A 3C2PA 2RTNB 4BBOA 2VFBA 3FIDA 3U50C 2JEAI 3PSIA 3VG7A 1E2VA 3NX2A 4HPBA 3FEPA 1MSHA 2R7ZH 3EMMA 2PY1A 4NXNL 1JQPA 3UDGA 1XMQQ 3SZJA 2ZT9C 1VQCA 2JOZA 3H3IA 4RGNA 3ZWEA 2MO5A 1AE3A 5LMNW 2UUAL 3OMCA 3I70A 4LZUA 1EY0A 2Z9HA 2HDMA 1N32L 5COYA 1BVSA 1X3QA 3I8ZA 3P6GA 2JA9A 3J7AV 5C4HA 4OWWB 1WBIA 3RE6A 5H8TA 3WJCA 3VA7A 5EBDA 4HAEA 4A3FH 4XMDA 1SXWA 1MJEA 3P20A 4NYQA 1VQGA 3E9HA 2RQXA 3K6OA 3MVFA 1RIPA 3KLWA 1VQHA 3OWEB 4N8X1 5K67A 1LCWA 5IYBG 2GJ5A 1PRTD 4DV0Q 1Q81C 1EYAA 2F0OA 2QGQA 3NWSA 3C3LA 1QFTA 4GGTA 4EEJA 2HIXA 2PYKA 4R4IA 4TKBA 1E2WA 2WKCA 1GM6A 1PV4A 4WFN3 5EKLA 5KNDA 1KIXA 4AZRA 1IFBA 3S1QB 2D0PA 2K5HA 2F0FA 3D9WA 1I50B 3A56A 2AKQA 1CKOA 4GK9A 2EY2A 3KF8A 2KCMA 3OIQA 2JSOA 5L8IA 4XIGS 4A3MB 2F3VA 3HOZG 1S5CD 2B2VC 3L3OC 3NQ9A 3UEVA 5IP9G 3GTKB 1DYQA 2M2LA 4A93G 2HYSA 4DKAC 3CCRA 5LJEA 2O2LD 4OMXA 4O4UA 2K23A 3EN2A 5IGGA 4ALOA 3LTWA 1IKLA 1U9RA 3OMGA 2B3GA 3SXHA 1BRQA 4ZH9A 5IRWA 1QWYA 4BBRH 2KBNA 4I3CA 1TWGH 1U0LA 2N3SA 5C5LA 2KTDA 1BWYA 4QQ1A 2AUJD 1MKHA 5IRAA 3KDFA 4DN4M 3TP5A 2R7ZB 2WB1B 3NQTA 1MBYA 3HG9A 4DFAA 5JD2A 2B2UA 1CKNB 3GTQB 3ERQA 4ID6A 4BOEA 1U4LA 4IFDH 2DNCA 2AT3X 4ZHHA 4JI4Q 3PV0A 1PZJD 1N8RC 3WVMA 2G8CO 2NWGA 2O4XA 4X64Q 1WTOA 4UHVA 1E06A 2JN4A 1VQ8A 3G4SA 1H9SB 3K0XA 1XJVA 1N34L 3I7FA 1K83H 2XNAC 2JU7A 3TZUA 1VQKA 1ZRYA 5JVH3 3FA8A 3MXNA 1ICWA 3PF4A 1VQ4A 4S3SA 3ZW1B 1CUKA 2AT5X 2G5DA 2KENA 5LJHA 2XGTA 5FJ8H 4GKJQ 3CMPA 3U4ZA 1CSPA 2OWOA 2MO1A 1KL4A 3CC2A 1SWEA 4DR3Q 4FO2A 4WJ3M 3I56A 1IKEA 2MPMA 1I94L 4YCEA 3GE2A 3Q34A 3LGJA 4L6TB 1V1PA 4ZCKA 4G7HC 4QQBX 4GUZA 4A3BG 1G6ZA 4ORRA 3S16H 4Z2OA 2P5ZX 3SVMA 4GLAC 4LFBQ 1TXYA 3K3LA 1QE6A 1BKBA 2PZUA 3TS2A 4D6BA 2PI2A 4IUVA 1DZJA 2LKKA 1ML0D 1ZNLA 3TDQA 5TSSA 4DR5Q 4MVEA 4JI5L 3HOUG 2F0UA 5HA0A 3J81c 3V96A 1LYLA 2MHDA 4IRWA 2BH8A 1VWRB 5IXGA 1VQEA 4A3JG 3CRKC 4GLVB 4Z6JA 5M5YH 5ELDA 1KT3A 3J81E 4R9WA 5JPMC 1DOKA 2M00A 2IZEB 3D31A 5CHKA 2RA4A 1PTOF 4LF5L 5AJCA 3EM0A 5KRUA 1CQFA 5T1GA 2WAQE 3FIQA 1PTOC 1IZ6A 1K8OA 3E3CA 4ME3A 5AQ6A 3OOCA 2IZCB 1F9PA 1D5MC 3N6RA 1QVFA 4GU8A 1SRJA 4IOAA 5L8NA 4F87A 4F7XA 2K62A 3I4MH 3WJEA 3KLRA 4JV5L 5LMNL 1HR0Q 1D6EC 1L0XB 5LMUL 4DV7Q 2GTFX 4UAIA 5ELEA 2RTLA 3CQRA 3DEOA 3CC7A 1UYOX 1U18A 3HWEA 3CPFA 2OFBA 3S17B 1E00A 4CHTB 1V8QA 4YKOA 2KCTA 1U4MA 4I7AA 2HIVA 2NVYB 2E2JB 3BX8A 1HZ9A 1UEAB 2RBMA 1MI2A 1QABE 2E5LL 4N7CA 1QVCA 1HPCA 1V1QA 1SLFB 1ERBA 4BY1H 2OVDA 2H1EA 2OY1O 4BY7H 1EALA 2LBAA 3FKIG 3HPEA 1KHIA 4HPAA 2MJ8A 2EYLA 3D6WA 2NNDA 1B4OA 3HRZC 2X45A 1JORA 1QWDA 1J5EQ 2CM4A 2KEDA 3HKZE 4X65Q 2ZXPA 1J8IA 3QOLA 1K3BA 4IBAA 2HHHL 2R3ZA 2WQAE 5B5GA 3MTSA 3WYQA 2F0QA 2F0TA 3RLOA 2OZQA 2IJ0A 4GZYC 2F0VA 4YH0A 1H95A 1GUOA 2SOBA 2XVSA 1WD0A 1LKEA 2LS01 3J81j 2ANSA 4XQNA 2BE5D 3SK4A 4QUCA 3U58A 2RTBB 2F3IA 5CORA 3D95A 3HOVB 1I4GA 1UE5A 3R93A 1P6PA 1TW4A 4IPHA 2A13A 2POAA 2JA6G 1O7ZA 2UXCQ 2QCBA 2L67A 4DR7Q 5CSEA 1YHAA 5M3MB 5C6AA 3OW2A 4MEEA 4DQ3A 4KKTA 5BN4A 2FXQA 1F9QA 2BOSA 3TEHB 1PH4A 1D8LA 3HOXB 2AF5A 3IKJA 4CKCA 3S60A 1LNMA 4BXXH 3RD4A 2P8GA 4A3KB 4A3GB 1VYFA 1PH6A 3BSZE 1LO5D 1IYJB 1N4JA 5ELBA 1Y8NB 5JJLA 2FWVA 1MUPA 2OYBO 2RTOB 2JK8A 1E7ZA 3P7JA 1XMOL 4B55A 1YJWA 3KFUA 2L68A 1XWEA 2SEBD 5M3FG 3MXUA 1CKMA 4BS9A 1F77A 5IGFA 2PMZB 1PTOB 2DM5A 3I2ZA 4JI6Q 1HXZA 2BDNA 3M4PA 3NHHA 2QDLA 3VA5A 3OSOA 4AH6A 4QUFA 4RG1A 1PH9A 4YKMA 2F0LA 2F3WA 3UEUA 1T5XD 1IBKL 2WAQG 1ML7A 4DR4Q 4DU9A 4JW0A 2Y0SB 4MVLA 3T6LA 3STNA 3M4OH 1GXDC 4WJWA 3JS1A 3C46A 3I4NB 2X56A 4FYDA 4O4SA 1B8EA 1M4VA 4DV1L 2IWHA 1UE7A 1K73C 1GKAB 2HMBA 1CRBA 3KF6B 2R92H 2IT1A 1SR3A 2R93G 3PO2G 1Q1BA 1I04A 5HY6A 2IZAA 1LT4D 3PF5A 3GP7A 2IPKD 2EYOA 2X8TA 1MX7A 2FRSA 3E0JA 3E5SA 4CK4A 4X62L 1BBWA 1KNEA 2OEOA 1YI2A 3OWFA 4DAYB 1FJ1E 2IZFB 1BBXC 4JVZA 1CM9A 3DTQA 4FBOA 3GTPH 1IBLQ 4C3HH 3ICEA 1L1OC 3OIPA 1KXOA 4BCSA 3HOWH 1JT8A 2FLJA 4P73A 4LNQA 2JU8A 4K6DA 5E1FA 1PH1A 4NYRA 3CKFA 1LT3D 1QZHA 2GVAA 2DUDA 3HKZG 1RTOA 3EBWA 1OO9B 1K24A 5KIXA 4LF6Q 4ZFXA 3H0GH 3SE0A 2JP1A 4GETA 4J8QA 2KTSA 5DEHA 2RTJA 4A1YA 2TMPA 2VFCA 1HRJA 1SLEB 2ICEC 1L6MA 2J0TD 3AEHA 4EGVA 4GE1A 5FLMH 1W6FA 4KN7C 2LB6A 2N8NA 1LF7A 1OPBA 3OJYC 3D4WA 1KQWA 1ESRA 2QM9A 3UEXA 4GKKL 1FEMA 3NE5B 1ET9A 4C3IH 4X3KA 1VQ6A 4YIJA 2QO4A 3HOEA 3L0OA 4O2DA 4GZVA 3HFZB 1NMGA 4XT1B 2AWOA 1TU2B 1SBBB 1QJOA 1IW2A 3RDSA 1SJHD 4DAMA 2RCFA 4JYAL 1GX9A 3FPPA 1I94Q 2JA8B 4HMIA 3SGIA 1YUPA 3RSWA 1B0OA 3K8AA 2ZAIA 1GOZA 5CV6A 4LF7L 2XN9C 2Z6BA 4K0KQ 2ZJQA 1BCPD 4DV5L 4A3IB 1XNRL 2UXBL 1CQVA 4OELB 2NVXB 2ZTCA 4A76A 3K5NA 5IGBA 1ZNDA 2LA7A 1G6PA 1VWCB 1YWCA 4C5PA 1IW7D 1YJNA 2OTLA 3RZOH 1TOUA 3P6HA 5EKKA 1FTPA 5LJKA 1MK5A 3Q24A 3T1YQ 3APUA 4CDDA 4IURA 2JA5G 2RTDB 2PPBC 3GO5A 2W2FA 2E75C 4QJFA 3S1RH 4ORYA 4YCUA 3E3XA 5CR3A 1KL3A 5FENA 2I0QA 1YWDA 3BVGA 4M8AA 3J7A5 2KUMA 3I17A 3HZXA 3PO3G 5KICA 5L8OA 2ENBA 1U4RA 5DG4A 4IPCA 2L0CA 5D4AA 3S1MB 3VG5A 2XSCA 1YIJA 4QB4A 4K19A 1A62A 1ENAA 1VQMA 1XMQL 4LF8Q 1VQNA 1SWRA 4QAEA 2AHOB 3P6FA 4PSQA 3DM1A 2QA4A 1HQPA 1VWMB 1ACDA 2IZBA 1HR0W 1MJCA 5IODA 4ODDA 5L3YA 1N43A 2FHLA 2DNEA 1O78A 1B4MA 4O4OA 5ELCA 4LUZA 4CPEA 1X8NA 3RN5A 3ZW0A 3MEFA 1L1OB 2PQEA 4K8JA 3NP8A 1MVGA 1UZ2X 2KEEA 4A3EG 1B3AA 3BDCA 1STAA 3WOEA 4B3SQ 1STNA 1G2TA 1UNSA 2EY5A 5C4XH 2NN6G 4NKLA 1JE4A 1SMYC 2FHTA 2AMMX 1Q3LA 4KY6A 3AKMA 2WQ9A 1AB0A 4ZUJA 3VR3A 3AKNA 4ORUA 1SNPA 1LTTD 3F2UA 1EEFD 1O80A 1B9MA 4A4IA 4HJ8A 1C4QA 4WRDA 3M7GA 4BBSH 1EIOA 1VMPA 3CCUA 3C1FA 3PP6A 4RHSA 2RVLA 3ULLA 2CQOA 3BZKA 1RXJA 1EU3A 2NN6I 3GTMH 2L9CA 1Y1VH 1IL8A 4IJLA 2A8GA 