2BHVA

Structure of comb10 of the com type iv secretion system of helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
191
Chain Sequence
NKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPRENEVIAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Bacterial protein
molecule keywords COMB10
publication title Structures of Two Core Subunits of the Bacterial Type Iv Secretion System, Virb8 from Brucella Suis and Comb10 from Helicobacter Pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 39
structure length 191
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03743 TrbI Bacterial conjugation TrbI-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.160 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2bhvA02
2.40.128.260 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bhvA01
2BHVA 3JQOA
chains in the Genus database with same CATH superfamily
1Z6MA 2CZUA 4JHQA 1STPA 4JO6A 4YFQA 1MM9A 4HWMA 2QM9A 3SZIA 3CCQP 1JMXA 3I56P 5D47A 1FENA 3NQKA 1D1DA 3N91A 1SWHA 2GZFA 3OE3A 4IPYA 3LRYA 1LICA 1GXAA 2Q2MA 3FEPA 4ON1A 1VWGB 1SWFA 1RXHA 3MBTA 1E00A 1K3BA 4EDEA 3NY7B 4U0AA 2K62A 1VWBB 3H47A 4QZUA 1SWPA 1ZNDA 2ERHA 5HAEA 4NLIA 1B8EA 1KQXA 3G7XA 2JU1A 4QNBA 4NLJA 2L22A 3RDUA 4MVIA 4FBOA 4IMNA 2MVUA 3ZI8A 1X8PA 1MEPA 1SWCA 3D4RA 4B55A 3WJCA 4Y0QA 1BBPA 4UU2A 4A1YA 2LIUA 1Y9TA 2AT3X 1RXJA 1HQBA 1KLPA 2WR6A 1I4UA 2C1QA 2WSJA 4WFUA 1VQOP 4NNTA 5F1EA 3U43A 3C78X 4Z6JA 3FA8A 3RG2A 3CCSP 4O3YA 3MG5A 5HGLA 1Y9LA 2YG2A 4IBAA 4BQUA 1IMPA 1LIEA 4KC7A 2LBAA 3VG6A 1KT5A 2RTEB 3BU1A 4CDDA 1IUQA 4BX7A 1YP6A 1BAJA 1B56A 4U0FA 3RY2A 4ORYA 1IMQA 4QAEA 2OL8O 2MVVA 1E6JP 5B5GA 3ZZVA 4EEJA 4BCSA 1RXKA 4ZCBA 5KP7B 4PH0A 2RTRB 4QGXA 4BPFA 5F2KA 1ACPA 1Y55X 5I4TG 4NEOA 1PBOA 4WFVA 3EM0A 3RWXA 5D8JA 3HYBA 3WZQA 2VLOA 2HKDA 1UYOX 2RTJA 4HPAA 3F8AA 4U0EA 4BPGA 2JU7A 3EJBA 1VYOA 2K23A 2JBGA 1EW3A 1SA8A 1CRBA 2FHNX 4BX6B 2NP1A 3G6EP 3FLLA 4GGZA 3GKLC 4O49A 1DF3A 1M6NA 2AF5A 2L4BA 3VHMA 2GH7A 2PEKA 1ZNLA 1SWLA 4KIIA 1W5RA 1RO2A 2L68A 3OBLA 3UEUA 1FJ1E 1T0VA 1O1UA 1SXXA 2A2GA 4YGZA 5L8IA 2IFBA 1LCVA 1LPJA 5BS1A 1ICNA 1OEJA 1VWEB 1QFVA 4R0BA 1VWMB 2ACPX 1T8KA 2KG8A 4BJ8A 1HY2A 1LIFA 2G78A 1DZMA 2FHLA 1NDJA 5B5FA 2IZIA 1M90Q 1YJNP 1EPBA 2K0YA 1G5WA 5F6BA 4UHPB 2QMIA 3EW1A 2VLPA 2X8TA 1ADLA 1VWQB 2JU2A 3AEHA 3GJNA 5EDBA 2MR7A 3HK1A 4BX5A 1BLRA 2KODA 2RTMA 5F2NA 2X34A 3WOVA 4OKAA 2OVEA 4F37A 2XKLA 4O9SA 5LJCA 4BX5B 2FS6A 3DS3A 3C76X 1Y52X 1HY8A 4I3BA 4YBUA 5AJCA 2ANSA 5AEOA 4TLJA 1VQ7P 3MGEA 1N7YA 3O19A 4IB7A 1SLEB 1OPAA 4O4UA 2GDWA 2RTGB 5L8OA 3CPWO 4YDBA 2NNEA 4GD9A 4HKGA 1I06A 3KFHA 4FBVA 5KHPA 3FR4A 5F2OA 3CR6A 1AYIA 4OS3A 4IAXA 3SLTA 3ZW2A 1I78A 2KGCA 1KOIA 2RTNB 1Q86Q 1M6EX 3L4RA 4ORRA 5D48A 2CG5B 4DQ4A 3NPOA 1GPJA 4YDAA 1NGLA 2MJIA 2N5HA 2OFMX 4GE1A 2GC9A 2KGAA 4QGWA 1XCAA 3D97A 2VLQA 3H0DA 4U8UN 1SRJA 1LCWA 2HMBA 1VKUA 1DV9A 2QOMA 3O2YA 2RTAA 2BC3A 4O4OA 4BBOA 5EJDA 4GRJA 1RO0A 1A18A 1FDQA 4DQ3A 1VPRA 3P6DA 1Q7YQ 3CKFA 4CPEA 3EYCA 1QVFO 4COTA 5EDCA 4AZMA 3FEKA 1D2UA 3GZMA 3SZHA 3WXQA 5D45A 2KG6A 3CCJP 4IRWA 2L9CA 4OS8A 3JS1A 5IXGA 5HZQA 3ZW0B 4QGVA 2OY7A 2CBSA 2X8SA 4XROA 1GKAB 1HXZA 2M8NA 2M8LA 1GX9A 4QYPA 3ZW1A 4GK9A 2OY1O 3PK2A 2CM9A 1SWGA 4ALOA 2K92A 1LUQA 3FELA 1PBYA 3SLOA 5KIDA 3BDRA 4YFPA 3ZW1B 1YI2P 4NP1A 5LJKA 5CSEA 2OZQA 2QNWA 1YWBA 2OARA 2X55A 3X00A 2NNDA 3HOLA 1VWIB 1RSUB 2BS5A 2VFCA 5DG4A 2I5ZO 1A43A 2EHTA 4LQZA 2DGYA 2N93A 1ML7A 1VQKP 1KQWA 4I9RA 2FRSA 1VWPB 4Z2PA 2ACOA 3Q34A 3WJFA 4CPIA 5LJEA 4CDFA 1BRPA 2MR8A 2CBRA 2RCTA 2RN4A 5FQ7E 4EFGA 4I60A 1BJ7A 5B29A 1ALBA 2F73A 2JYLA 4BOEA 4M6SA 2OVAA 3RDMA 1KZWA 3VRLC 1PM1X 2GZGA 4ID2A 1GGLA 2A0AA 4GJSA 4I95A 1KZXA 5EEDA 2RTOB 4ARHA 3ZQ3A 1SWUA 2DJGA 1ZNKA 1PEEA 3PEDA 1DV5A 4LKTA 2W2AA 5FQ8E 1VWDB 4Y59A 4GDZA 1L0IA 1OBQA 3DS0A 3AUMO 2ONTA 2UYWA 2MM3A 3VHIA 2OVSA 2JN3A 3C77X 2A3FX 3V8UA 1E0HA 1SLDB 2OFBA 2K5XA 3CC7P 3CQNA 5HZ9A 1BM5A 3FW5A 2EHSA 1GX3A 2CM4A 2ZAIA 4I6SA 2ZSCA 3KFGA 1VYFA 1ACDA 2OFRX 4RUUA 1YJWP 1D3SA 1VHNA 4GETA 4Y5DA 3P05A 1LELA 4LZUA 4GGRA 2GZEA 4FGIB 2Q2PA 1LDQA 5HCCC 2GDXA 4AZNA 2RTIB 1N43A 2HZQA 5HV8A 4DG9A 2X8FA 1VQPP 2IZKA 1S7DA 5LKEA 3CD6P 2PI3O 1AUMA 1JV4A 1L6MA 4YKOA 3I55P 2VLNA 2YMSA 2GZIA 5H9NA 5EW5E 2GTLN 4OS0A 3VG7A 4H2WC 1HQQA 4GKCA 2AL0X 5H8TA 1PMPA 4NV7A 5IO6A 5F2BA 4AZRA 4YH0A 1VWOB 5HGMA 1EALA 3RE5A 1VWHB 1GXGA 3NBXX 3B2HA 4C5PA 1RNIA 3KFFA 1I05A 3STMX 1EIAA 1SXWA 3RDXA 4M0IA 1FE3A 2JB0A 4FQBB 3HWDA 1K30A 2GJ5A 1LCZA 2OYBO 1AVGI 3CQRA 2A5CA 3RDOA 4R0MA 2P9XA 4AZQA 3FDCA 1LIDA 4BVMA 3RDSA 4H2YC 1OBUA 5HZ6A 1SREA 3B2LA 2Z44A 4DNEA 5DCKA 2RTHB 2AF8A 4MIRA 3FENA 2KOSA 5B10O 1VWAB 4U46A 1XKIA 5KP6B 1EOQA 3P6GA 2IZFB 1VYGA 1EIIA 2DJFA 1VQ9P 1NQNA 4A8ZA 2PY1A 4ES7A 4AYHA 3S60A 1Q82Q 3NQ3A 2MO5A 4GGTA 2Y3EA 3VE1A 2PENA 2LBVA 5IRWA 1I9HA 3OD9A 3STKA 3TGBA 2Q9SA 1OEEA 5B11O 4WBKA 3E3CA 2XZ1C 3WBHA 1E06A 1YIVA 1ZNGA 1YIJP 1N8RQ 4TKBA 2BS6A 1JQPA 4BX6A 1VQ4P 2GTLM 3ZWEA 3HOEA 4ZHDA 3UEXA 1A3YA 3CMPA 2RTPB 5CE4A 3SZJA 4BGFA 2RTBB 1KT7A 4O3WA 2FHSC 3PECA 4NYRA 5BS2A 4GUZA 3RE6A 3B2KA 4KT5A 2RTCB 1LNMA 2JW1A 3TGAA 1QY2A 5FFHA 1SWAA 2FT9A 2LB6A 1U0XA 3WYPA 4WHIA 3DS4A 2VDFA 