2BHVA

Structure of comb10 of the com type iv secretion system of helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
191
Chain Sequence
NKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPRENEVIAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Two Core Subunits of the Bacterial Type Iv Secretion System, Virb8 from Brucella Suis and Comb10 from Helicobacter Pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Bacterial protein
molecule keywords COMB10
total genus 39
structure length 191
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03743 TrbI Bacterial conjugation TrbI-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.160 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2bhvA02
2.40.128.260 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bhvA01
2BHVA 3JQOA
chains in the Genus database with same CATH superfamily
2L0QA 1K73Q 3NADA 2G78A 1KZWA 3SAOA 1HQBA 5DCKA 3EYCA 3O2YA 2LKIA 2OFAA 2K0XA 5IO5A 3UAQA 2JBGA 1Y0GA 5HWZA 1K24A 2FTBA 1E06A 1HXLA 1NJIQ 2FR2A 4UU3A 5K06A 1GXAA 2KT4B 2POAA 2AH7X 1ERBA 3LV4A 4MVEA 5IO6A 3RDOA 4I3BA 1NP4A 3VGWA 1H91A 1SRJA 4IMNA 3FLLA 4O9SA 3DS3A 4ZR2A 3TGAA 2AT5X 1N43A 1JMXA 5CYBA 4OELA 2G5LA 1SWQA 4IB9A 5B11O 2PY8A 1BXIA 1KT3A 3VG3A 2JOZA 2VLNA 3F8AA 1SXYA 3EJDA 3MG5A 3S5XA 2AKQA 1BAJA 1E6JP 3WZPA 1UYOX 3CQNA 2DNWA 4COCA 4YH0A 5HGMA 1VWPB 1VWOB 1SY0A 2MF6A 4DQ3A 1DZPA 3HWDA 1Z6MA 2ZSCA 5F2OA 1YWAA 2VDFA 5HGOA 1N9MA 2IZIA 4QGVA 1SLFB 3FA9A 1IKEA 1MOYA 2XXMA 2MF4A 1E00A 2W2FA 1KT7A 2X46A 5EJDA 2QA4P 3HTYA 3G1GA 1Q86Q 3DPHA 4QGWA 4YKMA 1HXZA 2ROQA 3WOVA 2IZJA 4OS0A 4Y0SA 3VRLC 4O4UA 4U0BA 1ZNDA 4IMOA 5D48A 3B5IA 4FQBB 3H3IA 2FVAA 2CBSA 3BU1A 1SWBA 2AVAA 4U0AA 1X8PA 3VG2A 1CRBA 2OY7A 3RY2A 2K0YA 2RTGB 4OEMA 2RTCB 3FR2A 3CE7A 4YFQA 4ML7B 2NNDA 5IRAA 2MR7A 3RDMA 2VSQA 5HCDC 1RSUB 4OMWA 1DV9A 1JYDA 1VWIB 4CDCA 2HZRA 1VQ8P 5B5GA 5F2NA 5H9AA 1FDQA 4IABA 1JJXA 5JD2A 1LDQA 1NQMA 4LZVA 2QM9A 1VWMB 3SZIA 1HMRA 1ICMA 4M7MA 2N50A 2E4JA 2RTFB 2RTRB 2OF8A 3PH6A 1X8OA 2JN3A 4A1HA 4CPHB 1SWCA 1DF3A 4NW4A 2LF4A 5F1EA 1Y9LA 2KGCA 3HOEA 5FAZA 4BOEA 2LIUA 3G21A 2RA6A 2DJGA 5HBSA 2UYWA 1IFCA 4AZMA 1KC8Q 2ZAIA 2FVEA 3L4RA 3FMZA 4YDBA 1GX8A 2KOQA 5HCEC 1DC9A 4YGGA 3NQ3A 1VWLB 2WR6A 3CKFA 4R0BA 1VWBB 3P6CA 