4QNIA

Crystal structure of an auxiliary nutrient binding protein (bt3507) from bacteroides thetaiotaomicron vpi-5482 at 2.30 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
325
structure length
321
Chain Sequence
YEHYISFSSQLDSKGVTNIYVPYSRHDAEGNYAEGGEGRSNYQLPILVSGPSNVTVHVAHDADTLNILNYARYATRTELYYEDMGAEGLAYASYPESLQIKAGENKGLLDLKFDFRNIDMSEKWVLPLQIVDDASYNYVAHPRKDYAKAILRIFPFNDYSGDYSGTGITNKVVTGYDGDGKPIETAESITKSSIRGYVIDEQTIFTYAGIVDEDYTDRRKYKIKFAFNGETNGSVTISCDNAEEIGFELNKDVTPSFRISSSMDDAKPYLEHRYVIINNVDYYFNYIPVEGTIIRYHVKGTLTLSRDINTQIPDEDQAIEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BT3507) from Bacteroides thetaiotaomicron VPI-5482 at 2.30 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 71
structure length 321
sequence length 325
ec nomenclature
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14274 DUF4361 Domain of unknown function (DUF4361)
A PF16343 DUF4973 Domain of unknown function (DUF4973)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.440 Mainly Beta Beta Barrel Lipocalin Lipocalin 4qniA02
4QNIA 3P02A 3NQKA 3SOTA
chains in the Genus database with same CATH superfamily
2FTBA 5JD2A 1ML7A 5IRUA 1DC9A 2AT0X 3F8AA 1G5WA 4NV8A 4MVKA 2X46A 1UYOX 5B11O 1RAVA 3WJDA 5D4AA 2A2GA 4CDFA 2G8CO 2IZFB 1GT4A 1WUBA 3LTWA 1EPAA 1LCVA 1BBPA 1LDQA 2C1SA 4ZHGA 3FA6A 4CK4A 3FEKA 4LKPA 2Y3FA 1DZKA 3HK1A 1JYJA 2KW1A 4GRJA 5F6ZA 5H9AA 1EXSA 2HYSA 1I4UA 3VG4A 5KIDA 1HQPA 1L6MA 2AMMX 4DNEA 1A2DA 2JU8A 2RTNB 1BRPA 1AVEA 2CM4A 4ALBA 4NYQA 2MF6A 3NX2A 4O3YA 4QNIA 5L3YA 1KT6A 3PH6A 4QZTA 1TW4A 1SWPA 3QQ2A 5IO5A 2IZCB 2R74A 2WQ9A 2X4MA 1N9YA 5LJDA 3TF6A 4RUNA 4YFPA 4O49A 2OFMX 1SRJA 2W2AA 1GXAA 3BDRA 4OS3A 2IZKA 1I78A 2F73A 1Y55X 3RSWA 3RY2A 2HNXA 1I05A 1ICNA 1SWFA 4IB7A 3RDUA 2IZIA 4A1HA 3CKGA 2X8FA 3ELZA 4GUZA 3NBXX 5LKFA 1SXUA 1Z24A 2FT9A 4OKAA 5HA0A 4IABA 2RCQA 4Z2VA 3G7XA 2CAMA 3KFIA 2RTRB 2G78A 1OPBA 2RQ0A 4ALOA 4BX5B 3BX8A 1E5PA 1LELA 1ZNDA 1YWAA 5KICA 1MX7A 3VPJE 4BBOA 2VFCA 4OMXA 4AZOA 4JGLA 1X8PA 1AELA 1DF3A 4ZH6A 1YIVA 4ORUA 3KVNA 3NQ3A 4HPBA 3PPTA 2KTDA 3OBLA 3V8UA 1HBQA 3EMMA 1NQNA 1VWBB 4GD9A 2ZAIA 3S5VA 1VWIB 2IZAA 5DPQA 4IAXA 3ZW2A 4BX7B 1SY2A 3KFFA 3VE1A 1GGLA 2A3FX 2BC3A 2P8GA 2RTPB 3O2YA 4YMYA 3T2XA 1A57A 5F1EA 4ZHHA 1GX9A 2QO5A 2QOSC 3EW1A 3PP6A 5IRAA 4BX6A 1VWAB 3S26A 1SY1A 1DZPA 5AJCA 2A5CA 2OFAA 3HWEA 3B2IA 3EYCA 3FR4A 5HA1A 3S5XA 1YUPA 3C78X 2RTQB 4Y0QA 4KC7A 4PSQA 2W2BA 4ORYA 3VGWA 1JJXA 1S7DA 4YKOA 2OF9A 1N4JA 3FIQA 1Y0GA 2AT6X 3KFGA 1IFCA 1MX8A 4FBVA 4QGXA 2IZJA 4GGRA 2KT4B 1S2PA 1TOUA 1UREA 2BT9A 4CSBA 4OELA 3TGCA 1JZUA 1GT5A 2OY1O 4Z27A 1LKEA 3WXQA 2OY7A 5KHPA 2L5PA 3D96A 1FTPA 3FELA 2RN4A 4QQ1A 4XMDA 2GJ5A 5L8OA 4Z6JA 3UEXA 3APWA 3CQRA 2ASNX 2UZ2A 5EDCA 4GKCA 1EIOA 2X34A 3EC5A 3B2LA 3HWGA 4O3ZA 3VHHA 2NNDA 4D6BA 4U8UM 3IA8A 4A60A 3HOLA 4ODDA 3ZW0B 2A13A 4KIIA 2Q39A 1D2UA 2LFOA 4HPDA 1S44A 5FQ7E 1PMPA 5HCCC 4Z28A 4YVBA 4ZH9A 4GETA 3BRNA 4U8UN 2RTIB 4Y59A 1B4MA 2AF5A 2F09A 3RY1A 4CDDA 1T8VA 5CYBA 5HAEA 2OY5O 1SWKA 4ID2A 3UEVA 3P24A 3KZAA 4TJZA 3UAQA 1GKAB 4FBRA 1MUPA 4NNSA 1ADLA 1Y9LA 5HZQA 3RDXA 1ZNLA 5FENA 1JYDA 2RTJA 2JN3A 4YFQA 2HZQA 2GTLN 2WR6A 1SMPI 3H3IA 4CPIA 3EBKA 1PEEA 2JMBA 2NNQA 3LV4A 3NP1A 3NX1A 3C76X 3NADA 2DM5A 4GU8A 3RZYA 1SRHA 3SLOA 4FGIB 2R56A 2IZBA 4HFOA 1U17A 5EEEA 5HZ5A 3HWFA 1VWFB 4C5PA 2GC9A 2LBVA 3VE2A 1SLEB 1LIEA 3TZSA 1ERXA 3KFHA 5LJGA 1BM5A 2C4IA 1KT7A 5D47A 1SREA 2R73A 4MVEA 2LB6A 4YBPA 3SLTA 5K06A 4OMWA 1N43A 1SWSA 1SWGA 1VWLB 2YG2A 4NP1A 4YH0A 1VWRB 2OL6O 5AEOA 3SZIA 3WZQA 3PH5A 1JMZA 3HPEA 2E4JA 1SY3A 3FEPA 2X55A 4I6SA 5B10O 3ZQ3A 4EQAC 2CM9A 4CV7A 5B27A 5LJKA 1LCWA 2OL7A 1AB0A 2ANSA 1A3YA 4U8UO 5F6BA 3L4RA 1VWPB 3FR2A 4L1NA 1JIWI 3VG6A 4Z2PA 1AVGI 3CBCA 3CWKA 1B56A 5K67A 3CKFA 5IXGA 4OS0A 3I17A 4MVIA 2RD7C 3WZNA 5HCEC 4ZFXA 5HCDC 2WUTA 1ZNEA 2RTFB 1SWLA 2VDFA 4XMGA 1GX8A 4Y5DA 5H9NA 4CPEA 1KZWA 1QWDA 1BWYA 4DQ3A 1XCAA 4GDAA 2GTLO 4MVLA 3FLLA 5FAZA 1BEBA 2FWVA 2X45A 4TLJA 4UU3A 2WEWA 1SY0A 1LPJA 1HXZA 3STMX 1KOIA 1JV4A 1TVQA 2PI3O 3VG7A 3WYQA 2RTBB 5LJHA 3ZZVA 2YMSA 4XMCA 1YP7A 1VWNB 3NPOA 1Y9TA 2G5LA 2K62A 3WJCA 1OPAA 1K24A 1OSPO 