1JYDA 4TKJA 4Z27A 5F7GA 4JGLA 1SWRA 1IIUA 2GTFX 2FADA 5K68A 3CCMP 3EMMA 4NW4A 3CCRP 4ORWA 3CCUP 4COPA 3Q20A 4PWVB 4U8UO 4EKVA 3KFIA 2BT9A 1M1KQ 5EPQA 2KD2A 1QVGO 1KFFA 5D4AA 1W6FA 1MX8A 4ZHCA 1BSOA 5HGNA 1GM6A 1U17A 1MX7A 3AKMA 1HMTA 3GAQA 2LF4A 4AZPA 3VPJE 2ZAGA 2OVDA 1BEBA 4ZHGA 3VGWA 3CC2P 1SY3A 3EW2A 1AQBA 1P6PA 2MD9A 4MRTC 5JPAA 3T6LA 2JYGA 1YWAA 4XMGA 2JMBA 4YBPA 1SMPI 2PEQA 3BU9A 3HWGA 2WPUA 2R74A 2QO4A 2QO5A 3APVA 4MVKA 3G1GA 5HTEA 3P6FA 1LFOA 5IO7A 2L0QA 2UZ2A 1IFCA 4YGHA 3WBGA 1KGLA 2AT8X 3HWEA 2ALLX 3QQ2A 5IO5A 4ORUA 1OPBA 1A8OA 5FENA 1W4TA 1S44A 2X46A 1N9YA 1RAVA 2KW1A 1ZNVA 2A13A 2FQ1A 4O3XB 3D95A 4ZH6A 1EQDA 3T2XA 3RG6C 4YMYA 1Q81Q 2L67A 4IMOA 2QOSC 1EXSA 2G7BA 5B3MO 3RZYA 1VWCB 3WJGA 1X8QA 3KVNA 1X8OA 2K2QA 2KGDA 2AFDA 4YFRA 1MUPA 3D96A 1GXHA 3WJDA 1K9MQ 4H2XC 2Z45A 1ZNHA 3RKGA 1CBIA 3EC5A 1L0HA 3HWFA 5FAZA 1U18A 2FQ0A 1Z24A 2FWVA 2Q4NA 4CPHB 2PY8A 5L8NA 1H91A 2G79A 3P02A 2HNXA 2PEOA 4MVEA 1K24A 3H4EA 3APUA 3ZW0A 3GE2A 2PEJA 1AVDA 1GKAA 1LDOA 3NR3A 2KTSA 4CV7A 2KGEA 3B5IA 5EEEA 4Z2OA 4M7MA 3CE7A 2IZBA 1NQMA 2HZRA 4U0CA 5LKFA 3WZNA 1DNYA 1KC8Q 3GZLA 2OY5O 1BSYA 5F6ZA 2LKKA 3B2JA 1JIWI 3PP6A 3FA9A 4OMXA 1UNKA 7CEIA 1AF8A 2KTDA 1EUOA 3OW2O 1QG5A 3FW4A 3U03A 4QNIA 1ZMBA 1LKEA 5IRUA 3P6CA 2PNGA 4CA3A 1KT6A 3STNA 3VG5A 4KCAA 2FR2A 1X71A 1UREA 2Y3FA 4ALBA 4ZGUA 1VQMP 3CBSA 2FGSA 4D6BA 4OMWA 2OL7A 4QQ1A 5EZ2A 5BVTA 1N4JA 4KC8A 4ORXA 5HBSA 2G5LA 4FBRA 4EQAC 3EBKA 4U0BA 3NQ9A 3VU1A 3P6EA 2LMLA 2IZLB 2RD7C 2QCBA 2Z4HA 1NQ4A 2WPTA 3FR2A 1QQSA 2QO6A 2OF9A 5H9AA 2X56A 2KW2A 2LA7A 3T6FA 2IZJA 3B4QA 2MWHA 1STRB 3G0VA 1HN2A 2EG5A 3K3LA 1IFBA 4AW8A 1VWNB 1YITP 4UU3A 3G71P 4XMFA 3U0DA 2CZTA 4XMDA 2K0DX 1SXYA 2OTJP 2BSZA 3FIDA 1OR5A 1FTPA 1I04A 2OTLP 2KOPA 2IZHB 2JAZA 3B2IA 1HQPA 4QRLA 2F09A 4XFZA 1DFVA 1CEIA 4TNNA 2AVAA 1MOYA 2VSQA 1ERBA 1SRGA 4IZ6A 1VQLP 3PH6A 4O3ZA 1HBPA 1TVQA 3I17A 1JZUA 5HZ5A 3CMEP 3PH5A 1DZKA 1GT4A 1K8AQ 4Z28A 2WWPA 1KL4A 3MX7A 2XT1A 4MEEA 2Q39A 5AQ6A 3M1MA 4QZTA 3PDFA 4XMEA 2IZCB 4MVLA 2NNQA 5BVSA 5HCDC 2KOOA 4ZHHA 2LL8A 2JGPA 5JD2A 3WZPA 2EU7X 4YCEA 1X8NA 4OELA 2LOLA 4CDEA 2FAEA 2N6ZA 5IRAA 1BXIA 4O4SA 2Z46A 1ZRYA 2EFJA 4O4XA 2MF4A 3G28A 3WJBA 1MZ8A 5JR8A 2E4JA 3FA7A 2AT5X 2OL6O 2XXMA 2BHVA 1OEKA 4INNA 3IFBA 5HTDA 5HVCA 4XMCA 1CBQA 1QFTA 1AB0A 1Y53X 1EMVA 4HPDA 1VWLB 2AT0X 2IZDB 4U9CA 2WQAE 1SWJA 4QKOA 2WQ9A 2F01A 3UAQA 2RTFB 4JNJA 3CKGA 5DPQA 2XZ0D 4I9SA 4L1NA 1CBRA 4CDCA 1KL3A 3S5XA 3IA8A 5HA1A 1X89A 3JSQA 4NV8A 3RDQA 4AZOA 2A8GA 2JOZA 2JQ4A 3LHNA 3AKNA 1SWTA 3EJDA 1LIBA 3E2DA 2WEWA 3HPEA 1ERXA 1AELA 3S5VA 4IAWA 2FKGA 2W2BA 3CC4P 2RTKA 5LJGA 1HMRA 5CHKA 1RBPA 2GYKA 1YHQP 1JJXA 2RQ0A 3ELZA 4WYMA 3BLGA 3TZSA 2O62A 5B2AO 4PSQA 1X3OA 2OY8A 3MM0A 4OEMA 1VQ5P 1SWOA 3Q6LA 2X32A 1M74A 4YVBA 2AMMX 3WZOA 1VWJB 1QY0A 4N7CA 4BX7B 4GDAA 1OSPO 4MISA 4ZHFA 4Z2VA 3NP1A 2P8GA 4LZVA 1JBHA 4IB9A 1FEMA 2EIAA 3BY0A 4GR2A 3CWKA 1IKJA 3QKGA 4ZJ0A 4ORSA 2QEXP 4ODDA 1WUBA 3VHHA 2R73A 1GT3A 4PXHB 2BLGA 1KQSO 4U0DA 4GR6A 4NNSA 1Y0GA 1HBQA 2N6YA 4Y0RA 1B0OA 4EXZA 4YCHA 2KWLA 3ZUIA 2RTLA 2LPKA 2AH7X 1MDCA 5HZ8A 1SY1A 1BWYA 1SWQA 4LKPA 2KG9A 2C1SA 2HYSA 3EJEA 3KZAA 1IJ8A 3UEWA 2LIWA 2MHDA 2A5BA 1HXLA 2AVIA 3APXA 3RY1A 1O8VA 3SOTA 2RTQB 1GT1A 3RBYA 2KOQA 4U3QA 1SWBA 3G21A 2VFBA 2PEMA 1F80D 2WUTA 4HPBA 2GZJA 4GZVA 1B4MA 1SWDA 2OFAA 3H3IA 1E2TA 4KH8A 3LTWA 4GJVA 3ELXA 3DS5A 3JQOA 1SWKA 1SY0A 2XSTA 3CXCO 2JO0A 1HMSA 1SWNA 1SLGB 4NYQA 2M5RA 2M8PA 2PEIA 3LMOA 4CSBA 3T1DA 1S72P 1DZJA 2Y32A 3NX2A 2MF6A 3DSZA 2A2UA 5BYPA 2ASNX 1VQNP 1VWRB 2N50A 5CZDB 2K0XA 3FMZA 4ZH9A 2KR5A 5HWZA 1CJ5A 2MY5A 1IKEA 1JJUA 1EI5A 1UZ2X 3SAOA 2RCQA 1JJ2O 2CAMA 4D6AA 4K19A 1ICMA 4IB8A 2QA4P 2DNWA 1KD1Q 1WBIA 1UYNX 5BVQA 3WJEA 5H9KA 4IB6A 2X2BA 2IZGB 5FQ6E 3BS2A 1KXOA 3NADA 1QWDA 4L3RA 2R56A 4HPCA 2AKQA 2LKIA 1STSB 2G8CO 1OBPA 3ZUOA 4IABA 3VG2A 1T68X 2JGSA 2K94A 3OJYC 5F58A 1YWDA 3HZQA 3CCLP 1TOUA 3P6HA 3FIQA 3BX8A 2IZAA 3T2WA 1PTSA 3CBCA 2FLJA 1IW2A 1ZNEA 1TW4A 5HA0A 3G26A 1RLBE 4CPHA 1NC9A 3NX1A 3U9PC 4GU8A 2CQ8A 3FYFA 2POAA 1BSQA 3O22A 3CCEP 1KT4A 1AVEA 4ZGFA 4HFOA 5HGOA 3BSZE 5KICA 4YGGA 2RA6A 2C4IA 3EBWA 1FR2A 4ML7B 2WEXA 2AT6X 1YUPA 3WVMA 4PJ2A 3VE2A 5KP8B 2OF8A 1VQ8P 3SLJA 1SWEA 1LF7A 3MVFA 2AFEA 3DTQA 2FQ2A 1UJZA 3D9WA 2Z4IA 1JMZA 2KORA 1SRIA 1BRQA 2CWOA 5CYBA 4TKHA 4COCA 4TQ2A 1SRHA 4N7DA 1TXLA 2NO8A 4RUNA 1DZPA 2BUOA 3APWA 2GDYA 2K93A 1MVGA 1A57A 1MK5A 1W2BO 1DC9A 1CBSA 1G74A 4ZR2A 4YKMA 3F9DA 4GH7A 4CPFA 3VG4A 2FS7A 1A2DA 5K06A 5K67A 3DTJA 2ROQA 3G1IA 2N98A 1EPAA 3FR5A 4GNWA 2FACA 1DF8A 2FTBA 3BRNA 1FELA 5L3YA 1QY1A 4CK4A 4A60A 1N0SA 1YJ9P 3RSWA 2LFOA 3F6ZB 5B27A 2L6EA 4BPHA 3TF6A 1SRFA 4Y0PA 3HTYA 3CCVP 5LJHA 1YP7A 3NTEA 3DS1A 3PQUA 3P24A 5LJBA 2X45A 4DCBA 1NP1A 5H9LA 1K73Q 1E02A 2KT4B 1QRJA 4A1HA 3FA6A 3CMAP 3PPTA 3LV4A 2W2FA 4U8UM 4GNYA 2FVAA 4XFXA 2N5IA 2RTDB 2E1MA 1S2PA 2L5PA 3I0AA 1VWKB 1GT5A 2CGQA 1KL5A 1R0UA 2GTLO 4I3DA 1G85A 4Y0SA 2M4LA 1SWSA 2X4MA 3S26A 1SXUA 2IZEB 2I5VO 2LTEA 2JU8A 1VQ6P 1JJJA 1NJIQ 1SLFB 1YWCA 3G29A 1QABE 3DS2A 1VWFB 2FR3A 1E5PA 1G7NA 1NP4A 1TOWA 3VG3A 1T8VA 5AJBA 4I3CA 1JYJA 2HLVA 1SY2A 4QYNA 2L9FA 1N9MA 3DPHA 4XFYA 4TJZA 2FKJA 1KT3A 1RSTB 1EIOA 2FVEA 3BX7A 4ZFXA 5LJDA 2XV6A 1NBXA 1X8UA 5C0NA 4XMHA 3PQSA 2CNRA 5HCEC 2FVFA 3G4SP 3UEVA 3TGCA 4XRQA 4PH1A 2DM5A 1O1VA 1GX8A 3KQ0A 3WYQA 2JU3A
