3SLTA

Pre-cleavage structure of the autotransporter espp - n1023s mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
305
structure length
305
Chain Sequence
b'HHHANKEATRNAAALFSVDYKAFLNEVSNLNKRMGDLRDINGEAGAWARIMSGTGSASGGFSDNYTHVQVGVDKKHELDGLDLFTGFTVTHTDSSASADVFSGKTKSVGAGLYASAMFDSGAYIDLIGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAWIEPQAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLIGRTGVDVGKSFSGKDWKVTARAGLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFEKSAFGKYNVDNAVNANFRYSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease espP
publication title Molecular basis for the activation of a catalytic asparagine residue in a self-cleaving bacterial autotransporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 92
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2011-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03797 Autotransporter Autotransporter beta-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.130 Mainly Beta Beta Barrel Lipocalin Autotransporter beta-domain 3sltA00
2QOMA 4MEEA 3KVNA 3QQ2A 3SLJA 3SLOA 1UYOX 3AEHA 1UYNX 3SLTA
chains in the Genus database with same CATH superfamily
4BX7B 3T1DA 4WHIA 4Y59A 1EALA 5LKFA 4ZJ0A 5HZ5A 2K62A 1FEMA 3S5XA 4MVEA 2A2UA 2NNDA 2F01A 1OPBA 5BVSA 2QO4A 3UAQA 4DNEA 3VE2A 2AMMX 1TVQA 2AF5A 1G5WA 1B4MA 3NX1A 1DF3A 1GX8A 3O2YA 3WZNA 2GTLO 2ZAIA 3SOTA 5LJHA 1A57A 1JYDA 5CSEA 1PEEA 3RDOA 1KGLA 1SY3A 2FHNX 2JOZA 4YGGA 1FELA 1YP6A 1UYNX 3CQRA 2GTLM 4GKCA 3IFBA 3VG6A 1BLRA 2KTSA 2A5CA 4GNYA 3GAQA 4D6AA 2OYBO 3VGWA 1JBHA 1VYGA 5D8JA 1RAVA 1IKJA 3FYFA 3EM0A 3BS2A 4ZHDA 2IZKA 1CJ5A 5IO5A 1CRBA 2AT3X 2OVDA 3E3CA 4CK4A 2GH7A 1SY1A 2RTBB 4I3DA 1KT4A 2ACPX 4BX7A 4M7MA 2R74A 1NGLA 3WXQA 4O3ZA 2OL6O 3WJCA 2E4JA 1VWCB 1X8OA 4NV7A 4BOEA 5EPQA 2CBSA 1VWPB 4WFVA 2FR3A 3CKGA 4TNNA 1L6MA 1KT7A 1EW3A 4NP1A 1G7NA 3ZW2A 2BHVA 4ORXA 4GGRA 5KIDA 1I9HA 3TGAA 3TGBA 1O1UA 1OBPA 4WFUA 3RY2A 1SWLA 1PM1X 4XMHA 1LIDA 2OVEA 2CBRA 2X46A 1WBIA 3APUA 3FMZA 4GGZA 5HCDC 3PP6A 1EI5A 1SRIA 1SXXA 2PY1A 3IA8A 3NX2A 3B2LA 4JGLA 5EDBA 2RTOB 2RTEB 1JMZA 3BX8A 4IAWA 4U8UO 3WZPA 1VWIB 3VG2A 1B56A 1SXUA 3HWGA 1Y0GA 3HTYA 3MM0A 2BSZA 4YBPA 1G85A 1GX9A 3VHIA 2HZRA 4U8UM 3RDXA 1UYOX 1EPAA 3JSQA 4JHQA 4GJSA 4LKPA 2RTMA 2Z4HA 2AH7X 1AELA 1K3BA 4DQ3A 2CZTA 4GJVA 1IFBA 1EIOA 2WPUA 4CSBA 1IW2A 1RXKA 1STSB 2EU7X 2RTCB 4XMEA 4ALBA 4O4OA 1OSPO 3OD9A 4FGIB 3CBCA 4KH8A 4U3QA 2IZLB 4TJZA 1U18A 4ZHGA 3WVMA 1XCAA 2BS5A 3MVFA 3FDCA 5IXGA 