5HTDA 2RTAA 3NQKA 3RE5A 1MVGA 2QCBA 1H91A 4Y0PA 1I9HA 1RXHA 2NP1A 4WFVA 1CBRA 1CBSA 1ALBA 5IO7A 4ZCBA 3WJBA 1X89A 4DQ4A 2LBAA 2Z4IA 5CE4A 1W5RA 2AVIA 5D48A 1HY2A 2RA6A 1KL5A 4BQUA 3ZI8A 1SWDA 3P6GA 3NR3A 1E2TA 3SLJA 4ZHDA 1X8QA 1VWKB 1VYGA 1VWGB 3FIDA 3I0AA 4QRLA 3WJEA 4QGVA 4CPHA 5C0NA 1GX3A 1HQQA 1X8OA 1KL3A 2QO6A 3N91A 4YCHA 2QMIA 3CMPA 3SAOA 1EQDA 1BLRA 2OVEA 2AL0X 1X8NA 2FR3A 4XMEA 2KTSA 1HBPA 1SXXA 2LA7A 2N93A 3C77X 1SWBA 3OD9A 4GH7A 4IMOA 2MJIA 3Q6LA 3O19A 1W6FA 1RLBE 4ON1A 1B8EA 5LJCA 1BJ7A 1JQPA 4NW4A 5BVQA 3ZUIA 2XSTA 1IJ8A 5B5GA 1ZNKA 2POAA 3FA7A 5L8IA 3VG2A 3PQSA 2FS7A 2HKDA 1O1UA 2F01A 3U03A 4GZVA 3SOTA 2IFBA 1K3BA 5HTEA 4RUUA 5LJEA 2GTFX 3BY0A 2A0AA 3EBWA 2QOMA 4I95A 1DZJA 4TKHA 3SZHA 3WJGA 4AW8A 1HMSA 1G74A 2DJFA 2RTMA 4LKTA 4WHIA 3QKGA 3D4RA 4GE1A 3RE6A 1TXLA 4YDBA 2AH7X 3APXA 4A8ZA 5LJBA 4Z2OA 4YGZA 3APVA 3HWDA 1DZMA 2OY8A 2MO5A 2WSJA 3AKNA 2X8TA 3GAQA 1FEMA 4I60A 4IBAA 4TKJA 3VU1A 4Y0SA 2MM3A 3BSZE 4LQZA 4ORXA 4QYNA 2OFRX 1XKIA 2DJGA 2HZRA 2HLVA 3WOVA 4O4UA 1KL4A 2OVAA 4BVMA 4QYPA 5AJBA 1KGLA 2WEXA 1SWHA 2WWPA 1LICA 1YWBA 1RBPA 1G85A 1YWCA 2Q2PA 1SLDB 2ZSCA 5F7GA 2L67A 3X00A 3ZUOA 2UYWA 2QM9A 2Q4NA 4O3XB 2X8SA 1PM1X 1Y52X 3P6EA 5FQ6E 5B3MO 1LCZA 5FFHA 2Y32A 4GDZA 1LIFA 2CBRA 1KQXA 1KT4A 4EFGA 4NLIA 2RTKA 1OEEA 1RXJA 1YWDA 3P6HA 1R0UA 1MDCA 1SWOA 3O22A 4WFUA 3FYFA 1SXYA 1X71A 1STPA 5FQ8E 3PK2A 5B2AO 1QQSA 3TGAA 2FS6A 2BS5A 2OZQA 3ZW1A 4KCAA 3LHNA 1FE3A 4IB8A 1SWTA 1LF7A 3WVMA 5BVTA 1RXKA 5HZ8A 2A8GA 3FA9A 4JO6A 4DCBA 1B0OA 3CR6A 3FDCA 3TGBA 4A1YA 1I04A 1FDQA 4HPCA 3APUA 4M6SA 4FQBB 1GT1A 5DG4A 2OFBA 3RDOA 4MEEA 2WPUA 4D6AA 4ORWA 1X8UA 3CBSA 1CBQA 5F58A 5IO6A 4QZUA 1VWMB 4XMHA 2FR2A 4AZMA 1LDOA 1BSQA 5EEDA 1ZNGA 4I3BA 1I06A 3T6LA 1E06A 4GJSA 1N9MA 1A18A 2KD2A 1EI5A 5JR8A 2FKGA 1MOYA 4OEMA 2A5BA 3RDSA 1SWUA 2FRSA 3WZPA 1SWNA 2IZHB 4IRWA 1VPRA 2BLGA 5CHKA 1W4TA 4YDAA 1SWRA 4WBKA 3RWXA 1OBUA 1KQWA 4KT5A 3HTYA 4GNYA 3WZOA 4EDEA 1VYFA 1VWQB 1LIBA 4EKVA 1CJ5A 1NP1A 3FW4A 3BS2A 4TNNA 2WQAE 2FLJA 4LZUA 4NNTA 1BSYA 3B2JA 3OJYC 1OEKA 3PDFA 1ICMA 2ACPX 5BYPA 2FGSA 3F6ZB 1GM6A 2JGSA 1NBXA 2I5VO 3MM0A 2G79A 4IMNA 3KQ0A 2FHNX 2Z4HA 1MK5A 1SLGB 1IKEA 2AT3X 3PEDA 4GGTA 3MG5A 4ZGUA 4GGZA 3STNA 4IB9A 5LKEA 4AYHA 1E00A 3MVFA 1T0VA 2ACOA 1D3SA 1AQBA 1HMTA 1SXWA 4IAWA 4AZQA 1SRFA 4BX5A 1LUQA 2M4LA 1FENA 2QO4A 5H9KA 1SWJA 4PJ2A 1N0SA 3AUMO 1DV9A 3BX7A 1OEJA 1QFVA 3SZJA 3EM0A 3OE3A 2AKQA 2L68A 4ZGFA 2BS6A 4QGWA 1IFBA 1EUOA 4YCEA 4U46A 4HPAA 3T6FA 1Y53X 4TQ2A 1QFTA 2RTEB 2CBSA 3AEHA 4I9RA 4O4XA 4U9CA 3STKA 1QG5A 1JJUA 4LZVA 3T2WA 4BX7A 1FJ1E 1G7NA 5B29A 2HMBA 4O3WA 1VWJB 4CDCA 2Q2MA 4OS8A 3P02A 3F9DA 4BOEA 5H9LA 2L9CA 2X56A 1NP4A 4ZHCA 5L8NA 4N7DA 1PBYA 2RTHB 3U9PC 2FKJA 1VWHB 1MM9A 4COTA 1ZNHA 3S60A 1VWEB 4BX6B 1JBHA 1IKJA 3WBGA 1EALA 4MIRA 3RDMA 3T1DA 1DF8A 1VWCB 4YKMA 4B55A 3E3CA 3RBYA 3RKGA 1QY2A 2K23A 3CQNA 4L3RA 4JNJA 5AQ6A 1SRIA 4INNA 1AVDA 3EW2A 4ARHA 4QAEA 2OVSA 3VG3A 3AKMA 1U18A 4AZRA 1QY1A 2JU3A 4ORSA 4NV7A 5IRWA 4GJVA 5EDBA 3BU9A 1U0XA 3FMZA 1BSOA 4UU2A 4N7CA 5F2BA 1YP6A 3ZW0A 2OYBO 3FR5A 3UEWA 1CRBA 4K19A 2CZUA 1JJJA 3FA8A 3P6DA 1PTSA 3UEUA 2IZEB 2ZAGA 3VHMA 3B2KA 4XMFA 1P6PA 2X32A 2RTLA 1LIDA 1IIUA 1ACDA 4O4SA 2G7BA 1KFFA 3BU1A 1VWDB 3WJFA 4CPFA 1ZRYA 2RCTA 1GKAA 1SWEA 4CPHB 3BLGA 1HN2A 1SWQA 4O9SA 3GE2A 2O62A 1VYOA 4KH8A 4YBUA 3Q34A 5HZ9A 4ZHFA 2AT8X 3D97A 4NYRA 4YGHA 4TKBA 4BJ8A 3PECA 4AZPA 1STSB 2IZLB 2RTCB 4KC8A 1EPBA 1QABE 1HMRA 2CZTA 5HBSA 1EIIA 1O8VA 4O4OA 4ORRA 5EPQA 3JQOA 3VG5A 1QY0A 4ES7A 1KT5A 5K68A 4R0BA 3HOEA 2PY1A 1EW3A 3B2HA 1MEPA 2RTOB 2EU7X 3IFBA 1T68X 1STRB 1HXLA 3JS1A 5H8TA 1E02A 4EXZA 1N7YA 2JW1A 2VFBA 3RDQA 1UZ2X 3P6CA 3U0DA 2IZGB 5CSEA 1LNMA 1BRQA 1LFOA 1TOWA 5B5FA 3D9WA 4ZR2A 2JU7A 1NC9A 2IZDB 1SLFB 2Q9SA 1KXOA 4HWMA 4I9SA 4YFRA 1UYNX 3MBTA 3WYPA 3FW5A 2GH7A 3D95A 2JOZA 3ELXA 3ZWEA 3VHIA 5HZ6A 2C1QA 2NNEA 2GTLM 2ALLX 1KT3A 4FBOA 1NDJA 1NQMA 1SWCA 1WBIA 2MWHA 2RTDB 2LKKA 2MHDA 3MX7A 4I3CA 4IB6A 4BGFA 4MISA 4CDEA 1RSTB 3NQ9A 1NGLA 1O1VA 1SA8A 1FELA 4YGGA 4GNWA 4ZJ0A 2BHVA 3DTQA 4M7MA 1OBPA 2I5ZO 4U3QA 4JHQA 5D45A 1KZXA 5D8JA 5EZ2A 2OVDA 1JMXA 3FENA 2BSZA 4AZNA 1IW2A 3JSQA 1VWOB 1GT3A 2OL8O 1OBQA 2AT5X 2XKLA 1SRGA 2Y3EA 3P6FA 3PQUA 4GK9A 3DSZA 2RTGB 4I3DA 1SWAA 2A2UA 4ML7B 2FHLA 1CBIA 3K3LA 5BVSA 4EEJA 4NLJA 1DFVA 1ERBA 1RSUB 3ZW1B 4Y0RA 5HWZA 2W2FA 1PBOA 4BCSA 2OF8A