chains in the Genus database with same CATH topology
1YI2P 2QO4A 4NP1A 5LJKA 2QO5A 3APVA 4MVKA 1VQ5P 2OZQA 3Q6LA 1YWBA 2OARA 1M74A 3G1GA 2CZUA 5HTEA 2NNDA 2AMMX 3P6FA 4YFQA 1QY0A 4HWMA 4N7CA 3HOLA 1LFOA 2QM9A 5IO7A 3CCQP 2BS5A 5DG4A 3I56P 5D47A 1A43A 1IFCA 4MISA 1FENA 3NQKA 4YGHA 1D1DA 3N91A 4LQZA 4ZHFA 2DGYA 3WBGA 3NP1A 2AT8X 2P8GA 4LZVA 1JBHA 1KGLA 3OE3A 3HWEA 4IB9A 4IPYA 1FEMA 2N93A 3LRYA 1LICA 2EIAA 2ALLX 1GXAA 1ML7A 4GR2A 2Q2MA 3BY0A 1VQKP 3CWKA 3FEPA 1IKJA 3QKGA 4ZJ0A 4ORSA 2QEXP 5IO5A 4ON1A 1KQWA 4ODDA 1OPBA 4ORUA 3MBTA 1A8OA 1E00A 1GT3A 2R73A 5FENA 4EDEA 4I9RA 2BLGA 4U0AA 1KQSO 1S44A 2FRSA 2K62A 2X46A 3H47A 4U0DA 4GR6A 2ACOA 2KW1A 4NNSA 3WJFA 1HBQA 4Y0RA 2A13A 5LJEA 4QZUA 1ZNDA 1B0OA 1BRPA 3D95A 4O3XB 4ZH6A 1EQDA 4EXZA 2CBRA 2RCTA 5HAEA 3RG6C 2RN4A 4NLIA 1B8EA 4YCHA 1KQXA 3ZUIA 4YMYA 1AELA 5FQ7E 1MDCA 3G7XA 2AH7X 4EFGA 4QNBA 1BJ7A 1Q81Q 1ALBA 4NLJA 2F73A 2L67A 2JYLA 4IMOA 4BOEA 5B29A 2QOSC 5HZ8A 4MVIA 1SY1A 4M6SA 1EXSA 2OVAA 1BWYA 4LKPA 2G7BA 4FBOA 3RZYA 4IMNA 3WJGA 2HYSA 1X8QA 3KZAA 3ZI8A 1X8PA 1KZWA 3VRLC 1X8OA 3UEWA 1PM1X 4ID2A 2MHDA 3D4RA 3WJCA 1GGLA 2A0AA 4I95A 4YFRA 4Y0QA 1BBPA 1MUPA 3APXA 4UU2A 4A1YA 1KZXA 3D96A 1O8VA 3WJDA 1K9MQ 1Y9TA 3SOTA 2Z45A 2AT3X 1ZNHA 5EEDA 3RKGA 1CBIA 1GT1A 3U0DA 3RBYA 4ARHA 3ZQ3A 3HWFA 4U3QA 5FAZA 2WR6A 1I4UA 3G21A 2WSJA 4WFUA 2PEMA 1U18A 1ZNKA 2WUTA 1Z24A 2FWVA 2Q4NA 4HPBA 1PEEA 3PEDA 1VQOP 2PY8A 4NNTA 4LKTA 5L8NA 2W2AA 5FQ8E 1H91A 4GZVA 1B4MA 2G79A 3P02A 5F1EA 2HNXA 2PEOA 4MVEA 3C78X 3H4EA 3APUA 4GDZA 3H3IA 1OBQA 3DS0A 3ZW0A 3GE2A 3FA8A 2PEJA 4KH8A 1GKAA 3CCSP 3NR3A 4O3YA 2KTSA 3ELXA 2ONTA 3DS5A 3JQOA 2MM3A 1SY0A 5HGLA 2XSTA 4CV7A 3CXCO 1Y9LA 3B5IA 2OVSA 2JN3A 3C77X 5EEEA 4M7MA 2A3FX 2JO0A 3V8UA 1HMSA 2YG2A 4IBAA 4NYQA 4BQUA 2HZRA 2M8PA 1LIEA 2PEIA 4U0CA 3CC7P 4KC7A 5LKFA 3CQNA 1KC8Q 2LBAA 3T1DA 4CSBA 5HZ9A 1S72P 1DZJA 1BM5A 1BSYA 3FW5A 3NX2A 5F6ZA 3VG6A 2LKKA 2CM4A 3B2JA 1JIWI 1KT5A 3DSZA 2ZAIA 3BU1A 2A2UA 5BYPA 1IUQA 2ASNX 1VQNP 4I6SA 1YP6A 3KFGA 3PP6A 3FA9A 4OMXA 1VYFA 1BAJA 1B56A 2KTDA 4U0FA 1EUOA 3OW2O 1QG5A 3FW4A 4ORYA 3U03A 4QNIA 4QAEA 3FMZA 1ZMBA 1ACDA 4ZH9A 2OFRX 4RUUA 1YJWP 1LKEA 5HWZA 1CJ5A 1D3SA 1E6JP 1IKEA 3ZZVA 4EEJA 3P6CA 1EI5A 4GETA 1KT6A 1UZ2X 3P05A 3STNA 3SAOA 3VG5A 2RCQA 4KCAA 4LZUA 4ZCBA 1JJ2O 2FR2A 1X71A 4PH0A 4D6AA 1UREA 4K19A 4ALBA 4ZGUA 1VQMP 4FGIB 2Q2PA 5HCCC 1ICMA 4IB8A 2QA4P 4AZNA 4QGXA 3CBSA 5F2KA 1KD1Q 2HZQA 5I4TG 4WFVA 1PBOA 3EM0A 4D6BA 5BVQA 2X8FA 3RWXA 1VQPP 4OMWA 5H9KA 3WJEA 5D8JA 1S7DA 3HYBA 4IB6A 4QQ1A 5EZ2A 5LKEA 3CD6P 5BVTA 5FQ6E 3BS2A 1AUMA 1JV4A 1L6MA 4KC8A 4ORXA 1KXOA 5HBSA 3NADA 4YKOA 1QWDA 4L3RA 4FBRA 2R56A 3I55P 4HPCA 4EQAC 3EBKA 2YMSA 4HPAA 4U0BA 3F8AA 4U0EA 5H9NA 2AKQA 3NQ9A 2JU7A 3P6EA 3VU1A 2K23A 2GTLN 4OS0A 1OBPA 3VG7A 1EW3A 1SA8A 3ZUOA 1CRBA 4GKCA 4IABA 2AL0X 3VG2A 1T68X 2RD7C 5H8TA 2Z4HA 2NP1A 3G6EP 3FLLA 3OJYC 5F58A 1YWDA 1PMPA 3HZQA 3CCLP 1TOUA 1QQSA 3FR2A 2QO6A 3P6HA 3FIQA 5H9AA 3BX8A 2LA7A 3CBCA 5IO6A 4O49A 2FLJA 4AZRA 1IW2A 1ZNEA 4YH0A 2MWHA 1DF3A 1M6NA 1TW4A 3G26A 5HGMA 5HA0A 1EALA 3NBXX 1RLBE 3B2HA 2PEKA 3G0VA 1RNIA 1HN2A 1ZNLA 3NX1A 3U9PC 4KIIA 3KFFA 4GU8A 2EG5A 1RO2A 1IFBA 3K3LA 2L68A 3FYFA 3OBLA 3UEUA 4AW8A 1T0VA 1I05A 3STMX 2POAA 1EIAA 1SXWA 1YITP 4M0IA 1O1UA 1BSQA 3G71P 3O22A 4UU3A 3CCEP 1SXXA 1KT4A 2A2GA 4XMFA 2CZTA 1FE3A 2IFBA 4FQBB 3HWDA 4XMDA 1SXYA 5L8IA 1LPJA 4ZGFA 4HFOA 2OTJP 5HGOA 3BSZE 5KICA 5BS1A 1K30A 4YGGA 2RA6A 1ICNA 1OEJA 2GJ5A 1QFVA 2ACPX 3EBWA 4ML7B 4R0BA 2WEXA 1FTPA 1I04A 2AT6X 2OTLP 1AVGI 1YUPA 3WVMA 3CQRA 1LIFA 4PJ2A 3VE2A 2G78A 1VQ8P 3B2IA 1LF7A 1HQPA 3MVFA 3DTQA 4QRLA 1DZMA 2F09A 2P9XA 4AZQA 4XFZA 1DFVA 1LIDA 2Z4IA 4TNNA 1BRQA 2CWOA 1M90Q 1YJNP 5CYBA 4TKHA 4BVMA 1EPBA 4COCA 4TQ2A 1G5WA 1ERBA 1OBUA 5F6BA 5HZ6A 2QMIA 2X8TA 4N7DA 1ADLA 1TXLA 1VQLP 3PH6A 4O3ZA 1HBPA 1TVQA 3B2LA 2Z44A 4RUNA 1DZPA 3I17A 2BUOA 1JZUA 5DCKA 5HZ5A 3CMEP 5EDBA 4MIRA 3FENA 3APWA 3HK1A 3PH5A 1MVGA 1A57A 1DZKA 1XKIA 1BLRA 1EOQA 2KODA 3P6GA 5F2NA 1W2BO 1GT4A 1DC9A 1CBSA 1K8AQ 1VYGA 2WWPA 1EIIA 3MX7A 1VQ9P 4A8ZA 2XT1A 1G74A 2PY1A 3WOVA 4ZR2A 4YKMA 2OVEA 2Q39A 2XKLA 5AQ6A 3F9DA 4O9SA 5LJCA 4ES7A 3M1MA 4GH7A 4QZTA 3S60A 1Q82Q 2FS7A 3VG4A 4AYHA 3NQ3A 4XMEA 1A2DA 5K06A 2FS6A 3DTJA 3DS3A 3C76X 2MO5A 3G1IA 4I3BA 1EPAA 4MVLA 3FR5A 4YBUA 3VE1A 2NNQA 5AJCA 2PENA 4GNWA 2LBVA 5BVSA 2ANSA 2FTBA 5HCDC 3BRNA 3OD9A 1FELA 3STKA 5AEOA 4ZHHA 1QY1A 3TGBA 1VQ7P 4IB7A 3MGEA 2Q9SA 3O19A 1OEEA 1N0SA 4TLJA 4O4UA 1OPAA 4A60A 1YJ9P 3RSWA 4WBKA 3E3CA 2LFOA 3F6ZB 3WBHA 2EU7X 5L8OA 1E06A 1YIVA 4YCEA 3CPWO 5B27A 2L6EA 1X8NA 1ZNGA 1YIJP 3TF6A 4YDBA 2NNEA 4Y0PA 1N8RQ 1I06A 4TKBA 3HTYA 3KFHA 4FBVA 2BS6A 3CCVP 5LJHA 1VQ4P 2GTLM 1YP7A 3ZWEA 5KHPA 3FR4A 3HOEA 5F2OA 3NTEA 4ZHDA 3CR6A 3UEXA 1A3YA 4OS3A 3DS1A 3CMPA 3PQUA 4IAXA 5CE4A 3P24A 3ZW2A 1KOIA 5LJBA 2Z46A 1ZRYA 2EFJA 2X45A 4O4SA 4O4XA 1Q86Q 1M6EX 3G28A 3L4RA 1NP1A 3WJBA 3ZW1B 1KT7A 4ORRA 5D48A 5H9LA 1K73Q 1E02A 2KT4B 1QRJA 4O3WA 3FA6A 3PECA 4A1HA 4NYRA 3CMAP 5BS2A 