3APWA 1CBSA 1LPJA 4LZVA 5B5GA 1UREA 2I5ZO 3BSZE 1LIBA 1QWDA 2JMBA 2MF6A 2NP1A 2FKJA 5KHPA 2N93A 2R73A 1FTPA 1LUQA 1VPRA 3BU1A 4Y0SA 3SZJA 4CV7A 3EW2A 1HY2A 1YWDA 3B2JA 1KL3A 1SLFB 3FELA 3ZUIA 3OBLA 5K06A 4CPIA 1IKEA 5H9LA 2GJ5A 4M6SA 1SXWA 1DZJA 3I0AA 1VWGB 4NLIA 4QYPA 4QZTA 4KT5A 1D2UA 3HOEA 1RSUB 1JQPA 3RSWA 1SWFA 2X55A 3FA7A 4OKAA 4Z6JA 2BT9A 4B55A 3VU1A 1SMPI 3P02A 2G7BA 3FIQA 5LJDA 1N7YA 4CPEA 2WEWA 2AVIA 5HZ8A 2WEXA 5L8OA 1SA8A 3B2IA 1IFCA 4XMCA 1SWKA 4LKTA 4TKHA 4EXZA 3P6FA 3JS1A 3CR6A 4CPFA 2VFBA 4KCAA 4A1HA 5FFHA 1LCWA 3P6HA 2AT6X 4AW8A 3BRNA 1HN2A 5LJCA 5H9KA 1DV9A 4RUUA 4MISA 3N91A 4TKBA 5L8NA 2YMSA 2A3FX 1SWBA 3WJGA 5F6ZA 2HKDA 1ZRYA 4HPCA 3SZHA 1EIIA 3RE6A 4NYRA 4OEMA 4CDCA 2FT9A 1E02A 1GXAA 3HWDA 2GTFX 4INNA 4Y0RA 1VWMB 5AQ6A 3EBKA 3HWEA 1JZUA 1HBPA 2ZAGA 5JR8A 1NDJA 1NBXA 5CYBA 1BM5A 4O4SA 4ZH6A 1AQBA 5HTEA 4AZQA 4WBKA 4KIIA 1JMXA 3ZUOA 2JN3A 5F58A 5B3MO 2RTAA 1IIUA 3F9DA 4FBOA 4IB9A 1LDQA 3WJDA 2LKKA 4O9SA 2ACOA 4ARHA 2ANSA 1VWFB 5FQ7E 4XMFA 3NBXX 2FRSA 1QQSA 1SWPA 3I17A 4YBUA 2OY7A 5C0NA 1EXSA 2Y32A 1RBPA 1XKIA 2GC9A 1KQXA 2UYWA 4HWMA 1CBQA 3MBTA 4QGXA 1W5RA 1ZNEA 2G8CO 1STPA 5HBSA 3WYPA 3RBYA 4GGTA 3U03A 4YDBA 1ZNHA 3WZQA 2WR6A 1H91A 2FKGA 1VWDB 2BC3A 2FTBA 2UZ2A 1MVGA 2RQ0A 2RTDB 3CQNA 1SWTA 2W2BA 3FA9A 3DTQA 3H3IA 4AZNA 4AZRA 2RCTA 2LFOA 1MUPA 2RCQA 3LV4A 4IB7A 1OPAA 4TLJA 1SWSA 4O3YA 4ORSA 1TW4A 3FR5A 4ORYA 3NADA 4GUZA 1HQQA 3P6CA 4YKMA 3D97A 4OMWA 2OVSA 4TKJA 5F6BA 5H9AA 2X8TA 1VWLB 2OZQA 1GKAB 3FR4A 4OS8A 1B8EA 1SY0A 1OEEA 4AYHA 1ZNLA 2QO5A 4KC8A 5LJGA 5IRWA 1OBUA 2LB6A 4EDEA 5AEOA 3FW4A 1CBIA 1Z24A 1JIWI 4HPAA 3VHHA 1P6PA 1Y52X 4HFOA 1NC9A 2RTLA 5KICA 1I04A 4BBOA 5L3YA 1LKEA 3B2KA 4EQAC 3APVA 2Y3FA 3OE3A 2RTJA 4I6SA 1ALBA 1G74A 1HXLA 3EW1A 2RTHB 1K24A 2YG2A 4MEEA 1UZ2X 4NNSA 4QQ1A 2RTFB 3FEPA 3BDRA 5H8TA 3HPEA 3KFIA 1FE3A 2Q9SA 1RXHA 3CWKA 3NQ9A 4IABA 4QAEA 4Y0QA 5L8IA 4ALOA 3TGCA 3FA6A 1MX7A 1HBQA 4YMYA 4YDAA 2QCBA 1I05A 3APXA 1E00A 1R0UA 3D4RA 1JV4A 2A2GA 2IZBA 1VWHB 4QNIA 3MX7A 4XMGA 2W2FA 3STNA 5HAEA 2C4IA 2JGSA 5HZ9A 1X89A 2CZUA 1QY0A 2C1SA 3PDFA 2X8SA 3Q6LA 1HQPA 1JYJA 4I3CA 1B0OA 1DFVA 1X8UA 4ORWA 1SWOA 1DF8A 3P6EA 1SY2A 3VHMA 4BCSA 4YVBA 2AT5X 1GKAA 1OBQA 4ZHCA 1SREA 1PBOA 1I78A 1X8PA 5FQ8E 1ZNDA 1YWCA 2FWVA 2MO5A 2MHDA 2OY5O 2OFAA 3VPJE 4CDFA 1LIEA 1U0XA 4YFQA 1O8VA 1TXLA 2Y3EA 2FS6A 3WJBA 2A13A 4A60A 1LICA 2KD2A 1GT1A 1RLBE 3DSZA 3BU9A 3CMPA 1AVDA 1JJUA 4IMNA 2RTQB 2OFRX 1VWJB 4NYQA 3SLJA 2RD7C 4K19A 3GE2A 4BJ8A 4IB6A 5F2BA 