chains in the Genus database with same CATH topology
2FTBA 1ML7A 1DC9A 2AT0X 3F8AA 1G5WA 4MVKA 2X46A 3WJDA 5D4AA 2A2GA 1GT4A 1EPAA 1BBPA 4ZHGA 3FA6A 4CK4A 3FEKA 4LKPA 3HK1A 1DZKA 5F6ZA 1JYJA 2KW1A 4GRJA 5H9AA 1EXSA 2HYSA 1I4UA 3VG4A 5KIDA 1HQPA 1L6MA 2AMMX 1A2DA 2JU8A 1BRPA 2CM4A 4ALBA 4NYQA 4O3YA 3NX2A 4QNIA 1KT6A 3PH6A 4QZTA 1TW4A 5IO5A 2R74A 2WQ9A 5LJDA 3TF6A 4RUNA 4YFPA 4O49A 2OFMX 2W2AA 4OS3A 1GXAA 3BDRA 2F73A 3RSWA 2HNXA 1I05A 1ICNA 4IB7A 4A1HA 2X8FA 3ELZA 5LKFA 3NBXX 1SXUA 1Z24A 2FT9A 5HA0A 4IABA 2RCQA 3G7XA 3KFIA 2G78A 1OPBA 2RQ0A 4ALOA 3BX8A 1E5PA 1ZNDA 5KICA 1YWAA 1MX7A 3VPJE 4OMXA 4AZOA 4JGLA 1X8PA 1AELA 1DF3A 4ZH6A 1YIVA 4ORUA 3NQ3A 4HPBA 3PPTA 2KTDA 3OBLA 3V8UA 1HBQA 3EMMA 2ZAIA 3S5VA 5DPQA 4IAXA 3ZW2A 1SY2A 3KFFA 3VE1A 1GGLA 2A3FX 2P8GA 3O2YA 4YMYA 1A57A 5F1EA 4ZHHA 1GX9A 2QO5A 2QOSC 3PP6A 3S26A 1SY1A 1DZPA 5AJCA 3HWEA 3B2IA 3EYCA 3FR4A 5HA1A 3S5XA 1YUPA 3C78X 4Y0QA 4KC7A 4PSQA 2W2BA 4ORYA 1JJXA 1S7DA 4YKOA 3FIQA 2AT6X 3KFGA 1IFCA 1MX8A 4FBVA 4QGXA 3TGCA 4CSBA 2KT4B 1S2PA 1TOUA 1UREA 2BT9A 1JZUA 1GT5A 1LKEA 3WXQA 5KHPA 2L5PA 3D96A 1FTPA 3FELA 2RN4A 4QQ1A 4XMDA 2GJ5A 5L8OA 3UEXA 3APWA 3CQRA 2ASNX 5EDCA 1EIOA 4GKCA 3B2LA 3HWGA 4O3ZA 2NNDA 4D6BA 4U8UM 3IA8A 4A60A 3HOLA 4ODDA 3ZW0B 2A13A 4KIIA 2Q39A 1D2UA 2LFOA 4HPDA 1S44A 5FQ7E 1PMPA 5HCCC 4ZH9A 4GETA 3BRNA 4U8UN 1B4MA 2F09A 1T8VA 5CYBA 5HAEA 4ID2A 3UEVA 3P24A 3KZAA 4TJZA 3UAQA 1GKAB 4FBRA 1MUPA 4NNSA 1ADLA 1Y9LA 5HZQA 1ZNLA 5FENA 1JYDA 2JN3A 4YFQA 2HZQA 2GTLN 2WR6A 1SMPI 3H3IA 3EBKA 1PEEA 2JMBA 2NNQA 3LV4A 3NP1A 3NX1A 3C76X 3NADA 2DM5A 4GU8A 3RZYA 4FGIB 2R56A 4HFOA 1U17A 5HZ5A 3HWFA 2GC9A 2LBVA 3VE2A 1LIEA 3TZSA 1ERXA 3KFHA 5LJGA 1BM5A 1KT7A 5D47A 2R73A 4MVEA 2LB6A 4YBPA 5K06A 4OMWA 2YG2A 4NP1A 4YH0A 5AEOA 3PH5A 2E4JA 1SY3A 3FEPA 4I6SA 3ZQ3A 4EQAC 4CV7A 2CM9A 5B27A 5LJKA 1AB0A 2ANSA 1A3YA 4U8UO 5F6BA 3L4RA 4L1NA 3FR2A 1JIWI 1AVGI 3CBCA 3CWKA 1B56A 4OS0A 3I17A 4MVIA 2RD7C 5HCEC 4ZFXA 5HCDC 2WUTA 1ZNEA 4XMGA 1GX8A 5H9NA 1KZWA 1QWDA 1BWYA 4DQ3A 1XCAA 2GTLO 4MVLA 3FLLA 5FAZA 1BEBA 2FWVA 2X45A 4TLJA 4UU3A 2WEWA 1SY0A 1LPJA 3STMX 1KOIA 1JV4A 1TVQA 3VG7A 5LJHA 3ZZVA 2YMSA 4XMCA 1YP7A 3NPOA 1Y9TA 3WJCA 2K62A 1OPAA 5HTDA 3NQKA 1MVGA 1H91A 4Y0PA 2NP1A 4WFVA 1CBRA 1CBSA 1ALBA 5IO7A 4ZCBA 3WJBA 1X89A 4DQ4A 2LBAA 2Z4IA 5CE4A 5D48A 2RA6A 4BQUA 3ZI8A 3P6GA 3NR3A 4ZHDA 1X8QA 1VYGA 3I0AA 4QRLA 3WJEA 4QGVA 5C0NA 3N91A 1X8OA 2QO6A 4YCHA 2QMIA 3CMPA 3SAOA 1EQDA 1BLRA 2OVEA 2AL0X 1X8NA 2FR3A 4XMEA 2LA7A 2KTSA 1HBPA 1SXXA 2N93A 3C77X 3OD9A 4GH7A 4IMOA 2MJIA 3Q6LA 3O19A 4ON1A 1RLBE 1B8EA 5LJCA 1BJ7A 4NW4A 5BVQA 3ZUIA 2XSTA 1ZNKA 2POAA 3FA7A 5L8IA 3VG2A 3PQSA 2FS7A 1O1UA 3U03A 4GZVA 3SOTA 2IFBA 5HTEA 4RUUA 5LJEA 2GTFX 3BY0A 2A0AA 3EBWA 4I95A 4TKHA 1DZJA 3WJGA 4AW8A 1HMSA 1G74A 4LKTA 4WHIA 3QKGA 3D4RA 4GE1A 1TXLA 4YDBA 2AH7X 3APXA 4A8ZA 5LJBA 4YGZA 3APVA 3HWDA 1DZMA 3GAQA 2MO5A 2WSJA 3AKNA 2X8TA 4IBAA 1FEMA 4TKJA 3VU1A 4Y0SA 2MM3A 3BSZE 4LQZA 4ORXA 4QYNA 2OFRX 1XKIA 2HZRA 2HLVA 3WOVA 4O4UA 2OVAA 4BVMA 4QYPA 5AJBA 1KGLA 2WEXA 2WWPA 1LICA 1YWBA 1RBPA 1G85A 1YWCA 2Q2PA 5F7GA 3ZUOA 2L67A 2QM9A 2Q4NA 4O3XB 2X8SA 1PM1X 5FQ6E 3P6EA 5FFHA 4GDZA 1LIFA 2CBRA 1KQXA 1KT4A 4EFGA 4NLIA 1OEEA 1YWDA 3P6HA 1R0UA 1MDCA 3O22A 4WFUA 3FYFA 1SXYA 1X71A 5FQ8E 1QQSA 3TGAA 2FS6A 2BS5A 2OZQA 3ZW1A 4KCAA 3LHNA 1FE3A 4IB8A 3WVMA 1LF7A 5BVTA 5HZ8A 3FA9A 1B0OA 3CR6A 3TGBA 4A1YA 1I04A 1FDQA 4HPCA 3APUA 4M6SA 4FQBB 1GT1A 5DG4A 4D6AA 4ORWA 1X8UA 3CBSA 1CBQA 5F58A 5IO6A 4QZUA 4XMHA 2FR2A 4AZMA 1BSQA 5EEDA 1ZNGA 4I3BA 1I06A 1E06A 1A18A 2KD2A 1EI5A 5JR8A 2FRSA 4YDAA 1VPRA 2BLGA 3RWXA 4WBKA 1OBUA 1KQWA 4KT5A 3HTYA 4GNYA 4EDEA 1VYFA 1LIBA 1CJ5A 1NP1A 3FW4A 3BS2A 4TNNA 2WQAE 2FLJA 4LZUA 4NNTA 1BSYA 3B2JA 3OJYC 1OEKA 1ICMA 2ACPX 5BYPA 3F6ZB 1GM6A 4IMNA 2G79A 3KQ0A 2Z4HA 2AT3X 1IKEA 3PEDA 4ZGUA 3STNA 4IB9A 5LKEA 4AYHA 1E00A 3MVFA 1T0VA 2ACOA 1D3SA 1AQBA 1HMTA 1SXWA 4IAWA 4AZQA 