5JR8A 2E4JA 3B2KA 3PPTA 4DQ4A 3NPOA 3FA7A 4KT5A 4YDAA 1NGLA 2MJIA 3LV4A 2AT5X 2OFMX 2W2FA 4GE1A 4U8UM 4GNYA 2GC9A 1LNMA 2JW1A 4QGWA 1XCAA 3TGAA 2XXMA 4XFXA 2BHVA 1OEKA 3D97A 3H0DA 4U8UN 4INNA 3IFBA 5HTDA 1QY2A 5FFHA 2E1MA 1S2PA 2HMBA 1DV9A 4XMCA 1CBQA 3O2YA 1QFTA 1AB0A 2FT9A 2LB6A 2L5PA 3I0AA 4O4OA 1U0XA 1GT5A 4GRJA 1R0UA 4I3DA 2GTLO 1G85A 4HPDA 4Y0SA 2M4LA 1RO0A 4WHIA 3DS4A 1A18A 1JYDA 1FDQA 4TKJA 3S26A 2AT0X 1SXUA 5F7GA 1VPRA 4DQ3A 3P6DA 4JGLA 1Q7YQ 1VQ6P 2JU8A 4U9CA 1IIUA 2WQAE 2GTFX 3EYCA 2WQ9A 1QVFO 3CCMP 1JJJA 3EMMA 1NJIQ 3CCRP 4NW4A 3UAQA 4ORWA 4COTA 4YGZA 3CCUP 4CK4A 4COPA 3Q20A 5DPQA 4I9SA 5EDCA 4L1NA 4AZMA 1CBRA 3FEKA 1D2UA 1YWCA 4U8UO 3G29A 1QABE 3DS2A 3S5XA 3IA8A 3WXQA 3KFIA 2FR3A 2BT9A 1M1KQ 1E5PA 1X89A 5EPQA 5HA1A 1G7NA 2KD2A 1QVGO 3JSQA 5D45A 1NP4A 1TOWA 5D4AA 3VG3A 1T8VA 1MX8A 4ZHCA 1BSOA 3CCJP 5HGNA 4AZOA 5AJBA 4I3CA 1GM6A 1U17A 1JYJA 1MX7A 2HLVA 3AKMA 1HMTA 3GAQA 2LF4A 1SY2A 4QYNA 2L9CA 3DPHA 2JOZA 3VPJE 4XFYA 2OVDA 2ZAGA 3LHNA 4OS8A 1BEBA 4AZPA 3AKNA 3JS1A 4ZHGA 1LIBA 4TJZA 3E2DA 1KT3A 5HZQA 3ZW0B 4QGVA 1EIOA 2WEWA 2CBSA 3BX7A 3CC2P 1SY3A 1ERXA 4ZFXA 2X8SA 1AQBA 5LJDA 2XV6A 4XROA 1GKAB 1P6PA 1X8UA 4XMHA 3S5VA 5JPAA 5C0NA 4IAWA 3PQSA 2M8NA 2M8LA 1GX9A 2JYGA 4QYPA 5HCEC 3ZW1A 2W2BA 1YWAA 3G4SP 3CC4P 4GK9A 4XMGA 3UEVA 5LJGA 2JMBA 4XRQA 1HMRA 3TGCA 4YBPA 1RBPA 1SMPI 4PH1A 2CM9A 2DM5A 2PEQA 3BU9A 4ALOA 3HWGA 1O1VA 1YHQP 1GX8A 3FELA 1JJXA 2RQ0A 3ELZA 4WYMA 3BLGA 5KIDA 3KQ0A 3TZSA 2O62A 3BDRA 4PSQA 4YFPA 2R74A 2JU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHV A;  3JQO A; 
#chains in the Genus database with same CATH topology
 1Z6M A;  2CZU A;  4JHQ A;  1STP A;  4JO6 A;  4YFQ A;  1MM9 A;  4HWM A;  2QM9 A;  3SZI A;  3CCQ P;  1JMX A;  3I56 P;  5D47 A;  1FEN A;  3NQK A;  1D1D A;  3N91 A;  1SWH A;  2GZF A;  3OE3 A;  4IPY A;  3LRY A;  1LIC A;  1GXA A;  2Q2M A;  3FEP A;  4ON1 A;  1VWG B;  1SWF A;  1RXH A;  3MBT A;  1E00 A;  1K3B A;  4EDE A;  3NY7 B;  4U0A A;  2K62 A;  1VWB B;  3H47 A;  4QZU A;  1SWP A;  1ZND A;  2ERH A;  5HAE A;  4NLI A;  1B8E A;  1KQX A;  3G7X A;  2JU1 A;  4QNB A;  4NLJ A;  2L22 A;  3RDU A;  4MVI A;  4FBO A;  4IMN A;  2MVU A;  3ZI8 A;  1X8P A;  1MEP A;  1SWC A;  3D4R A;  4B55 A;  3WJC A;  4Y0Q A;  1BBP A;  4UU2 A;  4A1Y A;  2LIU A;  1Y9T A;  2AT3 X;  1RXJ A;  1HQB A;  1KLP A;  2WR6 A;  1I4U A;  2C1Q A;  2WSJ A;  4WFU A;  1VQO P;  4NNT A;  5F1E A;  3U43 A;  3C78 X;  4Z6J A;  3FA8 A;  3RG2 A;  3CCS P;  4O3Y A;  3MG5 A;  5HGL A;  1Y9L A;  2YG2 A;  4IBA A;  4BQU A;  1IMP A;  1LIE A;  4KC7 A;  2LBA A;  3VG6 A;  1KT5 A;  2RTE B;  3BU1 A;  4CDD A;  1IUQ A;  4BX7 A;  1YP6 A;  1BAJ A;  1B56 A;  4U0F A;  3RY2 A;  4ORY A;  1IMQ A;  4QAE A;  2OL8 O;  2MVV A;  1E6J P;  5B5G A;  3ZZV A;  4EEJ A;  4BCS A;  1RXK A;  4ZCB A;  5KP7 B;  4PH0 A;  2RTR B;  4QGX A;  4BPF A;  5F2K A;  1ACP A;  1Y55 X;  5I4T G;  4NEO A;  1PBO A;  4WFV A;  3EM0 A;  3RWX A;  5D8J A;  3HYB A;  3WZQ A;  2VLO A;  2HKD A;  1UYO X;  2RTJ A;  4HPA A;  3F8A A;  4U0E A;  4BPG A;  2JU7 A;  3EJB A;  1VYO A;  2K23 A;  2JBG A;  1EW3 A;  1SA8 A;  1CRB A;  2FHN X;  4BX6 B;  2NP1 A;  3G6E P;  3FLL A;  4GGZ A;  3GKL C;  4O49 A;  1DF3 A;  1M6N A;  2AF5 A;  2L4B A;  3VHM A;  2GH7 A;  2PEK A;  1ZNL A;  1SWL A;  4KII A;  1W5R A;  1RO2 A;  2L68 A;  3OBL A;  3UEU A;  1FJ1 E;  1T0V A;  1O1U A;  1SXX A;  2A2G A;  4YGZ A;  5L8I A;  2IFB A;  1LCV A;  1LPJ A;  5BS1 A;  1ICN A;  1OEJ A;  1VWE B;  1QFV A;  4R0B A;  1VWM B;  2ACP X;  1T8K A;  2KG8 A;  4BJ8 A;  1HY2 A;  1LIF A;  2G78 A;  1DZM A;  2FHL A;  1NDJ A;  5B5F A;  2IZI A;  1M90 Q;  1YJN P;  1EPB A;  2K0Y A;  1G5W A;  5F6B A;  4UHP B;  2QMI A;  3EW1 A;  2VLP A;  2X8T A;  1ADL A;  1VWQ B;  2JU2 A;  3AEH A;  3GJN A;  5EDB A;  2MR7 A;  3HK1 A;  4BX5 A;  1BLR A;  2KOD A;  2RTM A;  5F2N A;  2X34 A;  3WOV A;  4OKA A;  2OVE A;  4F37 A;  2XKL A;  4O9S A;  5LJC A;  4BX5 B;  2FS6 A;  3DS3 A;  3C76 X;  1Y52 X;  1HY8 A;  4I3B A;  4YBU A;  5AJC A;  2ANS A;  5AEO A;  4TLJ A;  1VQ7 P;  3MGE A;  1N7Y A;  3O19 A;  4IB7 A;  1SLE B;  1OPA A;  4O4U A;  2GDW A;  2RTG B;  5L8O A;  3CPW O;  4YDB A;  2NNE A;  4GD9 A;  4HKG A;  1I06 A;  3KFH A;  4FBV A;  5KHP A;  3FR4 A;  5F2O A;  3CR6 A;  1AYI A;  4OS3 A;  4IAX A;  3SLT A;  3ZW2 A;  1I78 A;  2KGC A;  1KOI A;  2RTN B;  1Q86 Q;  1M6E X;  3L4R A;  4ORR A;  5D48 A;  2CG5 B;  4DQ4 A;  3NPO A;  1GPJ A;  4YDA A;  1NGL A;  2MJI A;  2N5H A;  2OFM X;  4GE1 A;  2GC9 A;  2KGA A;  4QGW A;  1XCA A;  3D97 A;  2VLQ A;  3H0D A;  4U8U N;  1SRJ A;  1LCW A;  2HMB A;  1VKU A;  1DV9 A;  2QOM A;  3O2Y A;  2RTA A;  2BC3 A;  4O4O A;  4BBO A;  5EJD A;  4GRJ A;  1RO0 A;  1A18 A;  1FDQ A;  4DQ3 A;  1VPR A;  3P6D A;  1Q7Y Q;  3CKF A;  4CPE A;  3EYC A;  1QVF O;  4COT A;  5EDC A;  4AZM A;  3FEK A;  1D2U A;  3GZM A;  3SZH A;  3WXQ A;  5D45 A;  2KG6 A;  3CCJ P;  4IRW A;  2L9C A;  4OS8 A;  3JS1 A;  5IXG A;  5HZQ A;  3ZW0 B;  4QGV A;  2OY7 A;  2CBS A;  2X8S A;  4XRO A;  1GKA B;  1HXZ A;  2M8N A;  2M8L A;  1GX9 A;  4QYP A;  3ZW1 A;  4GK9 A;  2OY1 O;  3PK2 A;  2CM9 A;  1SWG A;  4ALO A;  2K92 A;  1LUQ A;  3FEL A;  1PBY A;  