1SWFA 5GQOA 1QNUA 4A3EH 4RWSC 2PCFB 4DK1A 3GTJH 5M5XH 1KOIA 1LUQA 3FDTA 1TVQA 1FNUA 3FENA 1KLUD 1ZNEA 5HZ6A 2OVSA 1C8CA 4P75A 1YP6A 1SLJA 3RZDB 1R4QB 1LTLA 2F0HA 4IO9A 2R56A 2R61A 2OVEA 1PFSA 4FVMA 4KMUC 3FDCA 4C56C 1DOMA 2VZAA 4GGRA 1EWIA 4KCAA 3NENA 3UDIA 3OTOQ 2JXMB 1ICNA 3MX7A 3PH6A 1W6KA 5FFHA 5E7NA 4Z27A 1NAPA 4MTNA 2EU7X 3TGBA 4BX5B 1JWSD 4O4XA 5LHY1 2K05A 2B63B 3M4YA 4JI4L 2JEBI 4YWLA 4YBUA 1SJED 5GAHC 2VB3X 5I4DA 3VU1A 4IAXA 2LKVA 5IGCA 4X64L 4HIOA 4OS8A 4ZRZA 4JO6A 4XMFA 4KT5A 3HOYG 1O7LA 5HZ9A 2JQOA 2NZOA 5HCDC 2AQ2B 4MVIA 3VYUA 1JIWI 5IIFA 3KK7A 3S26A 2MQHA 3RDOA 1QCBD 4DR1L 3X00A 1QFVA 3RDXA 3B6YA 3D3RA 1VQBA 3PUWA 3AUMO 1VQAA 1Y52X 4TQUS 3HWFA 3GV3A 2A68D 5H1SE 1A0IA 2C4IA 4IUQA 1S3OA 1ZEQX 4HFOA 4JNJA 1VQLA 4GKJL 2IZDB 5K36G 1AEXA 3GTGH 4DR3L 4YMYA 1QY2A 1HZBA 2A6HD 3K58A 2WB1E 2DN8A 3I55A 3L9AX 3TREA 4A3DB 4GNYA 4LFBL 2E2HH 2HNXA 1AZPA 1FGUA 1X6OA 2N78A 2RDHA 3V8UA 1STHA 1UAPA 4DR5L 2XWJB 5JEAH 1LCVA 2RCTA 1YNND 5HGTA 3IAYA 3RDUA 2B2TA 3S15H 1Q86C 4FF4A 4TKOB 2UUCQ 2OL7A 2A2UA 3FEKA 1BSQA 3FA9A 4L5TA 3RE5A 2DJFC 3WOFA 4FDBA 3WOVA 4KN4C 3TQYA 5CGKA 3DLLA 1MEPA 1SWBA 1SNOA 2VW9A 4C3JG 1F9SA 1SNQA 1V1OA 2BC3A 3GTLB 5JJIA 5HTEA 1EZ8A 2JA7H 2MP1A 4IJHA 4COTA 5CV5A 1W6JA 5IOCA 3D4DA 1QG5A 1WOCA 3WJFA 3K7AH 5CV9A 3P6DA 3EQLC 1DF3A 2L12A 1K3BC 4C2MB 1A8VA 2RCNA 1AE2A 3ZUIA 2RTRB 4U8UN 4CDEA 5FLXL 1UE6A 1KD1C 1HR0L 4NW4A 1RD9D 1VQFA 4DV7L 4RCOA 4UPAA 3MEHA 1CTMA 1Y9TA 3S5VA 2VUMH 4ARHA 1MIUA 3BVMA 1SWSA 3RLFA 3A7AB 2L15A 2OFMX 4LWCA 4Y0RA 1SE8A 1CA6A 1SNCA 4CKEA 5NUCA 1SE3A 1X54A 1EQDA 4CDFA 4RGMA 1YP7A 4OS3A 1LCZA 4PZ7A 3BDLA 3EBKA 3N91A 3D0FA 4HTHA 4K2LA 2JE6I 1I05A 3AFQA 5T1IA 2YU9B 3D4RA 5EKIA 1PVOA 3FP9A 1J5EL 1STPA 5BR8Q 2E8GA 2JN3A 4X65L 1Q7YC 3OE3A 3I91A 3QQ2A 4AZOA 4QMGA 1A18A 1VWJB 1AELA 4A3MG 1I6HH 4ORWA 4TNNA 3WZQA 5K06A 1IYUA 2CW0C 4RMFA 4QZTA 4U8UM 1FNWA 1QNKA 4GLXA 3TGAA 4FXDA 3EA6A 2Q8RE 5A2QE 4A3CG 1CBIA 1HZAA 1R9TB 3WJGA 1FNVA 3RWXA 2J4XA 2CZTA 4AYBB 4EVOA 3MVVA 1WCMH 1T0VA 4RUUA 2D62A 2RTAA 4HEDA 2F03A 1LELA 1QQSA 4KIIA 2UXCL 1EPAA 5D3DA 2PQAB 4DR7L 1QY0A 1EQRA 3NQIA 3ZQ3A 1G2SA 2C5CA 1YWBA 3A5UA 5C3EB 1BLRA 2WB1G 2YTVA 4PQXA 3PIOA 5HCCC 1G5WA 1FYCA 2IHFA 1WTQA 1Y1WH 4RH6A 1Z9FA 2B2YA 5C0XG 1XPUA 2BA0A 3U4VA 5IWAQ 1IXRA 1TWCB 4BA1I 2OY5O 4R8IA 1RL2A 2D5DA 4Y5DA 3CRLC 5FQ7E 4MNOA 5BYPA 3J7YW 3A74A 4R1JA 1WJJA 1SWJA 1VWDB 1A57A 1CA5A 5CBAE 1RTNA 1S5FD 2F0GA 3J80i 4ZK9B 5KEEA 5JJZA 1KXLA 1A3YA 3NBXX 2I5ZO 4NV7A 5C0XI 1STEA 3SOTA 3S14H 4JG2A 3J80L 4KH8A 4M6SA 1PH8A 4I7ZC 3F2CA 4B08A 1DZ1A 4JI6L 3T1HL 3FA7A 3P24A 3ERSX 3TP8A 4XDXA 3AMUA 1BBPA 3O2YA 2RHSB 4DR4L 3Q8DA 4ZKCB 4YY3Q 1U5KA 1BDOA 1EY8A 4IFDJ 3RY1A 1EFID 2NTTA 1PMPA 1K8MA 3VR5A 1WTXA 1SWGA 2SDFA 3KFFA 2JJQA 2MO0A 2IW3A 4LJZC 1LIEA 1S7DA 1JWUD 1Y69U 2XRSD 1GUSA 1ESFA 2FFKB 3F2DA 2HZQA 4NB3A 2VQFL 2DGYA 5IYBH 1IKJA 5BVTA 4AZPA 2DY8A 4UP9A 2C1QA 1ET6A 4PZ6A 1WCMB 3EJIA 4CGYB 5C44B 1FJGL 1VQ7A 2EYHA 1DJRD 1STRB 3ELXA 3NR3A 4GGZA 2MUYA 2D0OA 3VR6A 3PIO3 2G79A 1Q8KA 4EXZA 1ERXA 2A69D 2ES2A 2PMZE 2XRQD 2Z1CA 5EPJA 2K33A 2L5TA 4OWTB 1IBLL 1VPRA 2BS5A 3TSSA 4CPIA 4BX6A 1J9OA 3CKIB 3ELZA 4XYQA 1JC7A 1KT5A 1HJPA 1Z7TA 1PH5A 1V9PA 4AZQA 3HOZH 1B3QA 5ELOA 2Y0SE 1GT4A 4QRLA 2D9UA 5HA1A 5IP9H 2KCNA 4A93H 1A63A 1B8AA 5KYLA 1EYGA 1F2MA 4PV1C 4BGFA 4LF6L 3CCVA 3VR2A 2RTPB 5HTDA 1N36L 3QG1A 2VXWA 3AQQA 4XMCA 3BYTB 4A3FB 4HSPA 4DR1Q 2NZHA 1SXUA 2HKDA 3U9SA 4RUNA 4ALPA 3T2WA 3SLJA 1PH7A 3BX7A 3UDFA 2BSZA 3S5XA 3KZAA 2E76C 3NQ3A 4KC7A 3M3YH 5B2AO 1DCZA 2V4DA 2Z8LA 2IZLB 1QOHA 3ZW2A 1XX8A 1CHPD 4ORSA 1VDZA 1CBSA 1B53A 3VHIA 4HCSA 2WR6A 3JQOA 4YGGA 2X6LA 3DUZA 4N9TA 4R4TA 3KQ0A 1JJXA 4FBVA 1CI3M 2F01A 2DY7A 4DR6Q 2AVIA 2Y3EA 4M1UB 1XPRA 1GO3E 3JC66 4OX9L 4IQZA 2NYZD 3TS0A 1A6XA 2F4VQ 3BJUA 4K0KL 4QGVA 1AVGI 1IBMQ 2I46A 4Y0QA 1SYGA 4KJOA 1M90C 4JI3Q 2RTEB 4DQ4A 1OEJA 3PQUA 1JJGA 5EPQA 1TWHH 2FMMA 2KHJA 4LFAQ 4YFQA 3T1YL 3BYYB 3G6EA 1TXLA 5AFWA 3NTHA 3TF6A 1MD2D 4EQNA 5IP7G 4KHPL 4BBRB 2LBVA 2IHEA 1K28A 2PO4A 1TWGB 3HOVG 1Y55X 5IT9L 1I4PA 2FKJA 4O49A 3S1NH 5AJBA 1BM5A 4PG3A 2WINB 1KL5A 4A3BH 1SRHA 4NLJA 5FOBB 1E0BA 1TKWB 4P2CB 5I9OA 1HNWQ 1WI5A 5M3MG 4LW1A 4U9CA 1FE3A 3FA6A 1HMSA 4H0LC 5M5WH 2K6AA 4GH7A 3HOXG 1EWHA 4OEMB 4GJSA 4NNSA 1JBHA 2C1SA 2QKIC 3HOUH 1HUNA 4LF8L 3I0AA 3OW7A 3SLTA 1Y8PB 4A3KG 3LNNA 1PH2A 4R4CA 4A3GG 1SXYA 2C9OA 1SY3A 1K83B 2A5HA 1OBPA 4A3JH 1NJIC 3BRNA 1E1TA 1SRFA 2KVMA 1JYDA 4GOPA 1O1UA 3RUZA 5FQ6E 1PYSB 1JYJA 1MDCA 3URYA 4YCHA 3VYTA 3RKGA 4HJ9A 1NP4A 4OS0A 5I6YA 4POGA 1G74A 1RKNA 3M4QA 1SE4A 1EIHA 5D8JA 3L2PA 4NPSA 5C4JH 4BVMA 5HAEA 1IL2A 2L1BA 1TT2A 4B3SL 4CPHB 2B39A 2K01A 4KV6A 4GRJA 2X32A 1SA8A 1VQIA 3NELA 1EQQA 4TKHA 1LUZA 5J22A 3EW1A 4NV8A 2K5WA 3S16B 4LUVA 2FS6A 2NNEA 3OHXC 2Q8IB 1LT6D 4U3QA 2KHSA 5EBCA 1I9HA 4DK0A 4NLIA 3I4NG 4Y0PA 1LACA 3H3VI 1EFWA 3AEVA 2I5LX 1OEKA 4EQOA 3APVA 2AT6X 3EYCA 1I6VC 4X3SA 2EZVA 1SNMA 4PMWA 4DUYQ 1ILPA 1Y9LA 1EOTA 1L0WA 3H3VH 1I4HA 1HCZA 1B56A 2A73B 4K2KA 1ADLA 1SROA 5M5YB 3CWKA 2G7BA 3D96A 1RBPA 3FKIH 2IFBA 4WBKA 2GTLN 3VHHA 4NNTA 3VYRA 4K5VA 3NP1A 4HIKA 4A3LG 5DM73 1PZID 5G3LD 2OTJA 4GDZA 3P1HA 3S24A 4QY7A 3OTOL 2RHQB 2KCCA 2FR2A 2I5VO 2YMSA 3P6CA 1PH3A 4LKPA 1BSYA 2OY7A 1SRGA 5EPLA 3VYSA 5ELNA 4NXMQ 1PTSA 1PXUA 4M7MA 2MWHA 1E2TA 1B70B 3CXCA 3I72A 3AYHB 5J3BA 2G9HD 3I4MB 1BNZA 1X8OA 3IFBA 1SFOH 3BZCA 1L2FA 1PRTF 3TMEA 1RCVD 1OXXK 4ODGA 3A8KE 1OBUA 4LF4Q 3RMHA 2JA6H 1PRTC 1SWDA 3VG3A 4GS3A 1MX8A 1KT4A 2ACOA 4GKCA 1VCIA 1EY6A 1JR0D 