2M4LA 1FENA 2QO4A 5H9KA 4PJ2A 1N0SA 1DV9A 3BX7A 1OEJA 1QFVA 3EM0A 3OE3A 2AKQA 2L68A 4ZGFA 2BS6A 4QGWA 1IFBA 1EUOA 4YCEA 4HPAA 4TQ2A 1QFTA 2CBSA 4I9RA 4O4XA 4U9CA 3STKA 1QG5A 4LZVA 1G7NA 5B29A 2HMBA 4O3WA 2Q2MA 4OS8A 3P02A 3F9DA 4BOEA 5H9LA 2L9CA 1NP4A 5L8NA 4N7DA 3U9PC 4COTA 1ZNHA 3S60A 1JBHA 1IKJA 3WBGA 1EALA 4MIRA 3T1DA 4YKMA 3E3CA 3RBYA 3RKGA 1QY2A 2K23A 3CQNA 4L3RA 5AQ6A 4INNA 4ARHA 4QAEA 2OVSA 3VG3A 3AKMA 1U18A 4AZRA 1QY1A 2JU3A 4ORSA 5EDBA 3BU9A 1U0XA 3FMZA 1BSOA 4UU2A 4N7CA 1YP6A 3ZW0A 3FR5A 3UEWA 1CRBA 4K19A 2CZUA 1JJJA 3FA8A 3P6DA 3UEUA 2ZAGA 3B2KA 4XMFA 1P6PA 1LIDA 1IIUA 1ACDA 4O4SA 2G7BA 3BU1A 3WJFA 1ZRYA 2RCTA 1GKAA 3BLGA 1HN2A 4O9SA 3GE2A 2O62A 4KH8A 4YBUA 5HZ9A 4ZHFA 2AT8X 3D97A 4NYRA 4YGHA 4TKBA 3PECA 4AZPA 4KC8A 1EPBA 1QABE 1HMRA 2CZTA 5HBSA 1EIIA 1O8VA 4O4OA 4ORRA 5EPQA 3JQOA 3VG5A 1QY0A 4ES7A 1KT5A 4R0BA 3HOEA 2PY1A 1EW3A 3B2HA 3IFBA 3JS1A 2EU7X 5H8TA 1T68X 1E02A 4EXZA 2JW1A 1UZ2X 3P6CA 3U0DA 1LNMA 1BRQA 1LFOA 1TOWA 4ZR2A 2JU7A 4HWMA 4ZHCA 2Q9SA 1KXOA 4I9SA 4YFRA 3MBTA 3FW5A 3D95A 2JOZA 3ELXA 3ZWEA 5HZ6A 2NNEA 2GTLM 2ALLX 1KT3A 4FBOA 5EEEA 3VG6A 2MWHA 4I3CA 4IB6A 2LKKA 2MHDA 3MX7A 4MISA 3NQ9A 1NGLA 1O1VA 1SA8A 1FELA 4YGGA 4GNWA 4ZJ0A 2BHVA 3DTQA 4M7MA 1OBPA 4U3QA 5D45A 1KZXA 5D8JA 5EZ2A 2OVDA 3FENA 4AZNA 1IW2A 3JSQA 1GT3A 1OBQA 2AT5X 2XKLA 3P6FA 3PQUA 4GK9A 3DSZA 4I3DA 2A2UA 4ML7B 1CBIA 3K3LA 5BVSA 4EEJA 4NLJA 1DFVA 1ERBA 3ZW1B 4Y0RA 5HWZA 2W2FA 1PBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNI A;  3P02 A;  3NQK A;  3SOT A; 
#chains in the Genus database with same CATH topology
 2FTB A;  5JD2 A;  1ML7 A;  5IRU A;  1DC9 A;  2AT0 X;  3F8A A;  1G5W A;  4NV8 A;  4MVK A;  2X46 A;  1UYO X;  5B11 O;  1RAV A;  3WJD A;  5D4A A;  2A2G A;  4CDF A;  2G8C O;  2IZF B;  1GT4 A;  1WUB A;  3LTW A;  1EPA A;  1LCV A;  1BBP A;  1LDQ A;  2C1S A;  4ZHG A;  3FA6 A;  4CK4 A;  3FEK A;  4LKP A;  2Y3F A;  1DZK A;  3HK1 A;  1JYJ A;  2KW1 A;  4GRJ A;  5F6Z A;  5H9A A;  1EXS A;  2HYS A;  1I4U A;  3VG4 A;  5KID A;  1HQP A;  1L6M A;  2AMM X;  4DNE A;  1A2D A;  2JU8 A;  2RTN B;  1BRP A;  1AVE A;  2CM4 A;  4ALB A;  4NYQ A;  2MF6 A;  3NX2 A;  4O3Y A;  4QNI A;  5L3Y A;  1KT6 A;  3PH6 A;  4QZT A;  1TW4 A;  1SWP A;  3QQ2 A;  5IO5 A;  2IZC B;  2R74 A;  2WQ9 A;  2X4M A;  1N9Y A;  5LJD A;  3TF6 A;  4RUN A;  4YFP A;  4O49 A;  2OFM X;  1SRJ A;  2W2A A;  1GXA A;  3BDR A;  4OS3 A;  2IZK A;  1I78 A;  2F73 A;  1Y55 X;  3RSW A;  3RY2 A;  2HNX A;  1I05 A;  1ICN A;  1SWF A;  4IB7 A;  3RDU A;  2IZI A;  4A1H A;  3CKG A;  2X8F A;  3ELZ A;  4GUZ A;  3NBX X;  5LKF A;  1SXU A;  1Z24 A;  2FT9 A;  4OKA A;  5HA0 A;  4IAB A;  2RCQ A;  4Z2V A;  3G7X A;  2CAM A;  3KFI A;  2RTR B;  2G78 A;  1OPB A;  2RQ0 A;  4ALO A;  4BX5 B;  3BX8 A;  1E5P A;  1LEL A;  1ZND A;  1YWA A;  5KIC A;  1MX7 A;  3VPJ E;  4BBO A;  2VFC A;  4OMX A;  4AZO A;  4JGL A;  1X8P A;  1AEL A;  1DF3 A;  4ZH6 A;  1YIV A;  4ORU A;  3KVN A;  3NQ3 A;  4HPB A;  3PPT A;  2KTD A;  3OBL A;  3V8U A;  1HBQ A;  3EMM A;  1NQN A;  1VWB B;  4GD9 A;  2ZAI A;  3S5V A;  1VWI B;  2IZA A;  5DPQ A;  4IAX A;  3ZW2 A;  4BX7 B;  1SY2 A;  3KFF A;  3VE1 A;  1GGL A;  2A3F X;  2BC3 A;  2P8G A;  2RTP B;  3O2Y A;  4YMY A;  3T2X A;  1A57 A;  5F1E A;  4ZHH A;  1GX9 A;  2QO5 A;  2QOS C;  3EW1 A;  3PP6 A;  5IRA A;  4BX6 A;  1VWA B;  3S26 A;  1SY1 A;  1DZP A;  5AJC A;  2A5C A;  2OFA A;  3HWE A;  3B2I A;  3EYC A;  3FR4 A;  5HA1 A;  3S5X A;  1YUP A;  3C78 X;  2RTQ B;  4Y0Q A;  4KC7 A;  4PSQ A;  2W2B A;  4ORY A;  3VGW A;  1JJX A;  1S7D A;  4YKO A;  2OF9 A;  1N4J A;  3FIQ A;  1Y0G A;  2AT6 X;  3KFG A;  1IFC A;  1MX8 A;  4FBV A;  4QGX A;  2IZJ A;  4GGR A;  2KT4 B;  1S2P A;  1TOU A;  1URE A;  2BT9 A;  4CSB A;  4OEL A;  3TGC A;  1JZU A;  1GT5 A;  2OY1 O;  4Z27 A;  1LKE A;  3WXQ A;  2OY7 A;  5KHP A;  2L5P A;  3D96 A;  1FTP A;  3FEL A;  2RN4 A;  4QQ1 A;  4XMD A;  2GJ5 A;  5L8O A;  4Z6J A;  3UEX A;  3APW A;  3CQR A;  2ASN X;  2UZ2 A;  5EDC A;  4GKC A;  1EIO A;  2X34 A;  3EC5 A;  3B2L A;  3HWG A;  4O3Z A;  3VHH A;  2NND A;  4D6B A;  4U8U M;  3IA8 A;  4A60 A;  3HOL A;  4ODD A;  3ZW0 B;  2A13 A;  