3SLO A;  5KID A;  3BDR A;  4YFP A;  3ZW1 B;  1YI2 P;  4NP1 A;  5LJK A;  5CSE A;  2OZQ A;  2QNW A;  1YWB A;  2OAR A;  2X55 A;  3X00 A;  2NND A;  3HOL A;  1VWI B;  1RSU B;  2BS5 A;  2VFC A;  5DG4 A;  2I5Z O;  1A43 A;  2EHT A;  4LQZ A;  2DGY A;  2N93 A;  1ML7 A;  1VQK P;  1KQW A;  4I9R A;  2FRS A;  1VWP B;  4Z2P A;  2ACO A;  3Q34 A;  3WJF A;  4CPI A;  5LJE A;  4CDF A;  1BRP A;  2MR8 A;  2CBR A;  2RCT A;  2RN4 A;  5FQ7 E;  4EFG A;  4I60 A;  1BJ7 A;  5B29 A;  1ALB A;  2F73 A;  2JYL A;  4BOE A;  4M6S A;  2OVA A;  3RDM A;  1KZW A;  3VRL C;  1PM1 X;  2GZG A;  4ID2 A;  1GGL A;  2A0A A;  4GJS A;  4I95 A;  1KZX A;  5EED A;  2RTO B;  4ARH A;  3ZQ3 A;  1SWU A;  2DJG A;  1ZNK A;  1PEE A;  3PED A;  1DV5 A;  4LKT A;  2W2A A;  5FQ8 E;  1VWD B;  4Y59 A;  4GDZ A;  1L0I A;  1OBQ A;  3DS0 A;  3AUM O;  2ONT A;  2UYW A;  2MM3 A;  3VHI A;  2OVS A;  2JN3 A;  3C77 X;  2A3F X;  3V8U A;  1E0H A;  1SLD B;  2OFB A;  2K5X A;  3CC7 P;  3CQN A;  5HZ9 A;  1BM5 A;  3FW5 A;  2EHS A;  1GX3 A;  2CM4 A;  2ZAI A;  4I6S A;  2ZSC A;  3KFG A;  1VYF A;  1ACD A;  2OFR X;  4RUU A;  1YJW P;  1D3S A;  1VHN A;  4GET A;  4Y5D A;  3P05 A;  1LEL A;  4LZU A;  4GGR A;  2GZE A;  4FGI B;  2Q2P A;  1LDQ A;  5HCC C;  2GDX A;  4AZN A;  2RTI B;  1N43 A;  2HZQ A;  5HV8 A;  4DG9 A;  2X8F A;  1VQP P;  2IZK A;  1S7D A;  5LKE A;  3CD6 P;  2PI3 O;  1AUM A;  1JV4 A;  1L6M A;  4YKO A;  3I55 P;  2VLN A;  2YMS A;  2GZI A;  5H9N A;  5EW5 E;  2GTL N;  4OS0 A;  3VG7 A;  4H2W C;  1HQQ A;  4GKC A;  2AL0 X;  5H8T A;  1PMP A;  4NV7 A;  5IO6 A;  5F2B A;  4AZR A;  4YH0 A;  1VWO B;  5HGM A;  1EAL A;  3RE5 A;  1VWH B;  1GXG A;  3NBX X;  3B2H A;  4C5P A;  1RNI A;  3KFF A;  1I05 A;  3STM X;  1EIA A;  1SXW A;  3RDX A;  4M0I A;  1FE3 A;  2JB0 A;  4FQB B;  3HWD A;  1K30 A;  2GJ5 A;  1LCZ A;  2OYB O;  1AVG I;  3CQR A;  2A5C A;  3RDO A;  4R0M A;  2P9X A;  4AZQ A;  3FDC A;  1LID A;  4BVM A;  3RDS A;  4H2Y C;  1OBU A;  5HZ6 A;  1SRE A;  3B2L A;  2Z44 A;  4DNE A;  5DCK A;  2RTH B;  2AF8 A;  4MIR A;  3FEN A;  2KOS A;  5B10 O;  1VWA B;  4U46 A;  1XKI A;  5KP6 B;  1EOQ A;  3P6G A;  2IZF B;  1VYG A;  1EII A;  2DJF A;  1VQ9 P;  1NQN A;  4A8Z A;  2PY1 A;  4ES7 A;  4AYH A;  3S60 A;  1Q82 Q;  3NQ3 A;  2MO5 A;  4GGT A;  2Y3E A;  3VE1 A;  2PEN A;  2LBV A;  5IRW A;  1I9H A;  3OD9 A;  3STK A;  3TGB A;  2Q9S A;  1OEE A;  5B11 O;  4WBK A;  3E3C A;  2XZ1 C;  3WBH A;  1E06 A;  1YIV A;  1ZNG A;  1YIJ P;  1N8R Q;  4TKB A;  2BS6 A;  1JQP A;  4BX6 A;  1VQ4 P;  2GTL M;  3ZWE A;  3HOE A;  4ZHD A;  3UEX A;  1A3Y A;  3CMP A;  2RTP B;  5CE4 A;  3SZJ A;  4BGF A;  2RTB B;  1KT7 A;  4O3W A;  2FHS C;  3PEC A;  4NYR A;  5BS2 A;  4GUZ A;  3RE6 A;  3B2K A;  4KT5 A;  2RTC B;  1LNM A;  2JW1 A;  3TGA A;  1QY2 A;  5FFH A;  1SWA A;  2FT9 A;  2LB6 A;  1U0X A;  3WYP A;  4WHI A;  3DS4 A;  2VDF A;  1JYD A;  4TKJ A;  4Z27 A;  5F7G A;  4JGL A;  1SWR A;  1IIU A;  2GTF X;  2FAD A;  5K68 A;  3CCM P;  3EMM A;  4NW4 A;  3CCR P;  4ORW A;  3CCU P;  4COP A;  3Q20 A;  4PWV B;  4U8U O;  4EKV A;  3KFI A;  2BT9 A;  1M1K Q;  5EPQ A;  2KD2 A;  1QVG O;  1KFF A;  5D4A A;  1W6F A;  1MX8 A;  4ZHC A;  1BSO A;  5HGN A;  1GM6 A;  1U17 A;  1MX7 A;  3AKM A;  1HMT A;  3GAQ A;  2LF4 A;  4AZP A;  3VPJ E;  2ZAG A;  2OVD A;  1BEB A;  4ZHG A;  3VGW A;  3CC2 P;  1SY3 A;  3EW2 A;  1AQB A;  1P6P A;  2MD9 A;  4MRT C;  5JPA A;  3T6L A;  2JYG A;  1YWA A;  4XMG A;  2JMB A;  4YBP A;  1SMP I;  2PEQ A;  3BU9 A;  3HWG A;  2WPU A;  2R74 A;  2QO4 A;  2QO5 A;  3APV A;  4MVK A;  3G1G A;  5HTE A;  3P6F A;  1LFO A;  5IO7 A;  2L0Q A;  2UZ2 A;  1IFC A;  4YGH A;  3WBG A;  1KGL A;  2AT8 X;  3HWE A;  2ALL X;  3QQ2 A;  5IO5 A;  4ORU A;  1OPB A;  1A8O A;  5FEN A;  1W4T A;  1S44 A;  2X46 A;  1N9Y A;  1RAV A;  2KW1 A;  1ZNV A;  2A13 A;  2FQ1 A;  4O3X B;  3D95 A;  4ZH6 A;  1EQD A;  3T2X A;  3RG6 C;  4YMY A;  1Q81 Q;  2L67 A;  4IMO A;  2QOS C;  1EXS A;  2G7B A;  5B3M O;  3RZY A;  1VWC B;  3WJG A;  1X8Q A;  3KVN A;  1X8O A;  2K2Q A;  2KGD A;  2AFD A;  4YFR A;  1MUP A;  3D96 A;  1GXH A;  3WJD A;  1K9M Q;  4H2X C;  2Z45 A;  1ZNH A;  3RKG A;  1CBI A;  3EC5 A;  1L0H A;  3HWF A;  5FAZ A;  1U18 A;  2FQ0 A;  1Z24 A;  2FWV A;  2Q4N A;  4CPH B;  2PY8 A;  5L8N A;  1H91 A;  2G79 A;  3P02 A;  2HNX A;  2PEO A;  4MVE A;  1K24 A;  3H4E A;  3APU A;  3ZW0 A;  3GE2 A;  2PEJ A;  1AVD A;  1GKA A;  1LDO A;  3NR3 A;  2KTS A;  4CV7 A;  2KGE A;  3B5I A;  5EEE A;  4Z2O A;  4M7M A;  3CE7 A;  2IZB A;  1NQM A;  2HZR A;  4U0C A;  5LKF A;  3WZN A;  1DNY A;  1KC8 Q;  3GZL A;  2OY5 O;  1BSY A;  5F6Z A;  2LKK A;  3B2J A;  1JIW I;  3PP6 A;  3FA9 A;  4OMX A;  1UNK A;  7CEI A;  1AF8 A;  2KTD A;  1EUO A;  3OW2 O;  1QG5 A;  3FW4 A;  3U03 A;  4QNI A;  1ZMB A;  1LKE A;  5IRU A;  3P6C A;  2PNG A;  4CA3 A;  1KT6 A;  3STN A;  3VG5 A;  4KCA A;  2FR2 A;  1X71 A;  1URE A;  2Y3F A;  4ALB A;  4ZGU A;  1VQM P;  3CBS A;  2FGS A;  4D6B A;  4OMW A;  2OL7 A;  4QQ1 A;  5EZ2 A;  5BVT A;  1N4J A;  4KC8 A;  4ORX A;  5HBS A;  2G5L A;  4FBR A;  4EQA C;  3EBK A;  4U0B A;  3NQ9 A;  3VU1 A;  3P6E A;  2LML A;  2IZL B;  2RD7 C;  2QCB A;  2Z4H A;  1NQ4 A;  2WPT A;  3FR2 A;  1QQS A;  