1ERXA 1GX3A 1GM6A 2RTIB 3MG5A 2FLJA 2RTPB 1E2TA 3K3LA 4HPDA 5K68A 2RTRB 2XSTA 5BYPA 4MIRA 1N9MA 1VWQB 2Q2PA 4ODDA 4GZVA 4PSQA 1SRGA 2WWPA 2F09A 3NP1A 3WBGA 2FGSA 3FW5A 4JNJA 5HCCC 4AZPA 3TZSA 2FHLA 4YFRA 1DZKA 5DPQA 1I4UA 1VYOA 2W2AA 3WZOA 1FJ1E 5B5FA 2WUTA 1TOUA 2LBAA 5AJCA 1YP7A 1VWEB 1GT5A 2ZSCA 3WJEA 3RDMA 4Z2PA 1KQWA 3KFHA 4YKOA 5CE4A 1BJ7A 2OF9A 4GE1A 4UU2A 1MK5A 3P24A 5D48A 3SZIA 3ZWEA 5IO7A 4GK9A 5BVTA 1SWDA 2IZGB 3EBWA 1VYFA 1A3YA 3NR3A 2BLGA 4YGZA 1U17A 1DZPA 3FLLA 3RE5A 2WQ9A 3RDSA 2DJGA 1X8NA 2JU7A 3AKMA 1SWHA 2F73A 2A8GA 3STMX 3BX7A 4HPBA 4Z2VA 5B29A 2FR2A 5EDCA 2X8FA 2HZQA 4CPHA 3Q34A 3C77X 1SRHA 4I9SA 4I95A 5D4AA 1ACDA 5CHKA 3RDUA 3V8UA 1T68X 2HYSA 3O22A 5B27A 2LBVA 1SWNA 3HWFA 3ZW0B 1JJXA 2FS7A 4IMOA 4ORUA 4Z28A 2AL0X 2DJFA 3B2HA 4N7DA 2OFMX 1AVEA 1W4TA 2Q39A 3L4RA 4ZGFA 5HTDA 2BS6A 3RKGA 2QOMA 2HNXA 2JU3A 3FENA 1KL4A 4O3XB 4BX5A 2C1QA 2RTGB 2X45A 2IZCB 1NP1A 3UEUA 2QM9A 2X34A 5D45A 4AZMA 3S5VA 4BQUA 1DC9A 4ZCBA 2OY1O 2RN4A 4I3BA 4JO6A 4XMDA 1HMRA 5HA1A 1KZWA 1A18A 2KT4B 1A2DA 3ZQ3A 2RA6A 1SWCA 4YCEA 5IRAA 4BX6A 1SLEB 1PMPA 3FIDA 1WUBA 1KT3A 1NP4A 2IZIA 1ADLA 2WQAE 5F7GA 4NV8A 3PH6A 1ICMA 2JU8A 2MWHA 2AT8X 5EZ2A 3BY0A 4QZUA 3KVNA 1EQDA 1VWKB 4KC7A 1SXYA 2IZHB 1QY2A 3F8AA 1QFTA 3C76X 5FQ6E 4DCBA 1KOIA 2R56A 4O3WA 5D47A 3EMMA 4Y0PA 3RZYA 3ZI8A 4OELA 3ZW0A 4BGFA 1VWBB 1VWOB 4O4UA 2LA7A 2OF8A 4N7CA 3BLGA 3WJFA 1T0VA 1SLDB 3ELZA 4YGHA 5DG4A 2L9CA 2POAA 3ZW1A 3TF6A 5LKEA 4IRWA 4ZFXA 4FBRA 4YH0A 4TQ2A 3D95A 1OEKA 1MDCA 1W6FA 1SWEA 3UEVA 1N0SA 1BSYA 1BSQA 5EEDA 1N43A 2MJIA 1KFFA 5LJBA 3LHNA 4ID2A 4GDAA 2Z4IA 2X4MA 5IO6A 1RXJA 4D6BA 1QG5A 2KW1A 4GNWA 3FA8A 4NW4A 5EEEA 4OS3A 1S7DA 1SRJA 4Z27A 1DZMA 2VFCA 1YWBA 5BVQA 4GD9A 2PI3O 2X56A 3D9WA 5B11O 3FR2A 4U9CA 3D96A 2ALLX 5HZQA 3QQ2A 3VG7A 5LJKA 1KT6A 3WYQA 5HWZA 1LFOA 2IFBA 3QKGA 4CDDA 2RTNB 3O19A 4QYNA 1FDQA 1S2PA 1STRB 1SWRA 2AT0X 2K23A 2X32A 1BRQA 3HK1A 3UEWA 2RTKA 3X00A 2AKQA 3PECA 4U46A 4C5PA 1SWUA 4EKVA 2IZJA 1SWGA 4I9RA 2CAMA 5FAZA 2VDFA 2Q4NA 4YCHA 3T2WA 3KFGA 2XKLA 1VWAB 3T6LA 3VG3A 3EC5A 2NNEA 1RSTB 4ZHHA 3KQ0A 3NQ3A 1NQMA 1D3SA 3JQOA 1TOWA 1ML7A 1Y9LA 1I06A 1SWJA 1ERBA 1QFVA 1GT4A 1Y9TA 2G79A 2KTDA 3RDQA 3AEHA 1BEBA 4GH7A 5F1EA 1PTSA 2GTLN 1MM9A 2A5BA 1N9YA 1EPBA 4A8ZA 2IZAA 1MEPA 1MOYA 4GETA 1HMSA 4IAXA 3U0DA 3PQUA 1LCZA 1AB0A 3P6DA 3LTWA 2OL7A 3PEDA 1MX8A 1VWNB 4CPHB 3C78X 1YIVA 4A1YA 3NQKA 3STKA 4MVIA 2P8GA 1AVGI 3U9PC 1BWYA 3KFFA 2HMBA 4COTA 4UU3A 3UEXA 1GGLA 5LJEA 3FEKA 3NPOA 4I60A 