4KII A;  2Q39 A;  1D2U A;  2LFO A;  4HPD A;  1S44 A;  5FQ7 E;  1PMP A;  5HCC C;  4Z28 A;  4YVB A;  4ZH9 A;  4GET A;  3BRN A;  4U8U N;  2RTI B;  4Y59 A;  1B4M A;  2AF5 A;  2F09 A;  3RY1 A;  4CDD A;  1T8V A;  5CYB A;  5HAE A;  2OY5 O;  1SWK A;  4ID2 A;  3UEV A;  3P24 A;  3KZA A;  4TJZ A;  3UAQ A;  1GKA B;  4FBR A;  1MUP A;  4NNS A;  1ADL A;  1Y9L A;  5HZQ A;  3RDX A;  1ZNL A;  5FEN A;  1JYD A;  2RTJ A;  2JN3 A;  4YFQ A;  2HZQ A;  2GTL N;  2WR6 A;  1SMP I;  3H3I A;  4CPI A;  3EBK A;  1PEE A;  2JMB A;  2NNQ A;  3LV4 A;  3NP1 A;  3NX1 A;  3C76 X;  3NAD A;  2DM5 A;  4GU8 A;  3RZY A;  1SRH A;  3SLO A;  4FGI B;  2R56 A;  2IZB A;  4HFO A;  1U17 A;  5EEE A;  5HZ5 A;  3HWF A;  1VWF B;  4C5P A;  2GC9 A;  2LBV A;  3VE2 A;  1SLE B;  1LIE A;  3TZS A;  1ERX A;  3KFH A;  5LJG A;  1BM5 A;  2C4I A;  1KT7 A;  5D47 A;  1SRE A;  2R73 A;  4MVE A;  2LB6 A;  4YBP A;  3SLT A;  5K06 A;  4OMW A;  1N43 A;  1SWS A;  1SWG A;  1VWL B;  2YG2 A;  4NP1 A;  4YH0 A;  1VWR B;  2OL6 O;  5AEO A;  3SZI A;  3WZQ A;  3PH5 A;  1JMZ A;  3HPE A;  2E4J A;  1SY3 A;  3FEP A;  2X55 A;  4I6S A;  5B10 O;  3ZQ3 A;  4EQA C;  2CM9 A;  4CV7 A;  5B27 A;  5LJK A;  1LCW A;  2OL7 A;  1AB0 A;  2ANS A;  1A3Y A;  4U8U O;  5F6B A;  3L4R A;  1VWP B;  3FR2 A;  4L1N A;  1JIW I;  3VG6 A;  4Z2P A;  1AVG I;  3CBC A;  3CWK A;  1B56 A;  5K67 A;  3CKF A;  5IXG A;  4OS0 A;  3I17 A;  4MVI A;  2RD7 C;  3WZN A;  5HCE C;  4ZFX A;  5HCD C;  2WUT A;  1ZNE A;  2RTF B;  1SWL A;  2VDF A;  4XMG A;  1GX8 A;  4Y5D A;  5H9N A;  4CPE A;  1KZW A;  1QWD A;  1BWY A;  4DQ3 A;  1XCA A;  4GDA A;  2GTL O;  4MVL A;  3FLL A;  5FAZ A;  1BEB A;  2FWV A;  2X45 A;  4TLJ A;  4UU3 A;  2WEW A;  1SY0 A;  1LPJ A;  1HXZ A;  3STM X;  1KOI A;  1JV4 A;  1TVQ A;  2PI3 O;  3VG7 A;  3WYQ A;  2RTB B;  5LJH A;  3ZZV A;  2YMS A;  4XMC A;  1YP7 A;  1VWN B;  3NPO A;  1Y9T A;  2G5L A;  2K62 A;  3WJC A;  1OPA A;  1K24 A;  1OSP O;  5HTD A;  2RTA A;  3NQK A;  3RE5 A;  1MVG A;  2QCB A;  1H91 A;  4Y0P A;  1I9H A;  1RXH A;  2NP1 A;  4WFV A;  1CBR A;  1CBS A;  1ALB A;  5IO7 A;  4ZCB A;  3WJB A;  1X89 A;  4DQ4 A;  2LBA A;  2Z4I A;  5CE4 A;  1W5R A;  2AVI A;  5D48 A;  1HY2 A;  2RA6 A;  1KL5 A;  4BQU A;  3ZI8 A;  1SWD A;  3P6G A;  3NR3 A;  1E2T A;  3SLJ A;  4ZHD A;  1X8Q A;  1VWK B;  1VYG A;  1VWG B;  3FID A;  3I0A A;  4QRL A;  3WJE A;  4QGV A;  4CPH A;  5C0N A;  1GX3 A;  1HQQ A;  1X8O A;  1KL3 A;  2QO6 A;  3N91 A;  4YCH A;  2QMI A;  3CMP A;  3SAO A;  1EQD A;  1BLR A;  2OVE A;  2AL0 X;  1X8N A;  2FR3 A;  4XME A;  2KTS A;  1HBP A;  1SXX A;  2LA7 A;  2N93 A;  3C77 X;  1SWB A;  3OD9 A;  4GH7 A;  4IMO A;  2MJI A;  3Q6L A;  3O19 A;  1W6F A;  1RLB E;  4ON1 A;  1B8E A;  5LJC A;  1BJ7 A;  1JQP A;  4NW4 A;  5BVQ A;  3ZUI A;  2XST A;  1IJ8 A;  5B5G A;  1ZNK A;  2POA A;  3FA7 A;  5L8I A;  3VG2 A;  3PQS A;  2FS7 A;  2HKD A;  1O1U A;  2F01 A;  3U03 A;  4GZV A;  3SOT A;  2IFB A;  1K3B A;  5HTE A;  4RUU A;  5LJE A;  2GTF X;  3BY0 A;  2A0A A;  3EBW A;  2QOM A;  4I95 A;  1DZJ A;  4TKH A;  3SZH A;  3WJG A;  4AW8 A;  1HMS A;  1G74 A;  2DJF A;  2RTM A;  4LKT A;  4WHI A;  3QKG A;  3D4R A;  4GE1 A;  3RE6 A;  1TXL A;  4YDB A;  2AH7 X;  3APX A;  4A8Z A;  5LJB A;  4Z2O A;  4YGZ A;  3APV A;  3HWD A;  1DZM A;  2OY8 A;  2MO5 A;  2WSJ A;  3AKN A;  2X8T A;  3GAQ A;  1FEM A;  4I60 A;  4IBA A;  4TKJ A;  3VU1 A;  4Y0S A;  2MM3 A;  3BSZ E;  4LQZ A;  4ORX A;  4QYN A;  2OFR X;  1XKI A;  2DJG A;  2HZR A;  2HLV A;  3WOV A;  4O4U A;  1KL4 A;  2OVA A;  4BVM A;  4QYP A;  5AJB A;  1KGL A;  2WEX A;  1SWH A;  2WWP A;  1LIC A;  1YWB A;  1RBP A;  1G85 A;  1YWC A;  2Q2P A;  1SLD B;  2ZSC A;  5F7G A;  2L67 A;  3X00 A;  3ZUO A;  2UYW A;  2QM9 A;  2Q4N A;  4O3X B;  2X8S A;  1PM1 X;  1Y52 X;  3P6E A;  5FQ6 E;  5B3M O;  1LCZ A;  5FFH A;  2Y32 A;  4GDZ A;  1LIF A;  2CBR A;  1KQX A;  1KT4 A;  4EFG A;  4NLI A;  2RTK A;  1OEE A;  1RXJ A;  1YWD A;  3P6H A;  1R0U A;  1MDC A;  1SWO A;  3O22 A;  4WFU A;  3FYF A;  1SXY A;  1X71 A;  1STP A;  5FQ8 E;  3PK2 A;  5B2A O;  1QQS A;  3TGA A;  2FS6 A;  2BS5 A;  2OZQ A;  3ZW1 A;  4KCA A;  3LHN A;  1FE3 A;  4IB8 A;  1SWT A;  1LF7 A;  