2OZQA 2LMLA 1MX8A 1KT6A 1TXLA 1CBIA 3UEXA 3P02A 3T2XA 3DS0A 1GX3A 3CMPA 3RBYA 2OY1O 1UYNX 2WQ9A 1SY2A 4BX5B 4Y0QA 4YCHA 4QZTA 3RDXA 3HYBA 4JHQA 5LJHA 4GH7A 3WYPA 5IO7A 3LMOA 1LIEA 3EJEA 3GZLA 2IFBA 2MWHA 4LQZA 2EIAA 3G26A 1M6EX 3LRYA 4GGRA 4WHIA 3G4SP 2JW1A 3ZW1A 4O3ZA 2KGEA 2JU7A 1X8UA 2PENA 4NEOA 1MZ8A 1KQXA 1JJ2O 1CBRA 2WSJA 4YGZA 2VFCA 3BSZE 3EBWA 1ICNA 4DQ4A 2HKDA 4NV8A 4QKOA 3G1IA 1SXUA 1MEPA 1A57A 1YWBA 2OTLP 4QZUA 1G7NA 2XZ1C 5F58A 5B5FA 2W2BA 3STNA 3FDCA 1VWGB 5BVTA 3KFHA 4ORYA 4O4OA 1PM1X 3CCVP 4O3XB 1OEJA 4XROA 4IB8A 2I5ZO 1YJ9P 4WFUA 4TNNA 2RQ0A 4ZHDA 1KL5A 3SZJA 4ALOA 2BUOA 4YKOA 2XT1A 5KHPA 4GNYA 1B4MA 1VYOA 2L68A 1FELA 2QO4A 1X89A 4BX6A 3NX2A 3ZWEA 5EDCA 2NNEA 1KFFA 4CPFA 2HYSA 3RWXA 1LICA 2CBRA 4YGHA 2PEMA 3BS2A 2JB0A 4O4SA 1SWLA 2GDWA 3APWA 1KT5A 1D2UA 4GRJA 5F6ZA 1RNIA 2G7BA 3WZQA 3H4EA 2RTAA 1FEMA 2NO8A 5F6BA 1BSQA 2BC3A 4CA3A 2LKKA 2QO5A 2ACPX 3T6LA 2NNQA 3GJNA 2X32A 2JO0A 4O3WA 5H8TA 1EI5A 1ZNVA 4Y0RA 2P9XA 2ANSA 1U18A 2WWPA 4C5PA 1RXHA 2RTBB 2Z45A 2RTEB 1AQBA 2KODA 1TOUA 1RO0A 1PBOA 2FT9A 1O1VA 3ZW0B 2C1SA 5FENA 2GZGA 2FHNX 2CNRA 1VWJB 1Y52X 2MR8A 2K0DX 1AF8A 2PEJA 3DS5A 3U43A 1LF7A 2A5CA 4EKVA 3KFIA 2KR5A 2GZEA 1B56A 1OR5A 1SWDA 3EC5A 1JYJA 1SXXA 1PTSA 2N6ZA 2LL8A 1VWDB 4EFGA 1N8RQ 1VWFB 2FQ1A 3ZW0A 4HKGA 2BS6A 4COPA 4Z2PA 3B2JA 1Y55X 2RTHB 2M8PA 3CC2P 5HA1A 5HZ9A 3SZHA 3FA6A 4GD9A 2Q9SA 4PH0A 3MGEA 3E2DA 2G8CO 1LCVA 3P05A 1I4UA 1ZNKA 1A8OA 1JQPA 1IUQA 3CMEP 3PDFA 4KCAA 3CCJP 2L9CA 3PQSA 1RSTB 3NBXX 4D6BA 4F37A 1LPJA 1N0SA 2KG9A 2GZIA 1MX7A 1EXSA 1ZNHA 1FENA 5EPQA 1ZNEA 3V8UA 3BX8A 2QOSC 4U0CA 1EALA 3CCQP 1UZ2X 1GKAA 1HY8A 2YMSA 2JGPA 1TOWA 2OVEA 4ODDA 1I9HA 4GNWA 1SWEA 2FKGA 2OFBA 1GXGA 4KC7A 3TGCA 3JS1A 1SWAA 3TZSA 2K5XA 2BSZA 3BRNA 3O22A 4ZHFA 5LJKA 2FQ0A 1U0XA 2LB6A 1S2PA 1VQ6P 1ERXA 1IIUA 1HBPA 1HN2A 1SWGA 3RE6A 1JBHA 2EU7X 1NGLA 2RTMA 2OYBO 2AT6X 2LBVA 5B2AO 1VYFA 2L4BA 2RTIB 1QABE 1PBYA 2PY1A 1BRPA 5IRUA 1T0VA 1ZMBA 1ACPA 3P6DA 4CK4A 3CWKA 1E0HA 1VHNA 3FW5A 3EJBA 2M8LA 3MX7A 4TLJA 4NLJA 4IPYA 3Q34A 4XMGA 1NBXA 4TJZA 2OF9A 2QMIA 1KQWA 4JGLA 3I55P 3SLJA 1L0IA 5H9LA 4XFXA 1SWNA 3FA7A 2WUTA 5F2KA 3B2KA 3AEHA 2EG5A 3FIDA 2L6EA 4YFPA 2AVIA 3CC4P 4KC8A 1IMPA 4JO6A 3NY7B 1YP6A 2L67A 3WZNA 1VPRA 3RY1A 1MM9A 2GZFA 1B0OA 