1BRPA 2ASNX 3WOVA 1IJ8A 1KXOA 1LF7A 1OEJA 4ZR2A 4OMXA 1KZXA 1YWAA 1E06A 2G78A 4GRJA 4L3RA 5B10O 4ZGUA 2OFBA 3P6GA 5FENA 4Y5DA 3OJYC 3PQSA 2WSJA 4BX5B 2L5PA 2NNQA 4MVLA 3SLOA 2QOSC 4IBAA 1SLGB 2QO6A 2DM5A 4FBVA 4QGVA 1CBRA 4R0BA 4RUNA 1KL5A 2QMIA 4EFGA 3ZZVA 3CBSA 3ELXA 4LQZA 3F6ZB 4O4XA 3SAOA 5HCEC 3RWXA 1QABE 2CM4A 1BSOA 3SLTA 1LDOA 4ZHFA 2I5VO 4GDZA 2L68A 2OVAA 4FQBB 4LZUA 1X71A 4AZOA 4PJ2A 1ZNGA 5HZ6A 2O62A 5B2AO 1S44A 3G7XA 3T2XA 1Y53X 1QY1A 1N4JA 3VG4A 5K67A 1NQNA 1HMTA 3AUMO 1FENA 2IZEB 3HOLA 3VG5A 2IZFB 3EYCA 4BVMA 4BX6B 1LCVA 3S26A 2G5LA 1LNMA 4GU8A 1BBPA 2M4LA 1VWRB 4EEJA 1E5PA 2A0AA 1HXZA 4U8UN 1SWAA 4DQ4A 2JW1A 2Q2MA 3AKNA 4NNTA 5AJBA 1Y55X 4ON1A 3PH5A 1PBYA 1LELA 2OY8A 3PK2A 1GT3A 5IRUA 3ZW1B 3CKFA 4QRLA 4L1NA 1ICNA 3PPTA 4QGWA 4ZH9A 1LIFA 4O49A 1SRFA 1ZNKA 3VE1A 4Z2OA 1YUPA 4NLJA 1SWQA 3S60A 3KZAA 4ES7A 1O1VA 3RY1A 4CDEA 4MVKA 2CM9A 1KT5A 2MM3A 2HLVA 2OL8O 4ML7B 4OS0A 5HA0A 5JD2A 1X8QA 2IZDB 5H9NA 1JJJA 4ORRA 4IB8A 4YFPA 3T6FA 2L67A 1T8VA 1EUOA
chains in the Genus database with same CATH topology
2QOMA 4MEEA 3KVNA 3QQ2A 3SLJA 3SLOA 1UYOX 3AEHA 1UYNX 3SLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QOM A;  4MEE A;  3KVN A;  3QQ2 A;  3SLJ A;  3SLO A;  1UYO X;  3AEH A;  1UYN X;  3SLT A; 
#chains in the Genus database with same CATH topology
 4BX7 B;  3T1D A;  4WHI A;  4Y59 A;  1EAL A;  5LKF A;  4ZJ0 A;  5HZ5 A;  2K62 A;  1FEM A;  3S5X A;  4MVE A;  2A2U A;  2NND A;  2F01 A;  1OPB A;  5BVS A;  2QO4 A;  3UAQ A;  4DNE A;  3VE2 A;  2AMM X;  1TVQ A;  2AF5 A;  1G5W A;  1B4M A;  3NX1 A;  1DF3 A;  1GX8 A;  3O2Y A;  3WZN A;  2GTL O;  2ZAI A;  3SOT A;  5LJH A;  1A57 A;  1JYD A;  5CSE A;  1PEE A;  3RDO A;  1KGL A;  1SY3 A;  2FHN X;  2JOZ A;  4YGG A;  1FEL A;  1YP6 A;  1UYN X;  3CQR A;  2GTL M;  4GKC A;  3IFB A;  3VG6 A;  1BLR A;  2KTS A;  2A5C A;  4GNY A;  3GAQ A;  4D6A A;  2OYB O;  3VGW A;  1JBH A;  1VYG A;  5D8J A;  1RAV A;  1IKJ A;  3FYF A;  3EM0 A;  3BS2 A;  4ZHD A;  2IZK A;  1CJ5 A;  5IO5 A;  1CRB A;  2AT3 X;  2OVD A;  3E3C A;  4CK4 A;  2GH7 A;  1SY1 A;  2RTB B;  4I3D A;  1KT4 A;  2ACP X;  4BX7 A;  4M7M A;  2R74 A;  1NGL A;  3WXQ A;  4O3Z A;  2OL6 O;  3WJC A;  2E4J A;  1VWC B;  1X8O A;  4NV7 A;  4BOE A;  5EPQ A;  2CBS A;  1VWP B;  4WFV A;  2FR3 A;  3CKG A;  4TNN A;  1L6M A;  1KT7 A;  1EW3 A;  4NP1 A;  1G7N A;  3ZW2 A;  2BHV A;  4ORX A;  4GGR A;  5KID A;  1I9H A;  3TGA A;  3TGB A;  1O1U A;  1OBP A;  4WFU A;  3RY2 A;  1SWL A;  1PM1 X;  4XMH A;  1LID