3WVM A;  5BVT A;  1RXK A;  5HZ8 A;  2A8G A;  3FA9 A;  4JO6 A;  4DCB A;  1B0O A;  3CR6 A;  3FDC A;  3TGB A;  4A1Y A;  1I04 A;  1FDQ A;  4HPC A;  3APU A;  4M6S A;  4FQB B;  1GT1 A;  5DG4 A;  2OFB A;  3RDO A;  4MEE A;  2WPU A;  4D6A A;  4ORW A;  1X8U A;  3CBS A;  1CBQ A;  5F58 A;  5IO6 A;  4QZU A;  1VWM B;  4XMH A;  2FR2 A;  4AZM A;  1LDO A;  1BSQ A;  5EED A;  1ZNG A;  4I3B A;  1I06 A;  3T6L A;  1E06 A;  4GJS A;  1N9M A;  1A18 A;  2KD2 A;  1EI5 A;  5JR8 A;  2FKG A;  1MOY A;  4OEM A;  2A5B A;  3RDS A;  1SWU A;  2FRS A;  3WZP A;  1SWN A;  2IZH B;  4IRW A;  1VPR A;  2BLG A;  5CHK A;  1W4T A;  4YDA A;  1SWR A;  4WBK A;  3RWX A;  1OBU A;  1KQW A;  4KT5 A;  3HTY A;  4GNY A;  3WZO A;  4EDE A;  1VYF A;  1VWQ B;  1LIB A;  4EKV A;  1CJ5 A;  1NP1 A;  3FW4 A;  3BS2 A;  4TNN A;  2WQA E;  2FLJ A;  4LZU A;  4NNT A;  1BSY A;  3B2J A;  3OJY C;  1OEK A;  3PDF A;  1ICM A;  2ACP X;  5BYP A;  2FGS A;  3F6Z B;  1GM6 A;  2JGS A;  1NBX A;  2I5V O;  3MM0 A;  2G79 A;  4IMN A;  3KQ0 A;  2FHN X;  2Z4H A;  1MK5 A;  1SLG B;  1IKE A;  2AT3 X;  3PED A;  4GGT A;  3MG5 A;  4ZGU A;  4GGZ A;  3STN A;  4IB9 A;  5LKE A;  4AYH A;  1E00 A;  3MVF A;  1T0V A;  2ACO A;  1D3S A;  1AQB A;  1HMT A;  1SXW A;  4IAW A;  4AZQ A;  1SRF A;  4BX5 A;  1LUQ A;  2M4L A;  1FEN A;  2QO4 A;  5H9K A;  1SWJ A;  4PJ2 A;  1N0S A;  3AUM O;  1DV9 A;  3BX7 A;  1OEJ A;  1QFV A;  3SZJ A;  3EM0 A;  3OE3 A;  2AKQ A;  2L68 A;  4ZGF A;  2BS6 A;  4QGW A;  1IFB A;  1EUO A;  4YCE A;  4U46 A;  4HPA A;  3T6F A;  1Y53 X;  4TQ2 A;  1QFT A;  2RTE B;  2CBS A;  3AEH A;  4I9R A;  4O4X A;  4U9C A;  3STK A;  1QG5 A;  1JJU A;  4LZV A;  3T2W A;  4BX7 A;  1FJ1 E;  1G7N A;  5B29 A;  2HMB A;  4O3W A;  1VWJ B;  4CDC A;  2Q2M A;  4OS8 A;  3P02 A;  3F9D A;  4BOE A;  5H9L A;  2L9C A;  2X56 A;  1NP4 A;  4ZHC A;  5L8N A;  4N7D A;  1PBY A;  2RTH B;  3U9P C;  2FKJ A;  1VWH B;  1MM9 A;  4COT A;  1ZNH A;  3S60 A;  1VWE B;  4BX6 B;  1JBH A;  1IKJ A;  3WBG A;  1EAL A;  4MIR A;  3RDM A;  3T1D A;  1DF8 A;  1VWC B;  4YKM A;  4B55 A;  3E3C A;  3RBY A;  3RKG A;  1QY2 A;  2K23 A;  3CQN A;  4L3R A;  4JNJ A;  5AQ6 A;  1SRI A;  4INN A;  1AVD A;  3EW2 A;  4ARH A;  4QAE A;  2OVS A;  3VG3 A;  3AKM A;  1U18 A;  4AZR A;  1QY1 A;  2JU3 A;  4ORS A;  4NV7 A;  5IRW A;  4GJV A;  5EDB A;  3BU9 A;  1U0X A;  3FMZ A;  1BSO A;  4UU2 A;  4N7C A;  5F2B A;  1YP6 A;  3ZW0 A;  2OYB O;  3FR5 A;  3UEW A;  1CRB A;  4K19 A;  2CZU A;  1JJJ A;  3FA8 A;  3P6D A;  1PTS A;  3UEU A;  2IZE B;  2ZAG A;  3VHM A;  3B2K A;  4XMF A;  1P6P A;  2X32 A;  2RTL A;  1LID A;  1IIU A;  1ACD A;  4O4S A;  2G7B A;  1KFF A;  3BU1 A;  1VWD B;  3WJF A;  4CPF A;  1ZRY A;  2RCT A;  1GKA A;  1SWE A;  4CPH B;  3BLG A;  1HN2 A;  1SWQ A;  4O9S A;  3GE2 A;  2O62 A;  1VYO A;  4KH8 A;  4YBU A;  3Q34 A;  5HZ9 A;  4ZHF A;  2AT8 X;  3D97 A;  4NYR A;  4YGH A;  4TKB A;  4BJ8 A;  3PEC A;  4AZP A;  1STS B;  2IZL B;  2RTC B;  4KC8 A;  1EPB A;  1QAB E;  1HMR A;  2CZT A;  5HBS A;  1EII A;  1O8V A;  4O4O A;  4ORR A;  5EPQ A;  3JQO A;  3VG5 A;  1QY0 A;  4ES7 A;  1KT5 A;  5K68 A;  4R0B A;  3HOE A;  2PY1 A;  1EW3 A;  3B2H A;  1MEP A;  2RTO B;  2EU7 X;  3IFB A;  1T68 X;  1STR B;  1HXL A;  3JS1 A;  5H8T A;  1E02 A;  4EXZ A;  1N7Y A;  2JW1 A;  2VFB A;  3RDQ A;  1UZ2 X;  3P6C A;  3U0D A;  2IZG B;  5CSE A;  1LNM A;  1BRQ A;  1LFO A;  1TOW A;  5B5F A;  3D9W A;  4ZR2 A;  2JU7 A;  1NC9 A;  2IZD B;  1SLF B;  2Q9S A;  1KXO A;  4HWM A;  4I9S A;  4YFR A;  1UYN X;  3MBT A;  3WYP A;  3FW5 A;  2GH7 A;  3D95 A;  2JOZ A;  3ELX A;  3ZWE A;  3VHI A;  5HZ6 A;  2C1Q A;  2NNE A;  2GTL M;  2ALL X;  1KT3 A;  4FBO A;  1NDJ A;  1NQM A;  1SWC A;  1WBI A;  2MWH A;  2RTD B;  2LKK A;  2MHD A;  3MX7 A;  4I3C A;  4IB6 A;  4BGF A;  4MIS A;  4CDE A;  1RST B;  3NQ9 A;  1NGL A;  1O1V A;  1SA8 A;  1FEL A;  4YGG A;  4GNW A;  4ZJ0 A;  2BHV A;  3DTQ A;  4M7M A;  1OBP A;  2I5Z O;  4U3Q A;  4JHQ A;  5D45 A;  1KZX A;  5D8J A;  5EZ2 A;  2OVD A;  1JMX A;  3FEN A;  2BSZ A;  4AZN A;  1IW2 A;  3JSQ A;  1VWO B;  1GT3 A;  2OL8 O;  1OBQ A;  2AT5 X;  2XKL A;  1SRG A;  2Y3E A;  3P6F A;  3PQU A;  4GK9 A;  3DSZ A;  2RTG B;  4I3D A;  1SWA A;  2A2U A;  4ML7 B;  2FHL A;  1CBI A;  3K3L A;  5BVS A;  4EEJ A;  4NLJ A;  1DFV A;  1ERB A;  1RSU B;  3ZW1 B;  4Y0R A;  5HWZ A;  2W2F A;  1PBO A;  4BCS A;  2OF8 A; 