2QO6 A;  2OF9 A;  5H9A A;  2X56 A;  2KW2 A;  2LA7 A;  3T6F A;  2IZJ A;  3B4Q A;  2MWH A;  1STR B;  3G0V A;  1HN2 A;  2EG5 A;  3K3L A;  1IFB A;  4AW8 A;  1VWN B;  1YIT P;  4UU3 A;  3G71 P;  4XMF A;  3U0D A;  2CZT A;  4XMD A;  2K0D X;  1SXY A;  2OTJ P;  2BSZ A;  3FID A;  1OR5 A;  1FTP A;  1I04 A;  2OTL P;  2KOP A;  2IZH B;  2JAZ A;  3B2I A;  1HQP A;  4QRL A;  2F09 A;  4XFZ A;  1DFV A;  1CEI A;  4TNN A;  2AVA A;  1MOY A;  2VSQ A;  1ERB A;  1SRG A;  4IZ6 A;  1VQL P;  3PH6 A;  4O3Z A;  1HBP A;  1TVQ A;  3I17 A;  1JZU A;  5HZ5 A;  3CME P;  3PH5 A;  1DZK A;  1GT4 A;  1K8A Q;  4Z28 A;  2WWP A;  1KL4 A;  3MX7 A;  2XT1 A;  4MEE A;  2Q39 A;  5AQ6 A;  3M1M A;  4QZT A;  3PDF A;  4XME A;  2IZC B;  4MVL A;  2NNQ A;  5BVS A;  5HCD C;  2KOO A;  4ZHH A;  2LL8 A;  2JGP A;  5JD2 A;  3WZP A;  2EU7 X;  4YCE A;  1X8N A;  4OEL A;  2LOL A;  4CDE A;  2FAE A;  2N6Z A;  5IRA A;  1BXI A;  4O4S A;  2Z46 A;  1ZRY A;  2EFJ A;  4O4X A;  2MF4 A;  3G28 A;  3WJB A;  1MZ8 A;  5JR8 A;  2E4J A;  3FA7 A;  2AT5 X;  2OL6 O;  2XXM A;  2BHV A;  1OEK A;  4INN A;  3IFB A;  5HTD A;  5HVC A;  4XMC A;  1CBQ A;  1QFT A;  1AB0 A;  1Y53 X;  1EMV A;  4HPD A;  1VWL B;  2AT0 X;  2IZD B;  4U9C A;  2WQA E;  1SWJ A;  4QKO A;  2WQ9 A;  2F01 A;  3UAQ A;  2RTF B;  4JNJ A;  3CKG A;  5DPQ A;  2XZ0 D;  4I9S A;  4L1N A;  1CBR A;  4CDC A;  1KL3 A;  3S5X A;  3IA8 A;  5HA1 A;  1X89 A;  3JSQ A;  4NV8 A;  3RDQ A;  4AZO A;  2A8G A;  2JOZ A;  2JQ4 A;  3LHN A;  3AKN A;  1SWT A;  3EJD A;  1LIB A;  3E2D A;  2WEW A;  3HPE A;  1ERX A;  1AEL A;  3S5V A;  4IAW A;  2FKG A;  2W2B A;  3CC4 P;  2RTK A;  5LJG A;  1HMR A;  5CHK A;  1RBP A;  2GYK A;  1YHQ P;  1JJX A;  2RQ0 A;  3ELZ A;  4WYM A;  3BLG A;  3TZS A;  2O62 A;  5B2A O;  4PSQ A;  1X3O A;  2OY8 A;  3MM0 A;  4OEM A;  1VQ5 P;  1SWO A;  3Q6L A;  2X32 A;  1M74 A;  4YVB A;  2AMM X;  3WZO A;  1VWJ B;  1QY0 A;  4N7C A;  4BX7 B;  4GDA A;  1OSP O;  4MIS A;  4ZHF A;  4Z2V A;  3NP1 A;  2P8G A;  4LZV A;  1JBH A;  4IB9 A;  1FEM A;  2EIA A;  3BY0 A;  4GR2 A;  3CWK A;  1IKJ A;  3QKG A;  4ZJ0 A;  4ORS A;  2QEX P;  4ODD A;  1WUB A;  3VHH A;  2R73 A;  1GT3 A;  4PXH B;  2BLG A;  1KQS O;  4U0D A;  4GR6 A;  4NNS A;  1Y0G A;  1HBQ A;  2N6Y A;  4Y0R A;  1B0O A;  4EXZ A;  4YCH A;  2KWL A;  3ZUI A;  2RTL A;  2LPK A;  2AH7 X;  1MDC A;  5HZ8 A;  1SY1 A;  1BWY A;  1SWQ A;  4LKP A;  2KG9 A;  2C1S A;  2HYS A;  3EJE A;  3KZA A;  1IJ8 A;  3UEW A;  2LIW A;  2MHD A;  2A5B A;  1HXL A;  2AVI A;  3APX A;  3RY1 A;  1O8V A;  3SOT A;  2RTQ B;  1GT1 A;  3RBY A;  2KOQ A;  4U3Q A;  1SWB A;  3G21 A;  2VFB A;  2PEM A;  1F80 D;  2WUT A;  4HPB A;  2GZJ A;  4GZV A;  1B4M A;  1SWD A;  2OFA A;  3H3I A;  1E2T A;  4KH8 A;  3LTW A;  4GJV A;  3ELX A;  3DS5 A;  3JQO A;  1SWK A;  1SY0 A;  2XST A;  3CXC O;  2JO0 A;  1HMS A;  1SWN A;  1SLG B;  4NYQ A;  2M5R A;  2M8P A;  2PEI A;  3LMO A;  4CSB A;  3T1D A;  1S72 P;  1DZJ A;  2Y32 A;  3NX2 A;  2MF6 A;  3DSZ A;  2A2U A;  5BYP A;  2ASN X;  1VQN P;  1VWR B;  2N50 A;  5CZD B;  2K0X A;  3FMZ A;  4ZH9 A;  2KR5 A;  5HWZ A;  1CJ5 A;  2MY5 A;  1IKE A;  1JJU A;  1EI5 A;  1UZ2 X;  3SAO A;  2RCQ A;  1JJ2 O;  2CAM A;  4D6A A;  4K19 A;  1ICM A;  4IB8 A;  2QA4 P;  2DNW A;  1KD1 Q;  1WBI A;  1UYN X;  5BVQ A;  3WJE A;  5H9K A;  4IB6 A;  2X2B A;  2IZG B;  5FQ6 E;  3BS2 A;  1KXO A;  3NAD A;  1QWD A;  4L3R A;  2R56 A;  4HPC A;  2AKQ A;  2LKI A;  1STS B;  2G8C O;  1OBP A;  3ZUO A;  4IAB A;  3VG2 A;  1T68 X;  2JGS A;  2K94 A;  3OJY C;  5F58 A;  1YWD A;  3HZQ A;  3CCL P;  1TOU A;  3P6H A;  3FIQ A;  3BX8 A;  2IZA A;  3T2W A;  1PTS A;  3CBC A;  2FLJ A;  1IW2 A;  1ZNE A;  1TW4 A;  5HA0 A;  3G26 A;  1RLB E;  4CPH A;  1NC9 A;  3NX1 A;  3U9P C;  4GU8 A;  2CQ8 A;  3FYF A;  2POA A;  1BSQ A;  3O22 A;  3CCE P;  1KT4 A;  1AVE A;  4ZGF A;  4HFO A;  5HGO A;  3BSZ E;  5KIC A;  4YGG A;  2RA6 A;  2C4I A;  3EBW A;  1FR2 A;  4ML7 B;  2WEX A;  2AT6 X;  1YUP A;  3WVM A;  4PJ2 A;  3VE2 A;  5KP8 B;  2OF8 A;  1VQ8 P;  3SLJ A;  1SWE A;  1LF7 A;  3MVF A;  2AFE A;  3DTQ A;  2FQ2 A;  1UJZ A;  3D9W A;  2Z4I A;  1JMZ A;  2KOR A;  1SRI A;  1BRQ A;  2CWO A;  5CYB A;  4TKH A;  4COC A;  4TQ2 A;  1SRH A;  4N7D A;  1TXL A;  2NO8 A;  4RUN A;  1DZP A;  2BUO A;  3APW A;  2GDY A;  2K93 A;  1MVG A;  1A57 A;  1MK5 A;  1W2B O;  1DC9 A;  1CBS A;  1G74 A;  4ZR2 A;  4YKM A;  3F9D A;  4GH7 A;  4CPF A;  3VG4 A;  2FS7 A;  1A2D A;  5K06 A;  5K67 A;  3DTJ A;  2ROQ A;  3G1I A;  2N98 A;  1EPA A;  3FR5 A;  4GNW A;  2FAC A;  1DF8 A;  2FTB A;  3BRN A;  1FEL A;  5L3Y A;  1QY1 A;  4CK4 A;  4A60 A;  1N0S A;  1YJ9 P;  3RSW A;  2LFO A;  3F6Z B;  5B27 A;  2L6E A;  4BPH A;  3TF6 A;  1SRF A;  4Y0P A;  3HTY A;  3CCV P;  5LJH A;  1YP7 A;  3NTE A;  3DS1 A;  3PQU A;  3P24 A;  5LJB A;  2X45 A;  4DCB A;  1NP1 A;  5H9L A;  1K73 Q;  1E02 A;  2KT4 B;  1QRJ A;  4A1H A;  3FA6 A;  3CMA P;  3PPT A;  3LV4 A;  2W2F A;  4U8U M;  4GNY A;  2FVA A;  4XFX A;  2N5I A;  2RTD B;  2E1M A;  1S2P A;  2L5P A;  3I0A A;  1VWK B;  1GT5 A;  2CGQ A;  1KL5 A;  1R0U A;  2GTL O;  4I3D A;  1G85 A;  4Y0S A;  2M4L A;  1SWS A;  2X4M A;  3S26 A;  1SXU A;  2IZE B;  2I5V O;  2LTE A;  2JU8 A;  1VQ6 P;  1JJJ A;  1NJI Q;  1SLF B;  1YWC A;  3G29 A;  1QAB E;  3DS2 A;  1VWF B;  2FR3 A;  1E5P A;  1G7N A;  1NP4 A;  1TOW A;  3VG3 A;  1T8V A;  5AJB A;  4I3C A;  1JYJ A;  2HLV A;  1SY2 A;  4QYN A;  2L9F A;  1N9M A;  3DPH A;  4XFY A;  4TJZ A;  2FKJ A;  1KT3 A;  1RST B;  1EIO A;  2FVE A;  3BX7 A;  4ZFX A;  5LJD A;  2XV6 A;  1NBX A;  1X8U A;  5C0N A;  4XMH A;  3PQS A;  2CNR A;  5HCE C;  2FVF A;  3G4S P;  3UEV A;  3TGC A;  4XRQ A;  4PH1 A;  2DM5 A;  1O1V A;  1GX8 A;  3KQ0 A;  3WYQ A;  2JU3 A; 