A;  2OVE A;  2CBR A;  2X46 A;  1WBI A;  3APU A;  3FMZ A;  4GGZ A;  5HCD C;  3PP6 A;  1EI5 A;  1SRI A;  1SXX A;  2PY1 A;  3IA8 A;  3NX2 A;  3B2L A;  4JGL A;  5EDB A;  2RTO B;  2RTE B;  1JMZ A;  3BX8 A;  4IAW A;  4U8U O;  3WZP A;  1VWI B;  3VG2 A;  1B56 A;  1SXU A;  3HWG A;  1Y0G A;  3HTY A;  3MM0 A;  2BSZ A;  4YBP A;  1G85 A;  1GX9 A;  3VHI A;  2HZR A;  4U8U M;  3RDX A;  1UYO X;  1EPA A;  3JSQ A;  4JHQ A;  4GJS A;  4LKP A;  2RTM A;  2Z4H A;  2AH7 X;  1AEL A;  1K3B A;  4DQ3 A;  2CZT A;  4GJV A;  1IFB A;  1EIO A;  2WPU A;  4CSB A;  1IW2 A;  1RXK A;  1STS B;  2EU7 X;  2RTC B;  4XME A;  4ALB A;  4O4O A;  1OSP O;  3OD9 A;  4FGI B;  3CBC A;  4KH8 A;  4U3Q A;  2IZL B;  4TJZ A;  1U18 A;  4ZHG A;  3WVM A;  1XCA A;  2BS5 A;  3MVF A;  3FDC A;  5IXG A;  3APW A;  1CBS A;  1LPJ A;  4LZV A;  5B5G A;  1URE A;  2I5Z O;  3BSZ E;  1LIB A;  1QWD A;  2JMB A;  2MF6 A;  2NP1 A;  2FKJ A;  5KHP A;  2N93 A;  2R73 A;  1FTP A;  1LUQ A;  1VPR A;  3BU1 A;  4Y0S A;  3SZJ A;  4CV7 A;  3EW2 A;  1HY2 A;  1YWD A;  3B2J A;  1KL3 A;  1SLF B;  3FEL A;  3ZUI A;  3OBL A;  5K06 A;  4CPI A;  1IKE A;  5H9L A;  2GJ5 A;  4M6S A;  1SXW A;  1DZJ A;  3I0A A;  1VWG B;  4NLI A;  4QYP A;  4QZT A;  4KT5 A;  1D2U A;  3HOE A;  1RSU B;  1JQP A;  3RSW A;  1SWF A;  2X55 A;  3FA7 A;  4OKA A;  4Z6J A;  2BT9 A;  4B55 A;  3VU1 A;  1SMP I;  3P02 A;  2G7B A;  3FIQ A;  5LJD A;  1N7Y A;  4CPE A;  2WEW A;  2AVI A;  5HZ8 A;  2WEX A;  5L8O A;  1SA8 A;  3B2I A;  1IFC A;  4XMC A;  1SWK A;  4LKT A;  4TKH A;  4EXZ A;  3P6F A;  3JS1 A;  3CR6 A;  4CPF A;  2VFB A;  4KCA A;  4A1H A;  5FFH A;  1LCW A;  3P6H A;  2AT6 X;  4AW8 A;  3BRN A;  1HN2 A;  5LJC A;  5H9K A;  1DV9 A;  4RUU A;  4MIS A;  3N91 A;  4TKB A;  5L8N A;  2YMS A;  2A3F X;  1SWB A;  3WJG A;  5F6Z A;  2HKD A;  1ZRY A;  4HPC A;  3SZH A;  1EII A;  3RE6 A;  4NYR A;  4OEM A;  4CDC A;  2FT9 A;  1E02 A;  1GXA A;  3HWD A;  2GTF X;  4INN A;  4Y0R A;  1VWM B;  5AQ6 A;  3EBK A;  3HWE A;  1JZU A;  1HBP A;  2ZAG A;  5JR8 A;  1NDJ A;  1NBX A;  5CYB A;  1BM5 A;  4O4S A;  4ZH6 A;  1AQB A;  5HTE A;  4AZQ A;  4WBK A;  4KII A;  1JMX A;  3ZUO A;  2JN3 A;  5F58 A;  5B3M O;  2RTA A;  1IIU A;  3F9D A;  4FBO A;  4IB9 A;  1LDQ A;  3WJD A;  2LKK A;  4O9S A;  2ACO A;  4ARH A;  2ANS A;  1VWF B;  5FQ7 E;  4XMF A;  3NBX X;  2FRS A;  1QQS A;  1SWP A;  3I17 A;  4YBU A;  2OY7 A;  5C0N A;  1EXS A;  2Y32 A;  1RBP A;  1XKI A;  2GC9 A;  1KQX A;  2UYW A;  4HWM A;  1CBQ A;  3MBT A;  4QGX A;  1W5R A;  1ZNE A;  