2O5JC 1EIFA 3NX1A 2YYZA 1LDOA 3IA8A 2GC9A 2Q2HA 3LHNA 2BHVA 4L1NA 5A35A 3T1HQ 3K59A 4BY1B 4BY7B 1TY2A 2GTLM 1GUGA 3PMFA 4EX5A 1QG7A 3FW4A 2AT0X 4R4QA 2IZKA 5L37A 1VWIB 1G51A 2EJFC 4MHEA 2JA8G 4EDEA 1CKNA 4Q0FA 2CHBD 1H9KA 1LTRD 2A5CA 3TGCA 2K03A 4J6HA 1XCAA 1D5ZC 2EYJA 1EU4A 1BJ7A 4A3IG 1PDQA 5M3FH 3CD6A 2RTHB 1B9NA 3FYFA 2DJGC 1YHQA 2VQFQ 3G7XA 2F73A 1H9SA 3T2XA 1HXYD 1O7YA 2WPUA 5B5FA 2HD3A 5F2DA 1FJGQ 3M7NA 3ONAB 4HCEA 3F6ZB 2A69C 4JCVE 1WTRA 2KD2A 1G85A 2AT8X 3IL8A 3ZW1A 3MAQA 4RA8A 1JCKB 2QO5A 2UUCL 1XPOA 4MISA 3S2DH 5CYBA 3JAMi 1NCVA 5ISRA 2L9HA 1D5XC 1YBYA 2Y32A 4P74A 3H15A 4IPGA 1AFPA 1VMCA 1CBRA 3JAML 2RF4A 4TKJA 4IUNA 1MSGA 2RSOA 1N9MA 2R93H 3GD7A 1EYDA 3PO2H 2OL6O 2GH7A 4JHQA 3NUCA 3BVZA 1VWEB 5AEOA 1I3QH 3DEPA 4QIWB 1X3EA 3MG5A 1GX8A 4FGIB 1HTPA 3O19A 4O3YA 1N36Q 2EYFA 4R8NA 3PQSA 1DZMA 2K5NA 5DLQE 2A6ED 4EQ5A 1N33Q 3HEJA 3STBD 3BG3A 3B2LA 3NWTA 4TSSA 1OXVA 4B3RQ
chains in the Genus database with same CATH topology
3WJBA 2EJGC 1BOSA 3CR6A 2EE1A 4XXEA 1OXSC 2X8SA 1HFNA 1JZUA 4A60A 1GUWA 4ZHDA 1NP1A 4QF4A 3M4OB 4DAPA 2L11A 3APXA 2NB0A 2B2VA 2FR3A 1F2LA 5CV4A 2R92B 1PRTB 1RODA 1QY1A 3HWDA 3FPUB 1EYCA 3SAOA 4LMQD 4IMOA 5C0NA 4K14A 1JOOA 2F1MA 4ZGFA 4AYHA 4TQ2A 1PFBA 2O62A 4XMGA 4O3ZA 4LAAA 1TS2A 1JWMD 2M9VA 1D1KA 3GTPB 2IX3A 2VB2X 1X8UA 4C3HB 3HGBA 4ZLTF 1KDBA 3HOWB 5IGDA 4KHZA 4ZJ0A 3KFIA 2WEXA 4ZHGA 4V0BA 2WIIB 3QO2A 4ZUIA 3FRPB 1EY4A 2QF7A 1KZWA 3H0GB 1GT3A 2CVRA 5DAUA 3Q0AA 2OVAA 2XKLA 3JSQA 3F8AA 4JGLA 1XKIA 2AL0X 3H94A 2HLVA 5KGUA 1N0SA 4C3IB 5B29A 1HMRA 2OT2A 3ZZVA 3C77X 1WTPA 4ME5A 1AW7A 1PBOA 2FTBA 3IFTA 1ZNHA 2K7VA 2OXPA 2B2UC 4K5WA 4UU3A 1EI5A 4ZHFA 4NP1A 3MC0B 3R3OA 2KQ3A 2A0AA 1HA5A 1IYVA 3OPOA 1SXTA 1EXSA 4ZHCA 3VPJE 5F6BA 3PUYA 4NMZA 2AQ3B 2CM9A 3RZOB 2BE5C 4H44C 2WWPA 1U0XA 4QGXA 4CJ2C 5G3LF 3R2IA 3C1EA 4ZQ3A 5F58A 4K6LA 3AU7A 2NN6H 3S1RB 4PMCA 3PIP3 1XYIA 1KNAA 4RAUC 1IFCA 2NUCA 1DC9A 5J1ZA 3SHLA 2VNUD 1AZQA 1X8PA 1OXUA 2EY1A 3G7LA 4WFVA 1F2ZA 5DM63 5BVQA 4U673 1D3SA 1OEEA 4FF1A 2N88A 3GQBA 3GAQA 4HR7B 4G7ZC 3MA2B 4XYOA 3ITPA 3Q23A 3WDNA 3ZI8A 3HS0C 1ALBA 3TBIB 1GKAA 5JEAJ 5K5PA 1LT5D 2L55A 3NK9A 1A15A 2G78A 2JU3A 2J7ZA 4KKSA 4BA2I 5KNBA 1ILQA 2X8FA 5C4XB 3BLGA 1KZXA 4DAYA 2KOLA 3U03A 1EIGA 1T5EA 4OHJA 4XMHA 3TZDA 3BU1A 4BBSB 1AQBA 3ND9A 5D65A 1O1VA 4H7BA 3Q22A 3GTMB 5I2XA 1Y1VB 2BDOA 1DD2A 3HOLA 3LX0A 4A3EB 3GTJB 5M5XB 4IALA 1FR3A 3SK5A 5JVG3 5F6ZA 4D6AA 3OD9A 4ZH6A 3Q6SA 1SMPI 1G91A 4QNIA 4EQPA 2OF1A 1QB5D 5K36H 2K5DA 5I9PA 1PFMA 3PH5A 4G57A 4U68A 1ZYRD 1KAAA 5EEDA 1TS4A 4MIRA 5B27A 5H9NA 1F9RA 1TIID 2HDLA 3I73A 3NTKA 3BS1A 1A2TA 2HCIA 4I3DA 4GNWA 5C5MA 4RGOS 2EVBA 1XTCD 3A8IE 3NBHA 4OIJA 1R4PB 3K57A 2N93A 2HQEA 2YG2A 2R6GA 3I4LA 3P6EA 1LTAD 1BO0A 1EQVA 1B50A 4BQUA 1KQXA 3VG2A 2IX0A 1ICMA 3NPOA 2XIWA 3U9PC 5D3IB 3KFGA 5D45A 3MBTA 4I9RA 1V1PB 2B8FA 2CQAA 4Z9CB 1HTLD 1E2ZA 2W2BA 1BCPF 1ONLA 3H6MA 2A2GA 1PTOD 2X69A 3D8GA 3MFGA 1B2TA 1WTWA 2ASNX 3U9OA 1BCPC 2K28A 4WORA 1CFMA 1TVXA 2E2HB 1BXTA 2MHVA 2B2WA 5LKEA 1IW7C 2NP1A 1S44A 4O3XB 1G8ZD 3S15B 3H09A 1E02A 4I95A 2F0JA 3WXQA 5HZQA 1RDPD 5ELFA 1IIUA 2Q9SA 5JR8A 4IB6A 2JMBA 4N7DA 2I07B 4TRDA 4PNYA 3FR5A 2CBSA 4YGHA 2Q4NA 1G7NA 1HN2A 4RGTA 3HK1A 4ZAIA 2AH7X 1I4QA 2JA7B 1VF5C 2H4OA 3K7AB 1RHPA 2Q2MA 1CZGA 1D2UA 1PLFA 2F0DA 2IL8A 3QIAA 3K5LA 5DPQA 4K5XA 1OBQA 2QOSC 1S2PA 3AB9A 2G9DA 1SYBA 3J81L 2VUMB 3HTYA 5CC4A 2Q39A 5CE4A 2WKDA 4OMWA 1BEBA 5EGTA 2WV6D 5D48A 5LKFA 4IUPA 1LV9A 2KECA 1Q90A 5FO8B 3CHBD 4Q5VA 5C0XH 3NPPA 4XTCS 3DHQA 2X46A 4NW2A 1RJTA 5HBSA 1HBQA 5H9AA 4QYPA 5HZ8A 3R2TA 5LJCA 4MVKA 1NSNS 5FO7B 1TR5A 1SE2A 3TZSA 5BVSA 1GXAA 3SEBA 1ZNKA 1I6HB 3FR4A 5J39A 1ZKOA 2K1BA 3TN2A 1A2DA 4YDBA 3FVQA 5C3WA 1WD1A 2NNQA 3ZUOA 1D1IA 1L0YB 2NZ1D 1LIFA 1VYGA 3VE1A 2JYOA 1BCPB 5HZ5A 3K5OA 4KI0A 1SYFA 1S5DD 4UU2A 2F0IA 1A3VA 3I3CA 2FINB 4ZYSA 4PJ2A 3TP7A 1GGLA 2RQ0A 4L3RA 1Y1WB 4YFRA 4IFDG 2PZTA 4KHVA 1DFVA 1I4UA 1OPAA 1KDCA 1ZNGA 3O13A 4V190 2IX1A 4AZMA 5KYIA 2EPBA 4OIKA 1JV4A 4IUUA 4KD3A 5FLXE 4KY5A 1EPBA 4QZUA 3STMX 4I6SA 3A7LA 2QILA 4AZNA 4IFDI 2A68C 4AW8A 5CMDA 2F0WA 3S14B 3VG6A 1SEBD 4QCLA 2E2DC 2WEWA 1QILA 3N52A 4FBRA 4HPDA 1GUTA 3T51B 2A6HC 3SR1A 1NR4A 3PECA 3H91A 4JBWA 1II3A 1PFNA 1ZXTA 1D2BA 1DONA 1XXGA 1Z6HA 3DXJC 1Q12A 2SNSA 4XQQA 1YNNC 5FO9B 5BN5A 5FKAC 1DOLA 1SYDA 4DAVA 1X3PA 2EY6A 2XSTA 2RN4A 3B2JA 5LJGA 3V05A 3LV4A 4R0BA 1PMRA 3X3NA 3DSZA 1ZYRC 3FEWX 3KLSA 4ZCBA 1RLBE 2BA1A 1PZKD 4ZR2A 1YWAA 1S5BD 4ULLA 1FENA 3SK6A 1I4XA 3MZ5A 4HSVA 4QYNA 1H9JA 2PNRC 3U0DA 3HOZB 3FMZA 4I3BA 1M8AA 1SDFA 3A8JE 4I65A 4A93B 3TP6A 4CKBA 4DGZA 1LTID 2BT9A 2TSSA 4NDXA 3P02A 2QEJC 4FF3A 3QJYA 5LL6X 2JW1A 2W2AA 5EPKA 2F0MA 1EY9A 2RDGA 2ZXOA 1A2UA 5CBEE 4X3UA 4ORXA 2F0NA 3J80E 2BLGA 1H9MA 3A55A 2Z4IA 3H3VC 3M3YB 1EZ6A 3UEWA 5LJBA 5H9LA 5IO7A 2FMCA 1LIBA 4BWGB 2OFRX 2B8GA 3RBYA 1Q8IA 5EDBA 4IB7A 1FGBD 4XQJA 3B2HA 2FT9A 3BZDB 4INNA 5EQ0A 4ZGUA 2E4JA 3K0YA 4YDAA 4WHIA 3NADA 3NQKA 4XT3B 4I9SA 5C3XA 4O42A 1TQOA 1PEEA 1TWHB 5BN3A 1IHZA 1PTOH 2RD7C 4IB8A 2Q2PA 3EROA 4ES7A 1UREA 3S1NB 3IFDA 3PUZA 4A3BB 1SMYD 5CV8A 1GT5A 3KLSX 3CBSA 5M5WB 4ZKBB 3PPTA 2BCOA 1C48A 3HOUB 5DNFA 2QO6A 4YGZA 1ENCA 3Q6LA 3A54A 3UI2A 3ZW0B 1GUNA 4G4KA 1STYA 4A3JB 1EWCA 1KDAA 3QWNA 1U4PA 4ML7B 1F2YA 4KD4A 2B2TC 3CBCA 3SDZA 5C4JB 4C1NK 4DNTB 2WACA 1H91A 1GJXA 1HQRD 4KC8A 1HUMA 2EDGA 1AP0A 1T8VA 2KW1A 4IZ8A 3ZYYX 4FP5D 4A1HA 1YIVA 3T1DA 1KT6A 3ND8A 2HUGA 3FR2A 3BU9A 4QGWA 5HWZA 2QMIA 2R73A 1X71A 1EIIA 1TS5A 2A74C 2WP8J 4O3WA 