#chains in the Genus database with same CATH homology
 1YI2 P;  2QO4 A;  4NP1 A;  5LJK A;  2QO5 A;  3APV A;  4MVK A;  1VQ5 P;  2OZQ A;  3Q6L A;  1YWB A;  2OAR A;  1M74 A;  3G1G A;  2CZU A;  5HTE A;  2NND A;  2AMM X;  3P6F A;  4YFQ A;  1QY0 A;  4HWM A;  4N7C A;  3HOL A;  1LFO A;  2QM9 A;  5IO7 A;  3CCQ P;  2BS5 A;  5DG4 A;  3I56 P;  5D47 A;  1A43 A;  1IFC A;  4MIS A;  1FEN A;  3NQK A;  4YGH A;  1D1D A;  3N91 A;  4LQZ A;  4ZHF A;  2DGY A;  3WBG A;  3NP1 A;  2AT8 X;  2P8G A;  4LZV A;  1JBH A;  1KGL A;  3OE3 A;  3HWE A;  4IB9 A;  4IPY A;  1FEM A;  2N93 A;  3LRY A;  1LIC A;  2EIA A;  2ALL X;  1GXA A;  1ML7 A;  4GR2 A;  2Q2M A;  3BY0 A;  1VQK P;  3CWK A;  3FEP A;  1IKJ A;  3QKG A;  4ZJ0 A;  4ORS A;  2QEX P;  5IO5 A;  4ON1 A;  1KQW A;  4ODD A;  1OPB A;  4ORU A;  3MBT A;  1A8O A;  1E00 A;  1GT3 A;  2R73 A;  5FEN A;  4EDE A;  4I9R A;  2BLG A;  4U0A A;  1KQS O;  1S44 A;  2FRS A;  2K62 A;  2X46 A;  3H47 A;  4U0D A;  4GR6 A;  2ACO A;  2KW1 A;  4NNS A;  3WJF A;  1HBQ A;  4Y0R A;  2A13 A;  5LJE A;  4QZU A;  1ZND A;  1B0O A;  1BRP A;  3D95 A;  4O3X B;  4ZH6 A;  1EQD A;  4EXZ A;  2CBR A;  2RCT A;  5HAE A;  3RG6 C;  2RN4 A;  4NLI A;  1B8E A;  4YCH A;  1KQX A;  3ZUI A;  4YMY A;  1AEL A;  5FQ7 E;  1MDC A;  3G7X A;  2AH7 X;  4EFG A;  4QNB A;  1BJ7 A;  1Q81 Q;  1ALB A;  4NLJ A;  2F73 A;  2L67 A;  2JYL A;  4IMO A;  4BOE A;  5B29 A;  2QOS C;  5HZ8 A;  4MVI A;  1SY1 A;  4M6S A;  1EXS A;  2OVA A;  1BWY A;  4LKP A;  2G7B A;  4FBO A;  3RZY A;  4IMN A;  3WJG A;  2HYS A;  1X8Q A;  3KZA A;  3ZI8 A;  1X8P A;  1KZW A;  3VRL C;  1X8O A;  3UEW A;  1PM1 X;  4ID2 A;  2MHD A;  3D4R A;  3WJC A;  1GGL A;  2A0A A;  4I95 A;  4YFR A;  4Y0Q A;  1BBP A;  1MUP A;  3APX A;  4UU2 A;  4A1Y A;  1KZX A;  3D96 A;  1O8V A;  3WJD A;  1K9M Q;  1Y9T A;  3SOT A;  2Z45 A;  2AT3 X;  1ZNH A;  5EED A;  3RKG A;  1CBI A;  1GT1 A;  3U0D A;  3RBY A;  4ARH A;  3ZQ3 A;  3HWF A;  4U3Q A;  5FAZ A;  2WR6 A;  1I4U A;  3G21 A;  2WSJ A;  4WFU A;  2PEM A;  1U18 A;  1ZNK A;  2WUT A;  1Z24 A;  2FWV A;  2Q4N A;  4HPB A;  1PEE A;  3PED A;  1VQO P;  2PY8 A;  4NNT A;  4LKT A;  5L8N A;  2W2A A;  5FQ8 E;  1H91 A;  4GZV A;  1B4M A;  2G79 A;  3P02 A;  5F1E A;  2HNX A;  2PEO A;  4MVE A;  3C78 X;  3H4E A;  3APU A;  4GDZ A;  3H3I A;  1OBQ A;  3DS0 A;  3ZW0 A;  3GE2 A;  3FA8 A;  2PEJ A;  4KH8 A;  1GKA A;  3CCS P;  3NR3 A;  4O3Y A;  2KTS A;  3ELX A;  2ONT A;  3DS5 A;  3JQO A;  2MM3 A;  1SY0 A;  5HGL A;  2XST A;  4CV7 A;  3CXC O;  1Y9L A;  3B5I A;  2OVS A;  2JN3 A;  3C77 X;  5EEE A;  4M7M A;  2A3F X;  2JO0 A;  3V8U A;  1HMS A;  2YG2 A;  4IBA A;  4NYQ A;  4BQU A;  2HZR A;  2M8P A;  1LIE A;  2PEI A;  4U0C A;  3CC7 P;  4KC7 A;  5LKF A;  3CQN A;  1KC8 Q;  2LBA A;  3T1D A;  4CSB A;  5HZ9 A;  1S72 P;  1DZJ A;  1BM5 A;  1BSY A;  3FW5 A;  3NX2 A;  5F6Z A;  3VG6 A;  2LKK A;  2CM4 A;  3B2J A;  1JIW I;  1KT5 A;  3DSZ A;  2ZAI A;  3BU1 A;  2A2U A;  5BYP A;  1IUQ A;  2ASN X;  1VQN P;  4I6S A;  1YP6 A;  3KFG A;  3PP6 A;  3FA9 A;  4OMX A;  1VYF A;  1BAJ A;  1B56 A;  2KTD A;  4U0F A;  1EUO A;  3OW2 O;  1QG5 A;  3FW4 A;  4ORY A;  3U03 A;  4QNI A;  4QAE A;  3FMZ A;  1ZMB A;  1ACD A;  4ZH9 A;  2OFR X;  4RUU A;  1YJW P;  1LKE A;  5HWZ A;  1CJ5 A;  1D3S A;  1E6J P;  1IKE A;  3ZZV A;  4EEJ A;  3P6C A;  1EI5 A;  4GET A;  1KT6 A;  1UZ2 X;  3P05 A;  3STN A;  3SAO A;  3VG5 A;  2RCQ A;  4KCA A;  4LZU A;  4ZCB A;  1JJ2 O;  2FR2 A;  1X71 A;  4PH0 A;  4D6A A;  1URE A;  4K19 A;  4ALB A;  4ZGU A;  1VQM P;  4FGI B;  2Q2P A;  5HCC C;  1ICM A;  4IB8 A;  2QA4 P;  4AZN A;  4QGX A;  3CBS A;  5F2K A;  1KD1 Q;  2HZQ A;  5I4T G;  4WFV A;  1PBO A;  3EM0 A;  4D6B A;  5BVQ A;  2X8F A;  3RWX A;  1VQP P;  4OMW A;  5H9K A;  3WJE A;  5D8J A;  1S7D A;  3HYB A;  4IB6 A;  4QQ1 A;  5EZ2 A;  5LKE A;  3CD6 P;  5BVT A;  5FQ6 E;  3BS2 A;  1AUM A;  1JV4 A;  1L6M A;  4KC8 A;  4ORX A;  1KXO A;  5HBS A;  3NAD A;  4YKO A;  1QWD A;  4L3R A;  4FBR A;  2R56 A;  3I55 P;  4HPC A;  4EQA C;  3EBK A;  2YMS A;  4HPA A;  4U0B A;  3F8A A;  4U0E A;  5H9N A;  2AKQ A;  3NQ9 A;  2JU7 A;  3P6E A;  3VU1 A;  2K23 A;  2GTL N;  4OS0 A;  1OBP A;  3VG7 A;  1EW3 A;  1SA8 A;  3ZUO A;  1CRB A;  4GKC A;  4IAB A;  2AL0 X;  3VG2 A;  1T68 X;  2RD7 C;  5H8T A;  2Z4H A;  2NP1 A;  3G6E P;  3FLL A;  3OJY C;  5F58 A;  1YWD A;  1PMP A;  3HZQ A;  3CCL P;  1TOU A;  1QQS A;  3FR2 A;  2QO6 A;  3P6H A;  3FIQ A;  5H9A A;  3BX8 A;  2LA7 A;  3CBC A;  5IO6 A;  4O49 A;  2FLJ A;  4AZR A;  1IW2 A;  1ZNE A;  4YH0 A;  2MWH A;  1DF3 A;  1M6N A;  1TW4 A;  3G26 A;  5HGM A;  5HA0 A;  1EAL A;  3NBX X;  1RLB E;  3B2H A;  2PEK A;  3G0V A;  1RNI