2G8C O;  1STP A;  5HBS A;  3WYP A;  3RBY A;  4GGT A;  3U03 A;  4YDB A;  1ZNH A;  3WZQ A;  2WR6 A;  1H91 A;  2FKG A;  1VWD B;  2BC3 A;  2FTB A;  2UZ2 A;  1MVG A;  2RQ0 A;  2RTD B;  3CQN A;  1SWT A;  2W2B A;  3FA9 A;  3DTQ A;  3H3I A;  4AZN A;  4AZR A;  2RCT A;  2LFO A;  1MUP A;  2RCQ A;  3LV4 A;  4IB7 A;  1OPA A;  4TLJ A;  1SWS A;  4O3Y A;  4ORS A;  1TW4 A;  3FR5 A;  4ORY A;  3NAD A;  4GUZ A;  1HQQ A;  3P6C A;  4YKM A;  3D97 A;  4OMW A;  2OVS A;  4TKJ A;  5F6B A;  5H9A A;  2X8T A;  1VWL B;  2OZQ A;  1GKA B;  3FR4 A;  4OS8 A;  1B8E A;  1SY0 A;  1OEE A;  4AYH A;  1ZNL A;  2QO5 A;  4KC8 A;  5LJG A;  5IRW A;  1OBU A;  2LB6 A;  4EDE A;  5AEO A;  3FW4 A;  1CBI A;  1Z24 A;  1JIW I;  4HPA A;  3VHH A;  1P6P A;  1Y52 X;  4HFO A;  1NC9 A;  2RTL A;  5KIC A;  1I04 A;  4BBO A;  5L3Y A;  1LKE A;  3B2K A;  4EQA C;  3APV A;  2Y3F A;  3OE3 A;  2RTJ A;  4I6S A;  1ALB A;  1G74 A;  1HXL A;  3EW1 A;  2RTH B;  1K24 A;  2YG2 A;  4MEE A;  1UZ2 X;  4NNS A;  4QQ1 A;  2RTF B;  3FEP A;  3BDR A;  5H8T A;  3HPE A;  3KFI A;  1FE3 A;  2Q9S A;  1RXH A;  3CWK A;  3NQ9 A;  4IAB A;  4QAE A;  4Y0Q A;  5L8I A;  4ALO A;  3TGC A;  3FA6 A;  1MX7 A;  1HBQ A;  4YMY A;  4YDA A;  2QCB A;  1I05 A;  3APX A;  1E00 A;  1R0U A;  3D4R A;  1JV4 A;  2A2G A;  2IZB A;  1VWH B;  4QNI A;  3MX7 A;  4XMG A;  2W2F A;  3STN A;  5HAE A;  2C4I A;  2JGS A;  5HZ9 A;  1X89 A;  2CZU A;  1QY0 A;  2C1S A;  3PDF A;  2X8S A;  3Q6L A;  1HQP A;  1JYJ A;  4I3C A;  1B0O A;  1DFV A;  1X8U A;  4ORW A;  1SWO A;  1DF8 A;  3P6E A;  1SY2 A;  3VHM A;  4BCS A;  4YVB A;  2AT5 X;  1GKA A;  1OBQ A;  4ZHC A;  1SRE A;  1PBO A;  1I78 A;  1X8P A;  5FQ8 E;  1ZND A;  1YWC A;  2FWV A;  2MO5 A;  2MHD A;  2OY5 O;  2OFA A;  3VPJ E;  4CDF A;  1LIE A;  1U0X A;  4YFQ A;  1O8V A;  1TXL A;  2Y3E A;  2FS6 A;  3WJB A;  2A13 A;  4A60 A;  1LIC A;  2KD2 A;  1GT1 A;  1RLB E;  3DSZ A;  3BU9 A;  3CMP A;  1AVD A;  1JJU A;  4IMN A;  2RTQ B;  2OFR X;  1VWJ B;  4NYQ A;  3SLJ A;  2RD7 C;  4K19 A;  3GE2 A;  4BJ8 A;  4IB6 A;  5F2B A;  1ERX A;  1GX3 A;  1GM6 A;  2RTI B;  3MG5 A;  2FLJ A;  2RTP B;  1E2T A;  3K3L A;  4HPD A;  5K68 A;  2RTR B;  2XST A;  5BYP A;  4MIR A;  1N9M A;  1VWQ B;  2Q2P A;  4ODD A;  4GZV A;  4PSQ A;  1SRG A;  2WWP A;  2F09 A;  3NP1 A;  3WBG A;  2FGS A;  3FW5 A;  4JNJ A;  5HCC C;  4AZP A;  3TZS A;  2FHL A;  4YFR A;  1DZK A;  5DPQ A;  1I4U A;  1VYO A;  2W2A A;  3WZO A;  1FJ1 E;  5B5F A;  2WUT A;  1TOU A;  2LBA A;  5AJC A;  1YP7 A;  1VWE B;  1GT5 A;  2ZSC