5JPNC 1DV9A 3NTIA 3FW5A 1I06A 1H9RA 2KT4B 2LFNA 3FKIB 5IO5A 1BQQT 1PM1X 4LZVA 1AN8A 5IT9E 3C78X 2M4LA 2RA6A 3NWTA 4DF7A 3CQNA 3T16A 4KY7A 1SAPA 2EOTA 4C3HG 1ENFA 4FF2A 5JAVA 4PMBA 1LLRD 1TOWA 1YNJD 2L4NA 2B2WC 3VG4A 4KKUA 1SFOB 3MXGA 2MM3A 4A8ZA 2RDFA 2EYPA 4ID2A 2JA6B 1Q1EA 3DWQA 1V43A 1SNDA 1CHQD 4C1NI 3KBXA 2QCPX 5F7GA 2WUTA 1X8QA 4C3IG 1EY5A 1X32A 4ABNA 4FNFA 4FXGC 2GTLO 2QDBA 1LABA 2D2CC 4G7OC 5HCEC 1SYCA 1BUVT 3S9WA 1WVLA 2B2YC 3J7AF 1EEID 3NSWA 1CZWA 1A3UA 5M3FB 2N55A 3QKGA 3NBIA 1LICA 4JK1C 2EYMA 1EL0A 2RCQA 1BRPA 5C4ZA 2WAQB 3HP3A 1HFGA 1LTGD 3EFXD 4CSBA 3S2DB 4HMJA 2AQ1B 2PW5A 4H13C 3RZYA 3WJDA 2F0KA 2F0EA 1MGSA 3NXWA 4NP5A 1EW3A 4OL7A 5IGEA 3X3MA 4B9WA 3MWYW 2R93B 3PO2B 4IB9A 4XMEA 4TJZA 1I3QB 1JICA 1UUPA 3UAQA 3BDOA 3P75A 1HA6A 1SY1A 4HN7A 2LY7A 3HWGA 2CW0D 3D97A 4YBPA 2LFOA 1E5PA 4DNRB 1LTBD 3K5MA 4YFPA 2FJ2A 4RCNA 3VR4A 1SY0A 1STBA 3FELA 2ICIA 4K8IA 1BR9A 1TWFB 3HKZB 5I2YA 2F0PA 5LL6S 4MN3A 1HQMC 3EVQA 1G291 4L8JA 4IABA 5KIDA 1A3TA 2K32A 4CBVA 1LPJA 1PYWD 5F1EA 2ACPX 1EUOA 3KUPA 3MHBA 1EQTA 3GV6A 3FLLA 2FS7A 3E6ZX 4HWMA 2AWNA 4FXKC 3B2IA 2HZRA 1HBPA 2R74A 2L5PA 3PUXA 2GA4B 2Z4HA 1DZKA 3CQZB 2KA7A 1KT7A 3V2TA 1T68X 3M85A 4Y7NB 1NR2A 4IUTA 3I90A 2BS6A 1S4ZA 3MFYA 3S2HB 2LMCB 3W3AA 3JAME 1TS3A 3DMUA 1JOQA 1RF2D 1VF7A 4OGQC 2NVQB 2O5IC 4ALBA 2JA5B 4F8MA 5A2QL 3T4AC 4UDUC 1LIDA 3QB3A 1CBQA 3T13A 4CJ0B 1DM0B 3PO3B 4TLJA 2NBFA 1Y8OB 4OO1G 3APWA 5E3FA 4IMNA 5E4WC 1HHVA 1HMTA 1FD7D 5E4XA 1BF4A 3B2KA 3QOJA 1Z47A 4WFUA 1KGLA 4OO1I 1FELA 3G6JB 4FQBB 2ALLX 5EZ2A 4ILWA 2ZAGA 3W2DA 1JJJA 1SSOA 4OO1H 4IAWA 2CZUA 4DXGA 4LQZA 4F88A 5JEAG 5CYUA 2Q8TA 3WBGA 2XWBB 1CK1A 5I6WA 2PZWA 1X89A 3F9DA 4RHRA 5FK9C 1SY2A 2A3FX 1YNJC 4DA2A 2PW7A 3R8BA 1DZPA 1NGLA 2MJIA 2NTSA 4MIUA 1KABA 4HPCA 1I4RA 3FMCA 1OXTA 3DWPA 3C76X 5KNCA 1DXMA 1LTSD 2E2IB 4ON1A 4X3TA 2A6EC 4E6IA 5IO6A 1B44D 3SK8A 1WTVA 5KHPA 4KTAA 2KJXA 2ID0A 3PUVA 1IKMA 2CBRA 3DWAA 2HCCA 3D6CA 5JOBA 5D47A 1R0UA 1GT1A 5EEEA 1KLGD 3STKA 2F09A 1JOKA 1B1ZA 3L7ZC 3OBLA 2AUKA 1GHKA 1EY7A 2F0SA 1BSOA 3VE2A 3MXPA 4EQAC 5CV7A 3GTOB 2ZXRA 3HOYB 4Y0SA 1CT1D 4B9XA 5FQ8E 1SXXA 1JB3A 2WSJA 2RSNA 5M9OA 4RFBA 4O9SA 2K5QA 3LWUA 2NVTB 5LJDA 1GHJA 1KTKA 1CJ5A 5EJWA 3BY0A 3KFHA 4O1NA 3GTGB 1U17A 4RKBA 3L4RA 4IN3A 2F4IA 3T56B 1LFOA 4RKLA 3O22A 3T53B 2X6GA 5HURA 5C0XJ 3KBGA 1SYEA 1FDQA 4N9PA 4EFGA 4KJNA 1NUCA 5D14A 1Z24A 3PEDA 4CJ1B 5FAZA 1TWAB 2E74C 2EJMA 5H9KA 4LK1C 3BS2A 2RKSA 4LKTA 4DXFA 2K04A 1O8VA 3CU7A 2MGSA 5EDCA 4CV7A 3LWEA 1S5ED 2EXZA 4L63B 2SNMA 3BDRA 1STGA 1JQYD 1TY0A 4C3JB 4KK7A 3C2PA 2JEAI 3VG7A 1E2VA 3NX2A 4HPBA 3FEPA 1MSHA 3EMMA 2PY1A 2ZT9C 2JOZA 3H3IA 4RGNA 3ZWEA 2MO5A 3OMCA 3I70A 4LZUA 1EY0A 2HDMA 5COYA 3I8ZA 1X3QA 3P6GA 3J7AV 5C4HA 5H8TA 3WJCA 3VA7A 5EBDA 4HAEA 4XMDA 1SXWA 3P20A 4NYQA 2RQXA 3K6OA 3MVFA 3OWEB 2GJ5A 1PRTD 4U8UO 1EYAA 2F0OA 3NWSA 3C3LA 1QFTA 4EEJA 2PYKA 4TKBA 1E2WA 2WKCA 1GM6A 4WFN3 5EKLA 5KNDA 4AZRA 1IFBA 3S1QB 2F0FA 1I50B 3A56A 2AKQA 4GK9A 2EY2A 3KF8A 3OIQA 2JSOA 5L8IA 4XIGS 4A3MB 2F3VA 1S5CD 2B2VC 3L3OC 3NQ9A 3UEVA 3GTKB 1DYQA 2M2LA 2HYSA 5LJEA 2O2LD 4OMXA 4O4UA 2K23A 5IGGA 4ALOA 1IKLA 1U9RA 3OMGA 3SXHA 1BRQA 4ZH9A 1QWYA 4I3CA 5C5LA 2KTDA 1BWYA 4QQ1A 2AUJD 4DN4M 2R7ZB 3TP5A 2WB1B 3NQTA 1MBYA 3HG9A 4DFAA 2B2UA 3GTQB 3ERQA 4ID6A 4BOEA 1U4LA 4IFDH 2DNCA 2AT3X 4ZHHA 3PV0A 1PZJD 3WVMA 2NWGA 2O4XA 1WTOA 1E06A 1H9SB 2XNAC 2JU7A 3TZUA 1ZRYA 5JVH3 3FA8A 3MXNA 1ICWA 4S3SA 3ZW1B 2AT5X 5LJHA 3CMPA 4FO2A 1IKEA 2MPMA 4YCEA 3GE2A 4L6TB 1V1PA 4G7HC 4ORRA 1G6ZA 3SVMA 3K3LA 1QE6A 2PZUA 4D6BA 4IUVA 1DZJA 2LKKA 1ML0D 1ZNLA 3TDQA 5TSSA 4MVEA 2F0UA 5HA0A 3V96A 2MHDA 3CRKC 5ELDA 1KT3A 3J81E 4R9WA 5JPMC 1DOKA 2M00A 3D31A 2RA4A 1PTOF 5AJCA 3EM0A 5KRUA 1CQFA 5T1GA 3FIQA 1PTOC 1K8OA 3E3CA 5AQ6A 3OOCA 1F9PA 1D5MC 3N6RA 4GU8A 5L8NA 4F87A 4F7XA 2K62A 3WJEA 3KLRA 1D6EC 1L0XB 2GTFX 4UAIA 5ELEA 3CQRA 3DEOA 1U18A 3HWEA 3S17B 1E00A 4CHTB 1V8QA 4YKOA 1U4MA 2NVYB 2E2JB 3BX8A 1UEAB 2RBMA 1MI2A 1QABE 4N7CA 1HPCA 1ERBA 2OVDA 2H1EA 1EALA 2LBAA 4HPAA 2MJ8A 2EYLA 3D6WA 2NNDA 1B4OA 3HRZC 2X45A 1JORA 1QWDA 2CM4A 2KEDA 1J8IA 2ZXPA 3QOLA 4IBAA 2R3ZA 2WQAE 3MTSA 2F0QA 2F0TA 2OZQA 2IJ0A 4GZYC 2F0VA 4YH0A 1GUOA 2SOBA 2XVSA 1WD0A 1LKEA 2LS01 2ANSA 4XQNA 2BE5D 3SK4A 4QUCA 3D95A 5CORA 3HOVB 1I4GA 3R93A 1P6PA 1TW4A 2A13A 2POAA 1O7ZA 2L67A 5M3MB 5C6AA 4DQ3A 4KKTA 5BN4A 1F9QA 2BOSA 3HOXB 3IKJA 4CKCA 3S60A 1LNMA 3RD4A 2P8GA 4A3KB 4A3GB 1VYFA 3BSZE 1LO5D 5ELBA 1Y8NB 2FWVA 1MUPA 3P7JA 2L68A 1XWEA 2SEBD 3MXUA 4BS9A 1F77A 5IGFA 2PMZB 1PTOB 2DM5A 3VA5A 2BDNA 3NHHA 3OSOA 4QUFA 4YKMA 2F0LA 2F3WA 3UEUA 1T5XD 1ML7A 4DU9A 2Y0SB 4MVLA 3STNA 1GXDC 4WJWA 3JS1A 3C46A 3I4NB 4FYDA 4O4SA 1B8EA 1M4VA 2IWHA 1GKAB 2HMBA 1CRBA 2IT1A 1Q1BA 1I04A 1LT4D 3GP7A 2IPKD 2EYOA 2X8TA 1MX7A 2FRSA 3E0JA 3E5SA 4CK4A 1KNEA 2OEOA 3OWFA 1BBXC 1CM9A 3DTQA 4FBOA 3OIPA 1KXOA 2FLJA 2JU8A 4K6DA 5E1FA 4NYRA 1LT3D 1RTOA 3EBWA 1OO9B 5KIXA 4ZFXA 3SE0A 2JP1A 4GETA 4J8QA 2KTSA 5DEHA 4A1YA 2TMPA 1HRJA 2ICEC 1L6MA 2J0TD 4EGVA 4GE1A 4KN7C 2LB6A 1LF7A 1OPBA 3OJYC 3D4WA 1KQWA 1ESRA 2QM9A 3UEXA 1FEMA 3NE5B 1ET9A 4X3KA 2QO4A 4YIJA 3HOEA 4GZVA 4XT1B 2AWOA 1TU2B 1SBBB 1QJOA 1IW2A 1SJHD 1GX9A 3FPPA 2JA8B 4HMIA 1YUPA 3RSWA 1B0OA 2ZAIA 1GOZA 5CV6A 2XN9C 1BCPD 4A3IB 1CQVA 2NVXB 1ZNDA 3K5NA 5IGBA 2LA7A 1YWCA 1IW7D 1TOUA 3P6HA 5EKKA 1FTPA 5LJKA 3Q24A 3APUA 4IURA 2PPBC 3GO5A 2W2FA 2E75C 4ORYA 5CR3A 5FENA 1YWDA 3BVGA 4M8AA 3I17A 2KUMA 3HZXA 5KICA 2ENBA 1U4RA 5DG4A 2L0CA 5D4AA 3S1MB 3VG5A 2XSCA 4K19A 4QB4A 1ENAA 