#chains in the Genus database with same CATH homology
 2FTB A;  1ML7 A;  1DC9 A;  2AT0 X;  3F8A A;  1G5W A;  4MVK A;  2X46 A;  3WJD A;  5D4A A;  2A2G A;  1GT4 A;  1EPA A;  1BBP A;  4ZHG A;  3FA6 A;  4CK4 A;  3FEK A;  4LKP A;  3HK1 A;  1DZK A;  5F6Z A;  1JYJ A;  2KW1 A;  4GRJ A;  5H9A A;  1EXS A;  2HYS A;  1I4U A;  3VG4 A;  5KID A;  1HQP A;  1L6M A;  2AMM X;  1A2D A;  2JU8 A;  1BRP A;  2CM4 A;  4ALB A;  4NYQ A;  4O3Y A;  3NX2 A;  4QNI A;  1KT6 A;  3PH6 A;  4QZT A;  1TW4 A;  5IO5 A;  2R74 A;  2WQ9 A;  5LJD A;  3TF6 A;  4RUN A;  4YFP A;  4O49 A;  2OFM X;  2W2A A;  4OS3 A;  1GXA A;  3BDR A;  2F73 A;  3RSW A;  2HNX A;  1I05 A;  1ICN A;  4IB7 A;  4A1H A;  2X8F A;  3ELZ A;  5LKF A;  3NBX X;  1SXU A;  1Z24 A;  2FT9 A;  5HA0 A;  4IAB A;  2RCQ A;  3G7X A;  3KFI A;  2G78 A;  1OPB A;  2RQ0 A;  4ALO A;  3BX8 A;  1E5P A;  1ZND A;  5KIC A;  1YWA A;  1MX7 A;  3VPJ E;  4OMX A;  4AZO A;  4JGL A;  1X8P A;  1AEL A;  1DF3 A;  4ZH6 A;  1YIV A;  4ORU A;  3NQ3 A;  4HPB A;  3PPT A;  2KTD A;  3OBL A;  3V8U A;  1HBQ A;  3EMM A;  2ZAI A;  3S5V A;  5DPQ A;  4IAX A;  3ZW2 A;  1SY2 A;  3KFF A;  3VE1 A;  1GGL A;  2A3F X;  2P8G A;  3O2Y A;  4YMY A;  1A57 A;  5F1E A;  4ZHH A;  1GX9 A;  2QO5 A;  2QOS C;  3PP6 A;  3S26 A;  1SY1 A;  1DZP A;  5AJC A;  3HWE A;  3B2I A;  3EYC A;  3FR4 A;  5HA1 A;  3S5X A;  1YUP A;  3C78 X;  4Y0Q A;  4KC7 A;  4PSQ A;  2W2B A;  4ORY A;  1JJX A;  1S7D A;  4YKO A;  3FIQ A;  2AT6 X;  3KFG A;  1IFC A;  1MX8 A;  4FBV A;  4QGX A;  3TGC A;  4CSB A;  2KT4 B;  1S2P A;  1TOU A;  1URE A;  2BT9 A;  1JZU A;  1GT5 A;  1LKE A;  3WXQ A;  5KHP A;  2L5P A;  3D96 A;  1FTP A;  3FEL A;  2RN4 A;  4QQ1 A;  4XMD A;  2GJ5 A;  5L8O A;  3UEX A;  3APW A;  3CQR A;  2ASN X;  5EDC A;  1EIO A;  4GKC A;  3B2L A;  3HWG A;  4O3Z A;  2NND A;  4D6B A;  4U8U M;  3IA8 A;  4A60 A;  3HOL A;  4ODD A;  3ZW0 B;  2A13 A;  4KII A;  2Q39 A;  1D2U A;  2LFO A;  4HPD A;  1S44 A;  5FQ7 E;  1PMP A;  5HCC C;  4ZH9 A;  4GET A;  3BRN A;  4U8U N;  1B4M A;  2F09 A;  1T8V A;  5CYB A;  5HAE A;  4ID2 A;  3UEV A;  3P24 A;  3KZA A;  4TJZ A;  3UAQ A;  1GKA B;  4FBR A;  1MUP A;  4NNS A;  1ADL A;  1Y9L A;  5HZQ A;  1ZNL A;  5FEN A;  1JYD A;  2JN3 A;  4YFQ A;  2HZQ A;  2GTL N;  2WR6 A;  1SMP I;  3H3I A;  3EBK A;  1PEE A;  2JMB A;  2NNQ A;  3LV4 A;  3NP1 A;  3NX1 A;  3C76 X;  3NAD A;  2DM5 A;  4GU8 A;  3RZY A;  4FGI B;  2R56 A;  4HFO A;  1U17 A;  5HZ5 A;  3HWF A;  2GC9 A;  2LBV A;  3VE2 A;  1LIE A;  3TZS A;  1ERX A;  3KFH A;  5LJG A;  1BM5 A;  1KT7 A;  5D47 A;  2R73 A;  4MVE A;  2LB6 A;  4YBP A;  5K06 A;  4OMW A;  2YG2 A;  4NP1 A;  4YH0 A;  5AEO A;  3PH5 A;  2E4J A;  1SY3 A;  3FEP A;  4I6S A;  3ZQ3 A;  4EQA C;  4CV7 A;  2CM9 A;  5B27 A;  5LJK A;  1AB0 A;  2ANS A;  1A3Y A;  4U8U O;  5F6B A;  3L4R A;  4L1N A;  3FR2 A;  1JIW I;  1AVG I;  3CBC A;  3CWK A;  1B56 A;  4OS0 A;  3I17 A;  4MVI A;  2RD7 C;  5HCE C;  4ZFX A;  5HCD C;  2WUT A;  1ZNE A;  4XMG A;  1GX8 A;  5H9N A;  1KZW A;  1QWD A;  1BWY A;  4DQ3 A;  1XCA A;  2GTL O;  4MVL A;  3FLL A;  5FAZ A;  1BEB A;  2FWV A;  2X45 A;  4TLJ A;  4UU3 A;  2WEW A;  1SY0 A;  1LPJ A;  3STM X;  1KOI A;  1JV4 A;  1TVQ A;  3VG7 A;  5LJH A;  3ZZV A;  2YMS A;  4XMC A;  1YP7 A;  3NPO A;  1Y9T A;  3WJC A;  2K62 A;  1OPA A;  5HTD A;  3NQK A;  1MVG A;  1H91 A;  4Y0P A;  2NP1 A;  4WFV A;  1CBR A;  1CBS A;  1ALB A;  5IO7 A;  4ZCB A;  3WJB A;  1X89 A;  4DQ4 A;  2LBA A;  2Z4I A;  5CE4 A;  5D48 A;  2RA6 A;  4BQU A;  3ZI8 A;  3P6G A;  3NR3 A;  4ZHD A;  1X8Q A;  1VYG A;  3I0A A;  4QRL A;  3WJE A;  4QGV A;  5C0N A;  3N91 A;  1X8O A;  2QO6 A;  4YCH A;  2QMI A;  3CMP A;  3SAO A;  1EQD A;  1BLR A;  2OVE A;  2AL0 X;  1X8N A;  2FR3 A;  4XME A;  2LA7 A;  2KTS A;  1HBP A;  1SXX A;  2N93 A;  3C77 X;  3OD9 A;  4GH7 A;  4IMO A;  2MJI A;  3Q6L A;  3O19 A;  4ON1 A;  1RLB E;  1B8E A;  5LJC A;  1BJ7 A;  4NW4 A;  5BVQ A;  3ZUI A;  2XST A;  1ZNK A;  2POA A;  3FA7 A;  5L8I A;  