A;  1HN2 A;  1ZNL A;  3NX1 A;  3U9P C;  4KII A;  3KFF A;  4GU8 A;  2EG5 A;  1RO2 A;  1IFB A;  3K3L A;  2L68 A;  3FYF A;  3OBL A;  3UEU A;  4AW8 A;  1T0V A;  1I05 A;  3STM X;  2POA A;  1EIA A;  1SXW A;  1YIT P;  4M0I A;  1O1U A;  1BSQ A;  3G71 P;  3O22 A;  4UU3 A;  3CCE P;  1SXX A;  1KT4 A;  2A2G A;  4XMF A;  2CZT A;  1FE3 A;  2IFB A;  4FQB B;  3HWD A;  4XMD A;  1SXY A;  5L8I A;  1LPJ A;  4ZGF A;  4HFO A;  2OTJ P;  5HGO A;  3BSZ E;  5KIC A;  5BS1 A;  1K30 A;  4YGG A;  2RA6 A;  1ICN A;  1OEJ A;  2GJ5 A;  1QFV A;  2ACP X;  3EBW A;  4ML7 B;  4R0B A;  2WEX A;  1FTP A;  1I04 A;  2AT6 X;  2OTL P;  1AVG I;  1YUP A;  3WVM A;  3CQR A;  1LIF A;  4PJ2 A;  3VE2 A;  2G78 A;  1VQ8 P;  3B2I A;  1LF7 A;  1HQP A;  3MVF A;  3DTQ A;  4QRL A;  1DZM A;  2F09 A;  2P9X A;  4AZQ A;  4XFZ A;  1DFV A;  1LID A;  2Z4I A;  4TNN A;  1BRQ A;  2CWO A;  1M90 Q;  1YJN P;  5CYB A;  4TKH A;  4BVM A;  1EPB A;  4COC A;  4TQ2 A;  1G5W A;  1ERB A;  1OBU A;  5F6B A;  5HZ6 A;  2QMI A;  2X8T A;  4N7D A;  1ADL A;  1TXL A;  1VQL P;  3PH6 A;  4O3Z A;  1HBP A;  1TVQ A;  3B2L A;  2Z44 A;  4RUN A;  1DZP A;  3I17 A;  2BUO A;  1JZU A;  5DCK A;  5HZ5 A;  3CME P;  5EDB A;  4MIR A;  3FEN A;  3APW A;  3HK1 A;  3PH5 A;  1MVG A;  1A57 A;  1DZK A;  1XKI A;  1BLR A;  1EOQ A;  2KOD A;  3P6G A;  5F2N A;  1W2B O;  1GT4 A;  1DC9 A;  1CBS A;  1K8A Q;  1VYG A;  2WWP A;  1EII A;  3MX7 A;  1VQ9 P;  4A8Z A;  2XT1 A;  1G74 A;  2PY1 A;  3WOV A;  4ZR2 A;  4YKM A;  2OVE A;  2Q39 A;  2XKL A;  5AQ6 A;  3F9D A;  4O9S A;  5LJC A;  4ES7 A;  3M1M A;  4GH7 A;  4QZT A;  3S60 A;  1Q82 Q;  2FS7 A;  3VG4 A;  4AYH A;  3NQ3 A;  4XME A;  1A2D A;  5K06 A;  2FS6 A;  3DTJ A;  3DS3 A;  3C76 X;  2MO5 A;  3G1I A;  4I3B A;  1EPA A;  4MVL A;  3FR5 A;  4YBU A;  3VE1 A;  2NNQ A;  5AJC A;  2PEN A;  4GNW A;  2LBV A;  5BVS A;  2ANS A;  2FTB A;  5HCD C;  3BRN A;  3OD9 A;  1FEL A;  3STK A;  5AEO A;  4ZHH A;  1QY1 A;  3TGB A;  1VQ7 P;  4IB7 A;  3MGE A;  2Q9S A;  3O19 A;  1OEE A;  1N0S A;  4TLJ A;  4O4U A;  1OPA A;  4A60 A;  1YJ9 P;  3RSW A;  4WBK A;  3E3C A;  2LFO A;  3F6Z B;  3WBH A;  2EU7 X;  5L8O A;  1E06 A;  1YIV A;  4YCE A;  3CPW O;  5B27 A;  2L6E A;  1X8N A;  1ZNG A;  1YIJ P;  3TF6 A;  4YDB A;  2NNE A;  4Y0P A;  1N8R Q;  1I06 A;  4TKB A;  3HTY A;  3KFH A;  4FBV A;  2BS6 A;  3CCV P;  5LJH A;  1VQ4 P;  2GTL M;  1YP7 A;  3ZWE A;  5KHP A;  3FR4 A;  3HOE A;  5F2O A;  3NTE A;  4ZHD A;  3CR6 A;  3UEX A;  1A3Y A;  4OS3 A;  3DS1 A;  3CMP A;  3PQU A;  4IAX A;  5CE4 A;  3P24 A;  3ZW2 A;  1KOI A;  5LJB A;  2Z46 A;  1ZRY A;  2EFJ A;  2X45 A;  4O4S A;  4O4X A;  1Q86 Q;  1M6E X;  3G28 A;  3L4R A;  1NP1 A;  3WJB A;  3ZW1 B;  1KT7 A;  4ORR A;  5D48 A;  5H9L A;  1K73 Q;  1E02 A;  2KT4 B;  1QRJ A;  4O3W A;  3FA6 A;  3PEC A;  4A1H A;  4NYR A;  3CMA P;  5BS2 A;  5JR8 A;  2E4J A;  3B2K A;  3PPT A;  4DQ4 A;  3NPO A;  3FA7 A;  4KT5 A;  4YDA A;  1NGL A;  2MJI A;  3LV4 A;  2AT5 X;  2OFM X;  2W2F A;  4GE1 A;  4U8U M;  4GNY A;  2GC9 A;  1LNM A;  2JW1 A;  4QGW A;  1XCA A;  3TGA A;  2XXM A;  4XFX A;  2BHV A;  1OEK A;  3D97 A;  3H0D A;  4U8U N;  4INN A;  3IFB A;  5HTD A;  1QY2 A;  5FFH A;  2E1M A;  1S2P A;  2HMB A;  1DV9 A;  4XMC A;  1CBQ A;  3O2Y A;  1QFT A;  1AB0 A;  2FT9 A;  2LB6 A;  2L5P A;  3I0A A;  4O4O A;  1U0X A;  1GT5 A;  4GRJ A;  1R0U A;  4I3D A;  2GTL O;  1G85 A;  4HPD A;  4Y0S A;  2M4L A;  1RO0 A;  4WHI A;  3DS4 A;  1A18 A;  1JYD A;  1FDQ A;  4TKJ A;  3S26 A;  2AT0 X;  1SXU A;  5F7G A;  1VPR A;  4DQ3 A;  3P6D A;  4JGL A;  1Q7Y Q;  1VQ6 P;  2JU8 A;  4U9C A;  1IIU A;  2WQA E;  2GTF X;  3EYC A;  2WQ9 A;  1QVF O;  3CCM P;  1JJJ A;  3EMM A;  1NJI Q;  3CCR P;  4NW4 A;  3UAQ A;  4ORW A;  4COT A;  4YGZ A;  3CCU P;  4CK4 A;  4COP A;  3Q20 A;  5DPQ A;  4I9S A;  5EDC A;  4L1N A;  4AZM A;  1CBR A;  3FEK A;  1D2U A;  1YWC A;  4U8U O;  3G29 A;  1QAB E;  3DS2 A;  3S5X A;  3IA8 A;  3WXQ A;  3KFI A;  2FR3 A;  2BT9 A;  1M1K Q;  1E5P A;  1X89 A;  5EPQ A;  5HA1 A;  1G7N A;  2KD2 A;  1QVG O;  3JSQ A;  5D45 A;  1NP4 A;  1TOW A;  5D4A A;  3VG3 A;  1T8V A;  1MX8 A;  4ZHC A;  1BSO A;  3CCJ P;  5HGN A;  4AZO A;  5AJB A;  4I3C A;  1GM6 A;  1U17 A;  1JYJ A;  1MX7 A;  2HLV A;  3AKM A;  1HMT A;  3GAQ A;  2LF4 A;  1SY2 A;  4QYN A;  2L9C A;  3DPH A;  2JOZ A;  3VPJ E;  4XFY A;  2OVD A;  2ZAG A;  3LHN A;  4OS8 A;  1BEB A;  4AZP A;  3AKN A;  3JS1 A;  4ZHG A;  1LIB A;  4TJZ A;  3E2D A;  1KT3 A;  5HZQ A;  3ZW0 B;  4QGV A;  1EIO A;  2WEW A;  2CBS A;  3BX7 A;  3CC2 P;  1SY3 A;  1ERX A;  4ZFX A;  2X8S A;  1AQB A;  5LJD A;  2XV6 A;  4XRO A;  1GKA B;  1P6P A;  1X8U A;  4XMH A;  3S5V A;  5JPA A;  5C0N A;  4IAW A;  3PQS A;  2M8N A;  2M8L A;  1GX9 A;  2JYG A;  4QYP A;  5HCE C;  3ZW1 A;  2W2B A;  1YWA A;  3G4S P;  3CC4 P;  4GK9 A;  4XMG A;  3UEV A;  5LJG A;  2JMB A;  4XRQ A;  1HMR A;  3TGC A;  4YBP A;  1RBP A;  1SMP I;  4PH1 A;  2CM9 A;  2DM5 A;  2PEQ A;  3BU9 A;  4ALO A;  3HWG A;  1O1V A;  1YHQ P;  1GX8 A;  3FEL A;  1JJX A;  2RQ0 A;  3ELZ A;  4WYM A;  3BLG A;  5KID A;  3KQ0 A;  3TZS A;  2O62 A;  3BDR A;  4PSQ A;  4YFP A;  2R74 A;  2JU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...