4QAEA 3P6FA 4PSQA 3DM1A 1HQPA 1ACDA 5IODA 4ODDA 2DNEA 1O78A 1B4MA 4O4OA 5ELCA 1X8NA 3ZW0A 2PQEA 4K8JA 3NP8A 1MVGA 1UZ2X 2KEEA 1B3AA 3BDCA 1STAA 3WOEA 1G2TA 1STNA 1UNSA 2EY5A 2NN6G 4NKLA 1JE4A 1SMYC 2FHTA 2AMMX 1Q3LA 4KY6A 3AKMA 2WQ9A 1AB0A 4ZUJA 3VR3A 3AKNA 4ORUA 1SNPA 1LTTD 3F2UA 1EEFD 1O80A 1B9MA 1C4QA 4WRDA 3M7GA 1EIOA 1VMPA 3C1FA 3PP6A 4RHSA 2RVLA 1EU3A 2NN6I 2L9CA 1IL8A 1QNUA 4RWSC 2PCFB 4DK1A 1KOIA 1TVQA 5L8OA 3FDTA 3FENA 1FNUA 1KLUD 1ZNEA 5HZ6A 2OVSA 1C8CA 1YP6A 3RZDB 1R4QB 2F0HA 2R56A 2R61A 2OVEA 4FVMA 4KMUC 4C56C 1DOMA 4KCAA 2JXMB 1ICNA 3MX7A 3PH6A 1W6KA 5FFHA 1NAPA 2EU7X 3TGBA 1JWSD 4O4XA 5LHY1 2K05A 2B63B 3M4YA 2JEBI 4YBUA 1SJED 2VB3X 5I4DA 3VU1A 4IAXA 2LKVA 5IGCA 4OS8A 4ZRZA 4XMFA 4KT5A 1O7LA 5HZ9A 5HCDC 2AQ2B 4MVIA 3VYUA 1JIWI 5IIFA 3KK7A 3S26A 1QCBD 1QFVA 3D3RA 3PUWA 3HWFA 4TQUS 3GV3A 2A68D 4IUQA 1ZEQX 4HFOA 5K36G 1AEXA 4YMYA 1QY2A 2A6HD 3K58A 2DN8A 3L9AX 4A3DB 4GNYA 2HNXA 1AZPA 2RDHA 3V8UA 1STHA 1UAPA 2XWJB 5JEAH 2RCTA 1YNND 5HGTA 3IAYA 2B2TA 4FF4A 4TKOB 3FEKA 2A2UA 1BSQA 3FA9A 3WOFA 3WOVA 4KN4C 5CGKA 1SNOA 4C3JG 1F9SA 1SNQA 1V1OA 3GTLB 5HTEA 1EZ8A 2MP1A 4COTA 5CV5A 1W6JA 5IOCA 3D4DA 1QG5A 3WJFA 5CV9A 3P6DA 3EQLC 2L12A 4C2MB 3ZUIA 4U8UN 5FLXL 4NW4A 1RD9D 4RCOA 3MEHA 1CTMA 1Y9TA 3S5VA 4ARHA 3BVMA 3RLFA 3A7AB 2OFMX 4Y0RA 1CA6A 1SNCA 4CKEA 5NUCA 1SE3A 1EQDA 4RGMA 1YP7A 4OS3A 3BDLA 3EBKA 3N91A 4HTHA 4K2LA 2JE6I 1I05A 5T1IA 2YU9B 3D4RA 5EKIA 2JN3A 3OE3A 3I91A 4AZOA 4QMGA 1A18A 1AELA 4ORWA 4TNNA 5K06A 1IYUA 2CW0C 4QZTA 4U8UM 1FNWA 1QNKA 3TGAA 4FXDA 3EA6A 2Q8RE 5A2QE 1CBIA 1R9TB 3WJGA 1FNVA 3RWXA 2J4XA 2CZTA 4AYBB 4EVOA 3MVVA 1T0VA 4RUUA 2D62A 4HEDA 2F03A 4KIIA 1QQSA 1EPAA 5D3DA 1QY0A 3NQIA 3ZQ3A 1G2SA 2C5CA 1YWBA 5C3EB 1BLRA 4PQXA 1G5WA 5HCCC 1FYCA 1WTQA 4RH6A 2B2YA 5C0XG 2BA0A 1TWCB 4BA1I 4R8IA 2D5DA 3CRLC 5FQ7E 5BYPA 3J7YW 1A57A 1CA5A 5CBAE 1RTNA 1S5FD 2F0GA 4ZK9B 5KEEA 1A3YA 5JJZA 3NBXX 5C0XI 1STEA 3SOTA 3J80L 4KH8A 4M6SA 4I7ZC 4B08A 1DZ1A 3P24A 3FA7A 3TP8A 1BBPA 3AMUA 3O2YA 4ZKCB 1BDOA 1EY8A 4IFDJ 1EFID 2NTTA 1PMPA 1K8MA 3VR5A 1WTXA 2SDFA 3KFFA 2IW3A 4LJZC 1LIEA 1S7DA 1JWUD 1Y69U 2XRSD 1GUSA 1ESFA 2FFKB 2HZQA 1IKJA 5BVTA 4AZPA 2DY8A 1ET6A 4CGYB 1WCMB 3EJIA 5C44B 2EYHA 1DJRD 3ELXA 3NR3A 2MUYA 3VR6A 3PIO3 4EXZA 2G79A 1ERXA 2A69D 2XRQD 2Z1CA 5EPJA 2K33A 2L5TA 1VPRA 2BS5A 3TSSA 1J9OA 3CKIB 3ELZA 4XYQA 1JC7A 1KT5A 1Z7TA 4AZQA 1GT4A 4QRLA 2D9UA 5HA1A 2KCNA 5KYLA 1F2MA 4PV1C 3VR2A 5HTDA 3QG1A 2VXWA 4XMCA 3BYTB 1OXVA 4A3FB 4HSPA 4RUNA 1SXUA 3U9SA 3BX7A 3S5XA 3KZAA 2E76C 3NQ3A 4KC7A 1DCZA 2V4DA 2Z8LA 3ZW2A 1QOHA 1XX8A 1CHPD 4ORSA 1VDZA 1CBSA 1B53A 1DF3A 4HCSA 2WR6A 3JQOA 4YGGA 2X6LA 3DUZA 4N9TA 3KQ0A 1JJXA 4FBVA 1CI3M 2DY7A 4M1UB 4IQZA 2NYZD 1A6XA 4QGVA 1AVGI 2I46A 4Y0QA 1SYGA 4KJOA 4DQ4A 1OEJA 3PQUA 5EPQA 2FMMA 4YFQA 1TXLA 3BYYB 5AFWA 3NTHA 3TF6A 1MD2D 4EQNA 4BBRB 2LBVA 2PO4A 1TWGB 5IT9L 1I4PA 4O49A 5AJBA 1BM5A 2WINB 4NLJA 5FOBB 1E0BA 1TKWB 4P2CB 5I9OA 4U9CA 1FE3A 3FA6A 1HMSA 4H0LC 2K6AA 4GH7A 1EWHA 4NNSA 1JBHA 3I0AA 2QKIC 1HUNA 3OW7A 1Y8PB 3LNNA 1SXYA 2C9OA 1SY3A 1K83B 2A5HA 1OBPA 3BRNA 2KVMA 1JYDA 1O1UA 3RUZA 5FQ6E 1JYJA 1MDCA 3URYA 4YCHA 3VYTA 3RKGA 1NP4A 4OS0A 5I6YA 1G74A 1RKNA 5D8JA 1SE4A 1EIHA 4BVMA 5HAEA 2L1BA 1TT2A 2B39A 2K01A 4KV6A 4GRJA 1SA8A 4TKHA 5J22A 2K5WA 3S16B 2FS6A 2NNEA 3OHXC 2Q8IB 1LT6D 4U3QA 2KHSA 5EBCA 4NLIA 4DK0A 4Y0PA 1LACA 1OEKA 4EQOA 3APVA 2AT6X 3EYCA 1I6VC 4X3SA 2EZVA 4PMWA 1SNMA 1ILPA 1Y9LA 1EOTA 1I4HA 1HCZA 1B56A 2A73B 4K2KA 1ADLA 5M5YB 3CWKA 2G7BA 3D96A 1RBPA 2IFBA 4WBKA 2GTLN 4NNTA 3VYRA 4K5VA 3NP1A 5DM73 1PZID 5G3LD 4GDZA 3P1HA 3P6CA 2KCCA 2FR2A 2YMSA 4LKPA 1BSYA 5EPLA 3VYSA 1PXUA 4M7MA 2MWHA 3I72A 2G9HD 3I4MB 1BNZA 1X8OA 3IFBA 1PRTF 3TMEA 1RCVD 1OXXK 4ODGA 3A8KE 1OBUA 3RMHA 1PRTC 3VG3A 1MX8A 2ACOA 1KT4A 4GKCA 1VCIA 1EY6A 1JR0D 2O5JC 3NX1A 2YYZA 3IA8A 2GC9A 3LHNA 2BHVA 4L1NA 5A35A 4BY1B 3K59A 4BY7B 1TY2A 2GTLM 1GUGA 3PMFA 1QG7A 3FW4A 2AT0X 2EJFC 4MHEA 4EDEA 4Q0FA 2CHBD 1H9KA 1LTRD 3TGCA 4J6HA 2K03A 1XCAA 1D5ZC 2EYJA 1EU4A 1BJ7A 1PDQA 3FYFA 1B9NA 3G7XA 2F73A 1H9SA 1HXYD 1O7YA 5F2DA 3M7NA 3ONAB 4HCEA 3F6ZB 2A69C 1WTRA 2KD2A 1G85A 2AT8X 3IL8A 3ZW1A 3MAQA 4RA8A 1JCKB 2QO5A 4MISA 5CYBA 1NCVA 5ISRA 2L9HA 1D5XC 1AFPA 1VMCA 1CBRA 3JAML 4TKJA 4IUNA 1MSGA 2RSOA 3GD7A 1EYDA 3NUCA 3BVZA 5AEOA 3DEPA 4QIWB 1GX8A 4FGIB 1HTPA 3O19A 4O3YA 2EYFA 4R8NA 3PQSA 1DZMA 2A6ED 3HEJA 3BG3A 3B2LA 4XDXA 4TSSA 4J1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9S A;  2B8F A;  1HQM C;  2EJG C;  1Y8N B;  2B8G A;  1G29 1;  1E2Z A;  4L8J A;  3FMC A;  1OXS C;  2K32 A;  2E76 C;  1ONL A;  1OXT A;  3PUW A;  2PPB C;  1OXU A;  2D62 A;  2E75 C;  3MXU A;  4TQU S;  3VA7 A;  2A68 D;  1DCZ A;  2V4D A;  1DXM A;  5KNC A;  4IFD G;  3CRK C;  2KCC A;  3GQB A;  3P20 A;  4KKU A;  1VDZ A;  4HR7 B;  2A6E C;  1CFM A;  5K36 G;  4G7Z C;  1IW7 C;  1CI3 M;  3D31 A;  1FYC A;  3WDN A;  4IQZ A;  1Q1E A;  2A6H D;  3PUV A;  3A7L A;  1E2W A;  2DN8 A;  3I72 A;  1V43 A;  5C0X G;  1A6X A;  5BN3 A;  3PUX A;  1K8O A;  2A68 C;  2BA0 A;  3L7Z C;  2KA7 A;  3OOC A;  2AUK A;  5KND A;  4BA1 I;  1GHK A;  2D5D A;  3CRL C;  3N6R A;  1OXX K;  3M85 A;  3A8K E;  2F1M A;  3PUZ A;  2DNE A;  1O78 A;  5JEA H;  2IT1 A;  3MFY A;  1GUT A;  1IW7 D;  4KKS A;  4BA2 I;  5KNB A;  2LMC B;  1VCI A;  1Q1B A;  3KLR A;  3W3A A;  3T51 B;  4XIG S;  2O5J C;  1LAB A;  2A6H C;  2YYZ A;  2D2C C;  4TKO B;  4G7O C;  3HGB A;  4JBW A;  5A35 A;  1T5E A;  1VF7 A;  1VF5 C;  4I7Z C;  1GUG A;  4OGQ C;  4KHZ A;  