3VG2 A;  3PQS A;  2FS7 A;  1O1U A;  3U03 A;  4GZV A;  3SOT A;  2IFB A;  5HTE A;  4RUU A;  5LJE A;  2GTF X;  3BY0 A;  2A0A A;  3EBW A;  4I95 A;  4TKH A;  1DZJ A;  3WJG A;  4AW8 A;  1HMS A;  1G74 A;  4LKT A;  4WHI A;  3QKG A;  3D4R A;  4GE1 A;  1TXL A;  4YDB A;  2AH7 X;  3APX A;  4A8Z A;  5LJB A;  4YGZ A;  3APV A;  3HWD A;  1DZM A;  3GAQ A;  2MO5 A;  2WSJ A;  3AKN A;  2X8T A;  4IBA A;  1FEM A;  4TKJ A;  3VU1 A;  4Y0S A;  2MM3 A;  3BSZ E;  4LQZ A;  4ORX A;  4QYN A;  2OFR X;  1XKI A;  2HZR A;  2HLV A;  3WOV A;  4O4U A;  2OVA A;  4BVM A;  4QYP A;  5AJB A;  1KGL A;  2WEX A;  2WWP A;  1LIC A;  1YWB A;  1RBP A;  1G85 A;  1YWC A;  2Q2P A;  5F7G A;  3ZUO A;  2L67 A;  2QM9 A;  2Q4N A;  4O3X B;  2X8S A;  1PM1 X;  5FQ6 E;  3P6E A;  5FFH A;  4GDZ A;  1LIF A;  2CBR A;  1KQX A;  1KT4 A;  4EFG A;  4NLI A;  1OEE A;  1YWD A;  3P6H A;  1R0U A;  1MDC A;  3O22 A;  4WFU A;  3FYF A;  1SXY A;  1X71 A;  5FQ8 E;  1QQS A;  3TGA A;  2FS6 A;  2BS5 A;  2OZQ A;  3ZW1 A;  4KCA A;  3LHN A;  1FE3 A;  4IB8 A;  3WVM A;  1LF7 A;  5BVT A;  5HZ8 A;  3FA9 A;  1B0O A;  3CR6 A;  3TGB A;  4A1Y A;  1I04 A;  1FDQ A;  4HPC A;  3APU A;  4M6S A;  4FQB B;  1GT1 A;  5DG4 A;  4D6A A;  4ORW A;  1X8U A;  3CBS A;  1CBQ A;  5F58 A;  5IO6 A;  4QZU A;  4XMH A;  2FR2 A;  4AZM A;  1BSQ A;  5EED A;  1ZNG A;  4I3B A;  1I06 A;  1E06 A;  1A18 A;  2KD2 A;  1EI5 A;  5JR8 A;  2FRS A;  4YDA A;  1VPR A;  2BLG A;  3RWX A;  4WBK A;  1OBU A;  1KQW A;  4KT5 A;  3HTY A;  4GNY A;  4EDE A;  1VYF A;  1LIB A;  1CJ5 A;  1NP1 A;  3FW4 A;  3BS2 A;  4TNN A;  2WQA E;  2FLJ A;  4LZU A;  4NNT A;  1BSY A;  3B2J A;  3OJY C;  1OEK A;  1ICM A;  2ACP X;  5BYP A;  3F6Z B;  1GM6 A;  4IMN A;  2G79 A;  3KQ0 A;  2Z4H A;  2AT3 X;  1IKE A;  3PED A;  4ZGU A;  3STN A;  4IB9 A;  5LKE A;  4AYH A;  1E00 A;  3MVF A;  1T0V A;  2ACO A;  1D3S A;  1AQB A;  1HMT A;  1SXW A;  4IAW A;  4AZQ A;  2M4L A;  1FEN A;  2QO4 A;  5H9K A;  4PJ2 A;  1N0S A;  1DV9 A;  3BX7 A;  1OEJ A;  1QFV A;  3EM0 A;  3OE3 A;  2AKQ A;  2L68 A;  4ZGF A;  2BS6 A;  4QGW A;  1IFB A;  1EUO A;  4YCE A;  4HPA A;  4TQ2 A;  1QFT A;  2CBS A;  4I9R A;  4O4X A;  4U9C A;  3STK A;  1QG5 A;  4LZV A;  1G7N A;  5B29 A;  2HMB A;  4O3W A;  2Q2M A;  4OS8 A;  3P02 A;  3F9D A;  4BOE A;  5H9L A;  2L9C A;  1NP4 A;  5L8N A;  4N7D A;  3U9P C;  4COT A;  1ZNH A;  3S60 A;  1JBH A;  1IKJ A;  3WBG A;  1EAL A;  4MIR A;  3T1D A;  4YKM A;  3E3C A;  3RBY A;  3RKG A;  1QY2 A;  2K23 A;  3CQN A;  4L3R A;  5AQ6 A;  4INN A;  4ARH A;  4QAE A;  2OVS A;  3VG3 A;  3AKM A;  1U18 A;  4AZR A;  1QY1 A;  2JU3 A;  4ORS A;  5EDB A;  3BU9 A;  1U0X A;  3FMZ A;  1BSO A;  4UU2 A;  4N7C A;  1YP6 A;  3ZW0 A;  3FR5 A;  3UEW A;  1CRB A;  4K19 A;  2CZU A;  1JJJ A;  3FA8 A;  3P6D A;  3UEU A;  2ZAG A;  3B2K A;  4XMF A;  1P6P A;  1LID A;  1IIU A;  1ACD A;  4O4S A;  2G7B A;  3BU1 A;  3WJF A;  1ZRY A;  2RCT A;  1GKA A;  3BLG A;  1HN2 A;  4O9S A;  3GE2 A;  2O62 A;  4KH8 A;  4YBU A;  5HZ9 A;  4ZHF A;  2AT8 X;  3D97 A;  4NYR A;  4YGH A;  4TKB A;  3PEC A;  4AZP A;  4KC8 A;  1EPB A;  1QAB E;  1HMR A;  2CZT A;  5HBS A;  1EII A;  1O8V A;  4O4O A;  4ORR A;  5EPQ A;  3JQO A;  3VG5 A;  1QY0 A;  4ES7 A;  1KT5 A;  4R0B A;  3HOE A;  2PY1 A;  1EW3 A;  3B2H A;  3IFB A;  3JS1 A;  2EU7 X;  5H8T A;  1T68 X;  1E02 A;  4EXZ A;  2JW1 A;  1UZ2 X;  3P6C A;  3U0D A;  1LNM A;  1BRQ A;  1LFO A;  1TOW A;  4ZR2 A;  2JU7 A;  4HWM A;  4ZHC A;  2Q9S A;  1KXO A;  4I9S A;  4YFR A;  3MBT A;  3FW5 A;  3D95 A;  2JOZ A;  3ELX A;  3ZWE A;  5HZ6 A;  2NNE A;  2GTL M;  2ALL X;  1KT3 A;  4FBO A;  5EEE A;  3VG6 A;  2MWH A;  4I3C A;  4IB6 A;  2LKK A;  2MHD A;  3MX7 A;  4MIS A;  3NQ9 A;  1NGL A;  1O1V A;  1SA8 A;  1FEL A;  4YGG A;  4GNW A;  4ZJ0 A;  2BHV A;  3DTQ A;  4M7M A;  1OBP A;  4U3Q A;  5D45 A;  1KZX A;  5D8J A;  5EZ2 A;  2OVD A;  3FEN A;  4AZN A;  1IW2 A;  3JSQ A;  1GT3 A;  1OBQ A;  2AT5 X;  2XKL A;  3P6F A;  3PQU A;  4GK9 A;  3DSZ A;  4I3D A;  2A2U A;  4ML7 B;  1CBI A;  3K3L A;  5BVS A;  4EEJ A;  4NLJ A;  1DFV A;  1ERB A;  3ZW1 B;  4Y0R A;  5HWZ A;  2W2F A;  1PBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...