A;  3WJE A;  3RDM A;  4Z2P A;  1KQW A;  3KFH A;  4YKO A;  5CE4 A;  1BJ7 A;  2OF9 A;  4GE1 A;  4UU2 A;  1MK5 A;  3P24 A;  5D48 A;  3SZI A;  3ZWE A;  5IO7 A;  4GK9 A;  5BVT A;  1SWD A;  2IZG B;  3EBW A;  1VYF A;  1A3Y A;  3NR3 A;  2BLG A;  4YGZ A;  1U17 A;  1DZP A;  3FLL A;  3RE5 A;  2WQ9 A;  3RDS A;  2DJG A;  1X8N A;  2JU7 A;  3AKM A;  1SWH A;  2F73 A;  2A8G A;  3STM X;  3BX7 A;  4HPB A;  4Z2V A;  5B29 A;  2FR2 A;  5EDC A;  2X8F A;  2HZQ A;  4CPH A;  3Q34 A;  3C77 X;  1SRH A;  4I9S A;  4I95 A;  5D4A A;  1ACD A;  5CHK A;  3RDU A;  3V8U A;  1T68 X;  2HYS A;  3O22 A;  5B27 A;  2LBV A;  1SWN A;  3HWF A;  3ZW0 B;  1JJX A;  2FS7 A;  4IMO A;  4ORU A;  4Z28 A;  2AL0 X;  2DJF A;  3B2H A;  4N7D A;  2OFM X;  1AVE A;  1W4T A;  2Q39 A;  3L4R A;  4ZGF A;  5HTD A;  2BS6 A;  3RKG A;  2QOM A;  2HNX A;  2JU3 A;  3FEN A;  1KL4 A;  4O3X B;  4BX5 A;  2C1Q A;  2RTG B;  2X45 A;  2IZC B;  1NP1 A;  3UEU A;  2QM9 A;  2X34 A;  5D45 A;  4AZM A;  3S5V A;  4BQU A;  1DC9 A;  4ZCB A;  2OY1 O;  2RN4 A;  4I3B A;  4JO6 A;  4XMD A;  1HMR A;  5HA1 A;  1KZW A;  1A18 A;  2KT4 B;  1A2D A;  3ZQ3 A;  2RA6 A;  1SWC A;  4YCE A;  5IRA A;  4BX6 A;  1SLE B;  1PMP A;  3FID A;  1WUB A;  1KT3 A;  1NP4 A;  2IZI A;  1ADL A;  2WQA E;  5F7G A;  4NV8 A;  3PH6 A;  1ICM A;  2JU8 A;  2MWH A;  2AT8 X;  5EZ2 A;  3BY0 A;  4QZU A;  3KVN A;  1EQD A;  1VWK B;  4KC7 A;  1SXY A;  2IZH B;  1QY2 A;  3F8A A;  1QFT A;  3C76 X;  5FQ6 E;  4DCB A;  1KOI A;  2R56 A;  4O3W A;  5D47 A;  3EMM A;  4Y0P A;  3RZY A;  3ZI8 A;  4OEL A;  3ZW0 A;  4BGF A;  1VWB B;  1VWO B;  4O4U A;  2LA7 A;  2OF8 A;  4N7C A;  3BLG A;  3WJF A;  1T0V A;  1SLD B;  3ELZ A;  4YGH A;  5DG4 A;  2L9C A;  2POA A;  3ZW1 A;  3TF6 A;  5LKE A;  4IRW A;  4ZFX A;  4FBR A;  4YH0 A;  4TQ2 A;  3D95 A;  1OEK A;  1MDC A;  1W6F A;  1SWE A;  3UEV A;  1N0S A;  1BSY A;  1BSQ A;  5EED A;  1N43 A;  2MJI A;  1KFF A;  5LJB A;  3LHN A;  4ID2 A;  4GDA A;  2Z4I A;  2X4M A;  5IO6 A;  1RXJ A;  4D6B A;  1QG5 A;  2KW1 A;  4GNW A;  3FA8 A;  4NW4 A;  5EEE A;  4OS3 A;  1S7D A;  1SRJ A;  4Z27 A;  1DZM A;  2VFC A;  1YWB A;  5BVQ A;  4GD9 A;  2PI3 O;  2X56 A;  3D9W A;  5B11 O;  3FR2 A;  4U9C A;  3D96 A;  2ALL X;  5HZQ A;  3QQ2 A;  3VG7 A;  5LJK A;  1KT6 A;  3WYQ A;  5HWZ A;  1LFO A;  2IFB A;  3QKG A;  4CDD A;  2RTN B;  3O19 A;  4QYN A;  1FDQ A;  1S2P A;  1STR B;  1SWR A;  2AT0 X;  2K23 A;  2X32 A;  1BRQ A;  3HK1 A;  3UEW A;  2RTK A;  3X00 A;  2AKQ A;  3PEC A;  4U46 A;  4C5P A;  1SWU A;  4EKV A;  