1V8Q A;  4KN4 C;  2O5I C;  1Z6H A;  3ND9 A;  3DXJ C;  3LWU A;  1Q12 A;  1TKW B;  1GUN A;  2NN6 G;  1GHJ A;  1SMY C;  2EJF C;  1YNN C;  4H0L C;  2QF7 A;  1HPC A;  1BDO A;  3QIA A;  1EWH A;  3VR3 A;  2BDO A;  5BN5 A;  1H9K A;  1DD2 A;  1B9M A;  1Y8O B;  1K8M A;  2AUJ D;  3VR5 A;  4OO1 G;  3AB9 A;  3T56 B;  3OW7 A;  4JK1 C;  1FR3 A;  1Y8P B;  3EQL C;  3LNN A;  1PMR A;  4LJZ C;  1B9N A;  1Y69 U;  1ZYR C;  3T53 B;  4IFD H;  1GUS A;  1H9S A;  2DNC A;  3SDZ A;  3H94 A;  2NN6 I;  3PV0 A;  4H13 C;  4DNT B;  2BA1 A;  5K36 H;  3SE0 A;  1GJX A;  3M7N A;  2PCF B;  4DK1 A;  2A69 C;  1H9S B;  1Q90 A;  2EDG A;  1CTM A;  4KN7 C;  5C0X H;  4GZY C;  1H9J A;  3TZU A;  2E74 C;  1GUO A;  2EJM A;  3IFT A;  2PNR C;  4LK1 C;  4XTC S;  3A7A B;  3RLF A;  3VR6 A;  3I73 A;  2K7V A;  2BE5 D;  3BDO A;  3ND8 A;  4KMU C;  2A69 D;  3A8J E;  4OO1 H;  3NE5 B;  2K33 A;  2L5T A;  2EVB A;  2AWO A;  1TU2 B;  2JXM B;  3A8I E;  5JEA G;  3GD7 A;  1QJO A;  3OPO A;  1IYV A;  2Q8I B;  1Z7T A;  3PUY A;  4DNR B;  2JE6 I;  3FPP A;  4DK0 A;  1ZKO A;  1LAC A;  3QJY A;  4KKT A;  5BN4 A;  2R6G A;  2JEA I;  3M4Y A;  3D4R A;  4RCN A;  3I4L A;  1E2V A;  1HTP A;  3IKJ A;  1H9R A;  2JEB I;  2BE5 C;  4H44 C;  4PV1 C;  3VR4 A;  1I6V C;  4G7H C;  3VR2 A;  2ZT9 C;  3QG1 A;  1H9M A;  1YNJ C;  2NN6 H;  2A6E D;  1O7L A;  1IYU A;  2CW0 C;  1HCZ A;  3BG3 A;  1OXV A;  4KI0 A; 
#chains in the Genus database with same CATH topology
 3WJB A;  2EJG C;  1BOS A;  3CR6 A;  2EE1 A;  3CCL A;  2RTC B;  4XXE A;  1OXS C;  2X8S A;  2MFI A;  1HFN A;  1JZU A;  4A60 A;  2RTI B;  1GUW A;  4ZHD A;  1TWF H;  3K81 C;  2MNA A;  1NP1 A;  4QF4 A;  4DV4 Q;  1JMC A;  3M4O B;  4DAP A;  4Z2V A;  2L11 A;  3APX A;  2NB0 A;  4X6A H;  4OX9 Q;  4X66 Q;  1QZG A;  2B2V A;  2FR3 A;  1F2L A;  5CV4 A;  2R92 B;  1PRT B;  5BR8 L;  1ROD A;  1QY1 A;  1PBY A;  3HWD A;  4IPD A;  3FPU B;  4L5Q A;  1EYC A;  3SAO A;  1P16 A;  4LMQ D;  4IMO A;  5C0N A;  4K14 A;  1JOO A;  3ULJ A;  2F1M A;  4ZGF A;  2G5L A;  4AYH A;  4TQ2 A;  4KHP Q;  1PFB A;  2O62 A;  4XMG A;  4O3Z A;  4LAA A;  1TS2 A;  1JWM D;  2M9V A;  3CQZ H;  1D1K A;  3WYP A;  3GTP B;  3KJP A;  2IX3 A;  2VB2 X;  1X8U A;  4C3H B;  3HGB A;  4P72 A;  4ZLT F;  1KDB A;  4Y7N H;  3HOW B;  3CCJ A;  5IGD A;  4KHZ A;  4ZJ0 A;  3KFI A;  2WEX A;  1C9O A;  3FHW A;  3S2H H;  4ZHG A;  4V0B A;  1N7Y A;  2WII B;  3QO2 A;  4ZUI A;  3FRP B;  1EY4 A;  2QF7 A;  1KZW A;  2B63 G;  3H0G B;  1GT3 A;  4JBK A;  2CVR A;  5DAU A;  3Q0A A;  4EKV A;  2OVA A;  2NVQ H;  3QR8 A;  5IWA L;  2XKL A;  2JA5 H;  1VQ5 A;  1NBX A;  3JSQ A;  1GKH A;  3F8A A;  4JGL A;  1XKI A;  2AL0 X;  5IYD G;  3H94 A;  4MTK A;  2HLV A;  2Q2T A;  3PO3 H;  5KGU A;  1N0S A;  1KAW A;  4C3I B;  5B29 A;  1HMR A;  2OT2 A;  2VQE L;  2RTQ B;  4UP8 A;  4AYB E;  3C77 X;  3ZZV A;  1WTP A;  3T6F A;  4ME5 A;  1AW7 A;  4AQY Q;  1PBO A;  2FTB A;  3IFT A;  1ZNH A;  1QUQ B;  2K7V A;  2OXP A;  4GNX A;  2B2U C;  4K5W A;  4UU3 A;  1EI5 A;  3W1B A;  4ZHF A;  4NP1 A;  3MC0 B;  4YY3 L;  3R3O A;  2KQ3 A;  2Z6K A;  1Q82 C;  3A0J A;  2A0A A;  2QOM A;  1HA5 A;  5GAE C;  1IYV A;  3OPO A;  1SXT A;  1EXS A;  1T9H A;  4ZHC A;  3VPJ E;  5F6B A;  1XTD A;  3PUY A;  3PDF A;  1HNX L;  4NMZ A;  2AQ3 B;  1GM5 A;  2CM9 A;  3RZO B;  2BE5 C;  4H44 C;  2WWP A;  1U0X A;  1FL0 A;  4CJ2 C;  5G3L F;  4QGX A;  1SRE A;  3R2I A;  3SLO A;  3C1E A;  4ZQ3 A;  5F58 A;  4K6L A;  3AU7 A;  4JBM A;  2NN6 H;  3S1R B;  1K8A C;  4PMC A;  3PIP 3;  1ASZ A;  3ER0 A;  4YHH Q;  1XYI A;  1KNA A;  4RAU C;  2FGS A;  1IFC A;  2NUC A;  1DC9 A;  4POF A;  3ULP A;  1VQD A;  3G48 A;  5J1Z A;  3SHL A;  4DK6 C;  1EIY B;  2VNU D;  2X34 A;  1AZQ A;  1SRU A;  1X8P A;  1OXU A;  2EY1 A;  3G7L A;  4LFC L;  1F2Z A;  5DM6 3;  4WFV A;  5BVQ A;  4U67 3;  1D3S A;  4QGU A;  1OEE A;  3K80 C;  4FF1 A;  2N88 A;  1YEZ A;  3GQB A;  3CCM A;  3GAQ A;  4HR7 B;  1MOY A;  4G7Z C;  1VWB B;  3MA2 B;  4XYO A;  3ITP A;  3Q23 A;  1VWG B;  3WDN A;  2K50 A;  3ZI8 A;  3HS0 C;  1MHW C;  2ZTE A;  3TBI B;  2E2I H;  3BU2 A;  1ALB A;  1GKA A;  1VWQ B;  3KF6 A;  5JEA J;  5K5P A;  1LT5 D;  1JJC B;  2L55 A;  1YZ6 A;  2UUB Q;  3NK9 A;  3WWV A;  1A15 A;  5AJ3 Q;  2G78 A;  2JU3 A;  2UYW A;  2J7Z A;  1WYD A;  4H02 A;  4KKS A;  3CKG A;  4BA2 I;  5KNB A;  1ILQ A;  2X8F A;  5C4X B;  3BLG A;  1KZX A;  4DAY A;  2KOL A;  3U03 A;  1EIG A;  1T5E A;  3KF8 B;  4OHJ A;  1NC9 A;  3TZD A;  4XMH A;  3BU1 A;  4BBS B;  1AQB A;  4OXP A;  3ND9 A;  5D65 A;  3HOY H;  4DR6 L;  1O1V A;  1SWL A;  4H7B A;  3Q22 A;  4JI7 Q;  3GTM B;  5I2X A;  1Y1V B;  2F4V L;  2BDO A;  1DD2 A;  1X55 A;  3HOL A;  1STS B;  3LX0 A;  4GN3 B;  4A3E B;  3GTJ B;  1KL9 A;  5M5X B;  1IBM L;  4IAL A;  1FR3 A;  3SK5 A;  5JVG 3;  5F6Z A;  4JI3 L;  2NVT H;  4TVA B;  4D6A A;  3OD9 A;  2IZI A;  2R7D A;  3Q6S A;  1SMP I;  4ZH6 A;  1G91 A;  4QNI A;  4EQP A;  2OF1 A;  4JI1 L;  1QB5 D;  4DUZ Q;  4DV2 Q;  2K5D A;  3KDF B;  2XTI A;  5I9P A;  1PFM A;  4YWM A;  4YWK A;  4LFA L;  1CSQ A;  1Y53 X;  4DV6 Q;  3PH5 A;  4G57 A;  4AYB G;  1VWN B;  4U68 A;  2UZ2 A;  2RTG B;  1ZYR D;  2OFA A;  2IZG B;  1KAA A;  5EED A;  1TS4 A;  4MIR A;  2GVB A;  5B27 A;  5H9N A;  1F9R A;  1TII D;  3WZN A;  2HDL A;  3I73 A;  3NTK A;  1HNW L;  3BS1 A;  1A2T A;  1LM0 A;  2CWP A;  1W4T A;  2HCI A;  4I3D A;  5C3E G;  4GNW A;  4DNI A;  5C5M A;  4RGO S;  1AH9 A;  2EVB A;  1TWA H;  1XTC D;  3A8I E;  3NBH A;  3MXN B;  4N8F A;  2RTF B;  4OIJ A;  1SLD B;  2VL6 A;  4L5R C;  1R4P B;  3K57 A;  2N93 A;  2HQE A;  2YG2 A;  4OEL A;  4DR2 Q;  2R6G A;  3I4L A;  3P6E A;  1LTA D;  1BO0 A;  1EQV A;  1B50 A;  4BQU A;  1KQX A;  1WTH A;  5EAY A;  3VG2 A;  2QW7 A;  4C3J H;  2IX0 A;  1ICM A;  3NPO A;  1W5R A;  2XIW A;  3U9P C;  5D3I B;  3KFG A;  5D45 A;  3MBT A;  4I9R A;  1V1P B;  2B8F A;  2CQA A;  4Z9C B;  1HTL D;  4J15 A;  1E2Z A;  2W2B A;  1BCP F;  1ONL A;  3H6M A;  2A2G A;  5B11 O;  1PTO D;  2X69 A;  3D8G A;  3MFG A;  4APV A;  5HGQ A;  1B2T A;  1WTW A;  2K14 A;  3U9O A;  1BCP C;  2ASN X;  3RNU A;  2K28 A;  4WOR A;  4YVB A;  1CFM A;  2PNH A;  1TVX A;  2E2H B;  1BXT A;  2MHV A;  2B2W A;  5LKE A;  1IW7 C;  2NP1 A;  2ZM6 Q;  1S44 A;  4JI8 Q;  4O3X B;  3DM3 A;  4KLK A;  1G8Z D;  4DUY L;  3H09 A;  3S15 B;  1E02 A;  4I95 A;  2F0J A;  3WXQ A;  5HZQ A;  1RDP D;  5ELF A;  4P71 A;  1IIU A;  1VWF B;  1B7Y B;  2Q9S A;  5JR8 A;  5C44 G;  4IB6 A;  1HXL A;  4GN5 A;  2ATW A;  2JMB A;  1L1O A;  1NE3 A;  4N7D A;  2I07 B;  4IOC A;  4TRD A;  4PNY A;  3FR5 A;  2CBS A;  4YGH A;  1O7I A;  2Q4N A;  1G7N A;  1HN2 A;  4RGT A;  3HK1 A;  2F52 A;  3S1Q H;  4ZAI A;  2AH7 X;  1I4Q A;  2JA7 B;  1VF5 C;  1I50 H;  1NTG A;  2H4O A;  2R7Z G;  3K7A B;  1BBU A;  1RHP A;  2Q2M A;  4GN4 B;  1CZG A;  3EW2 A;  1D2U A;  1S72 A;  4A3M H;  1PLF A;  4NXM L;  2F0D A;  3I4O A;  3GTK H;  2IL8 A;  3KOJ A;  3QIA A;  3K5L A;  1K8G A;  3J81 i;  3CC4 A;  4A3C H;  5DPQ A;  4K5X A;  1OBQ A;  2QOS C;  1S2P A;  3AB9 A;  4LUO A;  4B3T L;  2G9D A;  3A5Z B;  1SYB A;  1VQ9 A;  3J81 L;  2VUM B;  4LF4 L;  5CC4 A;  4A3F G;  3HTY A;  2Q39 A;  5CE4 A;  2WKD A;  4OMW A;  1BEB A;  5EGT A;  2WV6 D;  1SRI A;  2VQE Q;  5D48 A;  5LKF A;  4IUP A;  1LV9 A;  2WFW A;  2KEC A;  1Q90 A;  2Q2I A;  5FO8 B;  3GTQ H;  3CHB D;  4Q5V A;  2IZH B;  1PA6 A;  5C0X H;  1E3P A;  3NPP A;  2A5B A;  4XTC S;  3DHQ A;  1RXH A;  2X46 A;  4NW2 A;  1RJT A;  5HBS A;  1SN8 A;  4BX5 A;  1HBQ A;  4JBJ A;  5H9A A;  4QYP A;  5HZ8 A;  1KC8 C;  1Y0G A;  3R2T A;  5LJC A;  4MVK A;  1NSN S;  5FO7 B;  3CCS A;  1TR5 A;  1HNX Q;  1SE2 A;  3TZS A;  3PGZ A;  1VQO A;  5BVS A;  1GXA A;  4MZ9 A;  3SEB A;  1I6H B;  1ZNK A;  5J39 A;  2OCE A;  2V1C C;  1VS0 A;  1ZKO A;  3FR4 A;  2K1B A;  3TN2 A;  1A2D A;  4YDB A;  3FVQ A;  5C3W A;  1WD1 A;  2N49 A;  2NNQ A;  3ZUO A;  1D1I A;  1L0Y B;  2NZ1 D;  1LIF A;  1VYG A;  4UY8 C;  3UDX A;  3VE1 A;  2JYO A;  5JJK A;  1BCP B;  1DF8 A;  4BBR G;  5HZ5 A;  3K5O A;  4KI0 A;  1SYF A;  2X4M A;  1S5D D;  4UU2 A;  4OKA A;  2F0I A;  1A3V A;  3I3C A;  2FIN B;  4ZYS A;  4PJ2 A;  4LFC Q;  3CMA A;  1OSP O;  3TP7 A;  1GGL A;  1RXK A;  2RQ0 A;  4L3R A;  1Y1W B;  1AVD A;  4YFR A;  5FLX c;  4IFD G;  2PZT A;  4KHV A;  1DFV A;  1I4U A;  4B3M Q;  1KDC A;  1OPA A;  1ZNG A;  3O13 A;  2VDF A;  4V19 0;  2IX1 A;  4QL5 A;  5KYI A;  4AZM A;  2EPB A;  4OIK A;  1JV4 A;  4IUU A;  4KD3 A;  5FLX E;  4KY5 A;  1EPB A;  4QZU A;  3STM X;  4I6S A;  3A7L A;  2QIL A;  1VWH B;  4AZN A;  4CDD C;  4IFD I;  2CAM A;  2A68 C;  4AW8 A;  5CMD A;  2F0W A;  3S14 B;  3SZH A;  3VG6 A;  1SEB D;  1N33 L;  4QCL A;  2E2D C;  1S40 A;  4Y52 H;  4B3R L;  2WEW A;  1QIL A;  1DGS A;  3N52 A;  5FJ8 G;  4FBR A;  3MM0 A;  4HPD A;  1GUT A;  1SWP A;  3T51 B;  2A6H C;  3SR1 A;  1NR4 A;  3PEC A;  3H91 A;  2UXD Q;  4JBW A;  1II3 A;  2CFM A;  1PFN A;  4JC0 A;  4O0A A;  4DV4 L;  1ZXT A;  1D2B A;  1RSU B;  1DON A;  1XXG A;  1Z6H A;  3DXJ C;  2UU9 Q;  1Q12 A;  4X66 L;  2SNS A;  4XQQ A;  1GD7 A;  5F2B A;  1YNN C;  5FO9 B;  2FHN X;  5FKA C;  1DOL A;  4QIW E;  5BN5 A;  1SYD A;  4DAV A;  4Z2P A;  1X3P A;  3S17 H;  2EY6 A;  2XST A;  1X56 A;  2RN4 A;  3B2J A;  2PI3 O;  5LJG A;  2NVY H;  3V05 A;  2E2J H;  3LV4 A;  4R0B A;  1PMR A;  3X3N A;  3DSZ A;  4JI1 Q;  1ZYR C;  3G71 A;  4LF9 L;  3CAM A;  3FEW X;  4U46 A;  3KLS A;  2KHI A;  1RLB E;  4ZCB A;  2BA1 A;  1PZK D;  4ZR2 A;  1YWA A;  1S5B D;  4ULL A;  1FEN A;  1YJ9 A;  3SK6 A;  4GNX C;  2LXJ A;  1I4X A;  3MZ5 A;  4HSV A;  4QYN A;  1H9J A;  5GAD C;  3CW2 C;  2PNR C;  2Z6K C;  2CWA A;  3U0D A;  3HOZ B;  1LDQ A;  3FMZ A;  4I3B A;  1M8A A;  3KJO A;  2ALY B;  1SDF A;  3A8J E;  4JOI A;  4I65 A;  4A93 B;  3TP6 A;  2CKZ B;  4CKB A;  1LTI D;  4DGZ A;  1NMF A;  3EIV A;  2BT9 A;  2TSS A;  4NDX A;  1YIT A;  1E1O A;  3P02 A;  1VWP B;  2ZTD A;  3I4M G;  2QEJ C;  3J80 c;  5IP7 H;  3AFP A;  4FF3 A;  3QJY A;  5LL6 X;  1XNQ L;  2JW1 A;  2W2A A;  3HOV H;  5EPK A;  2F0M A;  4JI2 L;  1EY9 A;  2RDG A;  1KQS A;  2ZXO A;  1A2U A;  5CBE E;  4X3U A;  4ORX A;  2F0N A;  3J80 E;  2BLG A;  1H9M A;  3A55 A;  5M3M H;  2Z4I A;  4BX7 A;  3H3V C;  3M3Y B;  1EZ6 A;  3TRZ A;  3UEW A;  5LJB A;  4J1M A;  3F2B A;  2K75 A;  1SWT A;  2FMC A;  1LIB A;  5H9L A;  5IO7 A;  2GN5 A;  4BWG B;  3HOX H;  2HT1 A;  2OF9 A;  2OFR X;  4BY1 G;  2B8G A;  4AQY L;  3RBY A;  1Q8I A;  2OQ0 A;  4BY7 G;  1VWK B;  5EDB A;  1VWO B;  2PQA A;  1FGB D;  4IB7 A;  4A3K H;  4XQJ A;  4A3G H;  1GX3 A;  4GDA A;  1ASY A;  2OF8 A;  3B2H A;  2FT9 A;  2Y0S G;  3BZD B;  1PHJ A;  4YCV A;  4INN A;  5EQ0 A;  4ZGU A;  2E4J A;  3K0Y A;  4YDA A;  1NNX A;  4WHI A;  2YV5 A;  3NAD A;  3NQK A;  5K36 H;  4XT3 B;  4I9S A;  5C3X A;  4O42 A;  4PZ8 A;  1TQO A;  2BH2 A;  1PEE A;  1TWH B;  1I78 A;  5BN3 A;  2DJF A;  1IHZ A;  3WZP A;  1PTO H;  2RD7 C;  4IB8 A;  2Q2P A;  3ERO A;  5EEE A;  4ES7 A;  1URE A;  4YHH L;  3S1N B;  3KYH C;  3IFD A;  3PUZ A;  1OTC A;  4A3B B;  1SMY D;  1Y14 B;  5CV8 A;  1GT5 A;  1K3R A;  3KLS X;  3CBS A;  3I4N