2IZJ A;  1SWG A;  4I9R A;  2CAM A;  5FAZ A;  2VDF A;  2Q4N A;  4YCH A;  3T2W A;  3KFG A;  2XKL A;  1VWA B;  3T6L A;  3VG3 A;  3EC5 A;  2NNE A;  1RST B;  4ZHH A;  3KQ0 A;  3NQ3 A;  1NQM A;  1D3S A;  3JQO A;  1TOW A;  1ML7 A;  1Y9L A;  1I06 A;  1SWJ A;  1ERB A;  1QFV A;  1GT4 A;  1Y9T A;  2G79 A;  2KTD A;  3RDQ A;  3AEH A;  1BEB A;  4GH7 A;  5F1E A;  1PTS A;  2GTL N;  1MM9 A;  2A5B A;  1N9Y A;  1EPB A;  4A8Z A;  2IZA A;  1MEP A;  1MOY A;  4GET A;  1HMS A;  4IAX A;  3U0D A;  3PQU A;  1LCZ A;  1AB0 A;  3P6D A;  3LTW A;  2OL7 A;  3PED A;  1MX8 A;  1VWN B;  4CPH B;  3C78 X;  1YIV A;  4A1Y A;  3NQK A;  3STK A;  4MVI A;  2P8G A;  1AVG I;  3U9P C;  1BWY A;  3KFF A;  2HMB A;  4COT A;  4UU3 A;  3UEX A;  1GGL A;  5LJE A;  3FEK A;  3NPO A;  4I60 A;  1BRP A;  2ASN X;  3WOV A;  1IJ8 A;  1KXO A;  1LF7 A;  1OEJ A;  4ZR2 A;  4OMX A;  1KZX A;  1YWA A;  1E06 A;  2G78 A;  4GRJ A;  4L3R A;  5B10 O;  4ZGU A;  2OFB A;  3P6G A;  5FEN A;  4Y5D A;  3OJY C;  3PQS A;  2WSJ A;  4BX5 B;  2L5P A;  2NNQ A;  4MVL A;  3SLO A;  2QOS C;  4IBA A;  1SLG B;  2QO6 A;  2DM5 A;  4FBV A;  4QGV A;  1CBR A;  4R0B A;  4RUN A;  1KL5 A;  2QMI A;  4EFG A;  3ZZV A;  3CBS A;  3ELX A;  4LQZ A;  3F6Z B;  4O4X A;  3SAO A;  5HCE C;  3RWX A;  1QAB E;  2CM4 A;  1BSO A;  3SLT A;  1LDO A;  4ZHF A;  2I5V O;  4GDZ A;  2L68 A;  2OVA A;  4FQB B;  4LZU A;  1X71 A;  4AZO A;  4PJ2 A;  1ZNG A;  5HZ6 A;  2O62 A;  5B2A O;  1S44 A;  3G7X A;  3T2X A;  1Y53 X;  1QY1 A;  1N4J A;  3VG4 A;  5K67 A;  1NQN A;  1HMT A;  3AUM O;  1FEN A;  2IZE B;  3HOL A;  3VG5 A;  2IZF B;  3EYC A;  4BVM A;  4BX6 B;  1LCV A;  3S26 A;  2G5L A;  1LNM A;  4GU8 A;  1BBP A;  2M4L A;  1VWR B;  4EEJ A;  1E5P A;  2A0A A;  1HXZ A;  4U8U N;  1SWA A;  4DQ4 A;  2JW1 A;  2Q2M A;  3AKN A;  4NNT A;  5AJB A;  1Y55 X;  4ON1 A;  3PH5 A;  1PBY A;  1LEL A;  2OY8 A;  3PK2 A;  1GT3 A;  5IRU A;  3ZW1 B;  3CKF A;  4QRL A;  4L1N A;  1ICN A;  3PPT A;  4QGW A;  4ZH9 A;  1LIF A;  4O49 A;  1SRF A;  1ZNK A;  3VE1 A;  4Z2O A;  1YUP A;  4NLJ A;  1SWQ A;  3S60 A;  3KZA A;  4ES7 A;  1O1V A;  3RY1 A;  4CDE A;  4MVK A;  2CM9 A;  1KT5 A;  2MM3 A;  2HLV A;  2OL8 O;  4ML7 B;  4OS0 A;  5HA0 A;  5JD2 A;  1X8Q A;  2IZD B;  5H9N A;  1JJJ A;  4ORR A;  4IB8 A;  4YFP A;  3T6F A;  2L67 A;  1T8V A;  1EUO A; 
#chains in the Genus database with same CATH homology
 2QOM A;  4MEE A;  3KVN A;  3QQ2 A;  3SLJ A;  3SLO A;  1UYO X;  3AEH A;  1UYN X;  3SLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...