H;  1K9M C;  5M5W B;  2FKG A;  4ZKB B;  1E22 A;  3PPT A;  2BCO A;  1C48 A;  3HOU B;  4JI0 Q;  4BXX G;  5DNF A;  2QO6 A;  4YGZ A;  3NEM A;  1ENC A;  1W2B A;  3Q6L A;  3A54 A;  3UI2 A;  2LXK A;  3ZW0 B;  1GUN A;  4G4K A;  5B10 O;  1STY A;  4A3J B;  1EWC A;  1KDA A;  3QWN A;  1U4P A;  2VY3 A;  4ML7 B;  1F2Y A;  4KD4 A;  2ZJP A;  4B3T Q;  3CME A;  2B2T C;  1SWQ A;  1SWO A;  3CBC A;  4I60 A;  4AIM A;  2UUB L;  4A3L H;  4GNX B;  1ICF B;  1JJ2 A;  5AJ3 L;  3SDZ A;  5C4J B;  4C1N K;  1NQM A;  4DNT B;  1HNZ L;  2WAC A;  1H91 A;  2K5V A;  4NXN Q;  1GJX A;  5GRO A;  2Q2U A;  1UE1 A;  1HQR D;  4KC8 A;  1HUM A;  2EDG A;  3RN2 A;  1AP0 A;  1T8V A;  2UUA Q;  2KW1 A;  4IZ8 A;  3RY2 A;  3VHM A;  3ZYY X;  1C7Y A;  4DV3 L;  1N32 Q;  4FP5 D;  3EBE A;  4A1H A;  1YIV A;  3T1D A;  1KT6 A;  3ND8 A;  1UWV A;  2HUG A;  4DPG A;  3FR2 A;  3BU9 A;  2CH4 W;  2ZSC A;  4QGW A;  1X65 A;  4JI7 L;  5HWZ A;  2QMI A;  2R73 A;  4CDC A;  4CDE C;  2R92 G;  3RLN A;  1X71 A;  3KVN A;  2A19 A;  1EII A;  1TS5 A;  2A74 C;  2WP8 J;  4O3W A;  5IT9 c;  5JPN C;  1DV9 A;  3SZI A;  3NTI A;  3FW5 A;  1J6Q A;  1I06 A;  1H9R A;  2KT4 B;  2LFN A;  3FKI B;  4DUZ L;  4DV2 L;  5IO5 A;  1BQQ T;  3VGW A;  1PM1 X;  1JMX A;  1KRT A;  4LZV A;  4DV6 L;  1AN8 A;  5IT9 E;  3C78 X;  2M4L A;  2RA6 A;  4DF7 A;  3CQN A;  2JA8 H;  3T16 A;  4KY7 A;  1SAP A;  4CDF C;  2EOT A;  3F1Z A;  4C3H G;  4HJA A;  1N9Y A;  1ENF A;  4FF2 A;  2X55 A;  3HOW G;  3F8T A;  5IE8 A;  4PMB A;  5JAV A;  2CCZ A;  5B3M O;  1LLR D;  4A3I H;  1TOW A;  2NVX H;  1YNJ D;  4DNE A;  2L4N A;  2B2W C;  4GJV A;  4OWX B;  3VG4 A;  4KKU A;  1SFO B;  3H0G G;  3MXG A;  3WZO A;  3IRB A;  2MM3 A;  4A8Z A;  4DR2 L;  2RDF A;  3CP0 A;  1RST B;  2EYP A;  4ID2 A;  5FLM G;  2JA6 B;  1Q1E A;  3DWQ A;  1V43 A;  1SND A;  1CHQ D;  1P8L A;  2ASB A;  2IZJ A;  2CH4 A;  4C1N I;  3KBX A;  1VWL B;  2QCP X;  5F7G A;  2RTK A;  2WUT A;  1X8Q A;  4C3I G;  1EY5 A;  3E9I A;  3CF5 A;  1X32 A;  3S1M H;  4DCB A;  4ABN A;  2IY5 B;  4FNF A;  4FXG C;  1SMX A;  2GTL O;  2QDB A;  2EXD A;  1LAB A;  2D2C C;  4G7O C;  1C0A A;  5HCE C;  1SYC A;  1BUV T;  3S9W A;  1WVL A;  2B2Y C;  1N34 Q;  3J7A F;  1EEI D;  3NSW A;  4Z28 A;  3UE1 A;  4OEM A;  1JJU A;  1CZW A;  1A3U A;  1VWA B;  5M3F B;  1M1K C;  2N55 A;  2ZM6 L;  1AVE A;  2ZJR A;  1SWH A;  3QKG A;  3M9B A;  4JI8 L;  3OYY A;  3NBI A;  2Z0S A;  1LIC A;  4JK1 C;  2EYM A;  4LF9 Q;  1EL0 A;  1BRP A;  5C4Z A;  2RCQ A;  2WAQ B;  3HP3 A;  1HFG A;  1LTG D;  3EFX D;  4CSB A;  3S2D B;  4HMJ A;  2AQ1 B;  2PW5 A;  4H13 C;  3VDY A;  3RZY A;  3WJD A;  2F0K A;  2F0E A;  3NBH B;  1MGS A;  3NXW A;  4NP5 A;  2K4K A;  4CPH A;  1EW3 A;  4OL7 A;  5IGE A;  3X3M A;  3PIP A;  4B9W A;  3ZJY C;  3MWY W;  2PI2 E;  2R93 B;  3PO2 B;  3PCO B;  4IB9 A;  4XME A;  3CPW A;  2VS1 A;  3RDQ A;  4JI5 Q;  4TJZ A;  2K52 A;  1I3Q B;  1JIC A;  1UUP A;  3UAQ A;  3BDO A;  1HQQ A;  3P75 A;  1HA6 A;  1SY1 A;  4HN7 A;  2LY7 A;  4CPF A;  3HWG A;  1KRS A;  1RAV A;  3RZD H;  2CW0 D;  1HH2 P;  1XNQ Q;  3D97 A;  4YBP A;  2LFO A;  1E5P A;  4DNR B;  1LTB D;  4JI2 Q;  3K5M A;  1YHB A;  1SWU A;  2AMC B;  4YFP A;  2EQS A;  4LF5 Q;  2FJ2 A;  1EUJ A;  4RCN A;  3VR4 A;  1SY0 A;  1STB A;  5IYC G;  4BJ8 A;  2QEX A;  3FEL A;  2ICI A;  3K7U C;  4K8I A;  1BR9 A;  5C4X G;  1TWF B;  3HKZ B;  5I2Y A;  2F0P A;  5LL6 S;  2B63 H;  4MN3 A;  1HQM C;  3EVQ A;  1G29 1;  4L8J A;  1HY2 A;  4IAB A;  5KID A;  1A3T A;  1E24 A;  2K32 A;  4CBV A;  4BBS G;  4JV5 Q;  5LMN Q;  5LMU Q;  1LPJ A;  1EOV A;  1PYW D;  5F1E A;  2ACP X;  1EUO A;  5IRU A;  5IYD H;  3KUP A;  3MHB A;  4A3D G;  1Y1V G;  1EQT A;  3GV6 A;  2RTM A;  2FS7 A;  3FLL A;  3E6Z X;  5GAG C;  2HQL A;  3CCQ A;  4HWM A;  5IYC H;  1K0R A;  2AWN A;  2E5L Q;  4FXK C;  4DV0 L;  3B2I A;  2HZR A;  4UP7 A;  1HBP A;  2R74 A;  2L5P A;  3PUX A;  2GA4 B;  2Z4H A;  4GD9 A;  1DZK A;  3CQZ B;  2KA7 A;  3JAM c;  1FVI A;  1KT7 A;  3V2T A;  1T68 X;  3M85 A;  4Y7N B;  1NR2 A;  4IUT A;  3I90 A;  2BS6 A;  1S4Z A;  2I5H A;  3MFY A;  3S2H B;  2LMC B;  3W3A A;  3JAM E;  4HIM A;  1TS3 A;  4A3D H;  2HHH Q;  1X3F A;  3DMU A;  1JOQ A;  1SWA A;  4Y59 A;  1RF2 D;  1VF7 A;  3E0E A;  4B3M L;  4OGQ C;  2NVQ B;  1YVC A;  2O5I C;  4ALB A;  2JA5 B;  2MF6 A;  4F8M A;  5A2Q L;  1JB7 A;  3T4A C;  3W1G A;  2YTX A;  4UDU C;  1LID A;  3QB3 A;  2EIF A;  3T13 A;  1CBQ A;  1SLG B;  4CJ0 B;  3EC5 A;  1DM0 B;  3PO3 B;  2OY8 A;  4TLJ A;  2NBF A;  5K68 A;  1Y8O B;  4OO1 G;  1PYB A;  3APW A;  5E3F A;  3W5O A;  4IMN A;  1WUB A;  5E4W C;  1HHV A;  1QVG A;  2A1A A;  1HNZ Q;  1HMT A;  1NY4 A;  3GTL H;  1FD7 D;  5E4X A;  1BF4 A;  3B2K A;  3QOJ A;  1Z47 A;  4WFU A;  1X9N A;  1KGL A;  4OO1 I;  1FEL A;  4DV3 Q;  2UXD L;  3G6J B;  4C2M H;  1VQP A;  4JOI C;  4FQB B;  2ALL X;  3GTO H;  5EZ2 A;  4ILW A;  2ZAG A;  4HJ7 A;  1XMO Q;  2UU9 L;  3W2D A;  1JJJ A;  1SSO A;  4OO1 H;  2OQK A;  4IAW A;  2CZU A;  1NQN A;  4DXG A;  4LQZ A;  4GOP C;  1NDJ A;  1HZC A;  4F88 A;  5JEA G;  2LSS A;  5CYU A;  1IJ8 A;  2Q8T A;  3WBG A;  2XWB B;  1IBK Q;  1CK1 A;  5I6W A;  1WFQ A;  4BX6 B;  2PZW A;  1X89 A;  3F9D A;  4RHR A;  5FK9 C;  2H5X A;  1SY2 A;  2A3F X;  3PQI A;  1YNJ C;  3UE0 A;  5IY0 A;  4DA2 A;  4DV1 Q;  2PW7 A;  3R8B A;  1DZP A;  1NGL A;  1Q46 A;  2MJI A;  2NTS A;  4MIU A;  4A75 A;  2YU9 H;  1SWC A;  1KAB A;  2JA7 G;  4HPC A;  2C35 B;  2YTY A;  1I4R A;  4U8U O;  3FMC A;  2B29 A;  1OXT A;  3DWP A;  3C76 X;  1MM9 A;  5KNC A;  1DXM A;  1