2WPUA 2AT3X 2C4IA 3KFGA 5DPQA 2KOPA 1D1DA 2IZEB 2AT8X 1FR2A 1N9YA 1DZMA 2QCBA 3UEWA 1Y53X 1SWFA 4XFYA 1UNKA 1L6MA 4ZGUA 1Q82Q 1M90Q 1AYIA 1KGLA 2FAEA 3PQUA 5HGLA 4N7CA 4BVMA 3GKLC 3S60A 5CZDB 1LIDA 2X34A 5IRWA 1G85A 2NP1A 4ORSA 3PP6A 4TQ2A 1KT4A 2PNGA 2Y3FA 2EHSA 2UZ2A 4MISA 2A5BA 1MVGA 1QVGO 3BLGA 2VLQA 2ASNX 4DG9A 2KWLA 5EDBA 2JQ4A 2L5PA 4I3DA 2A8GA 2FR3A 3D9WA 4BQUA 3P24A 1DFVA 5C0NA 4U9CA 2N6YA 2CWOA 3EMMA 2OFMX 1W4TA 1U17A 5EW5E 2MY5A 1E2TA 4HPAA 3UEUA 2GYKA 2RN4A 5I4TG 4H2WC 5JR8A 2RTPB 3AUMO 5CHKA 2E1MA 4QGXA 2X8TA 2EFJA 4ORUA 3S5VA 4MVKA 4NP1A 2WQAE 2K92A 2Y32A 2X8SA 3CBSA 4YFRA 1EIAA 4O49A 4AZRA 3N91A 4M6SA 2X55A 3RDSA 4I95A 4ZGFA 1RAVA 3P6GA 3NR3A 5LJBA 1DV5A 1NDJA 3HK1A 1SWJA 2HLVA 1CBQA 2CGQA 5B10O 2AFEA 1UREA 3OBLA 2GTLO 4ON1A 4BCSA 1QFVA 5KICA 2ERHA 4U8UO 3CCLP 5HVCA 5LKFA 2OY8A 1X8QA 3CR6A 5D47A 4ZJ0A 1VQOP 3DS4A 4YBPA 4U0DA 3RKGA 5AQ6A 1BSOA 5K67A 3BY0A 2W2AA 4KT5A 2R73A 3H47A 2C1QA 1AELA 2M5RA 1JMZA 2IZAA 3FEPA 1E02A 2IZCB 2JYLA 2WEWA 2GTLM 4HPDA 4L3RA 4Z27A 4ARHA 2HZQA 1OBPA 3BU9A 4CDDA 2X4MA 2OARA 2IZHB 3EM0A 4IB7A 3AKNA 4QRLA 2R56A 1KZXA 1W6FA 3LTWA 4N7DA 3CBCA 2VLPA 5HA0A 2QOMA 2N98A 2CZUA 2JYGA 4GU8A 3NX1A 1SXWA 3EW1A 4BPGA 1IFBA 3I0AA 2KOSA 1I04A 2RTJA 1B8EA 5BVSA 4UHPB 1ZRYA 1MK5A 3ZQ3A 2AMMX 4FBVA 1TVQA 1QWDA 2KG8A 2GTFX 1GT3A 1BRQA 2QEXP 4GR2A 2JU3A 4I6SA 4I9RA 2RTLA 5KP6B 1BSYA 5FQ6E 1AVDA 1YWCA 2KW1A 1YJWP 2IZBA 1KQSO 1Q7YQ 1SMPI 4DCBA 2QNWA 3VG6A 5L8IA 3VHMA 4COTA 3NQKA 3T6FA 3DTQA 4WYMA 1ZNLA 4QYPA 1QRJA 1QQSA 1HQQA 2F09A 4ZH6A 1IW2A 3MVFA 1G5WA 4EEJA 2JU2A 5DG4A 3FR5A 4PSQA 4GZVA 3IFBA 1JZUA 4BX6B 2LTEA 4LKTA 1PEEA 2OL8O 1SWTA 2F73A 2RTDB 4Z2OA 1SWPA 1GT4A 3OD9A 4GDZA 1HBQA 1GPJA 1GT5A 1LCWA 2KORA 1IMQA 4CDEA 3OW2O 3F6ZB 3X00A 4U0EA 1Y9TA 2FS7A 3S26A 2FLJA 3VG5A 2LIWA 3ZUOA 2M8NA 5EZ2A 1FTPA 5B3MO 2VLOA 1VWRB 1I05A 4MVIA 3WJEA 3PEDA 1EW3A 2CAMA 4UU2A 4HWMA 1GGLA 4QYNA 2N5HA 4ZCBA 2RCTA 4AW8A 3D96A 1GKAB 4H2YC 4ZHGA 1LKEA 1AB0A 1S44A 1ACDA 2FKJA 1VQPP 1SLDB 2N93A 2Q2PA 4IZ6A 1VQ4P 2XV6A 4B55A 2ALLX 1RO2A 2PEKA 3VHIA 4OS8A 3VPJE 5L3YA 3WYQA 3IA8A 4MRTC 2DJFA 4BX7B 1EPAA 2AF8A 5HZQA 3KZAA 5HTEA 3G0VA 1R0UA 4WBKA 5IXGA 4INNA 4YVBA 4AZOA 2EHTA 4DNEA 4BJ8A 1VQ5P 2MVVA 2R74A 1SREA 3U03A 1SRHA 3ELZA 4FBOA 1JIWI 4HPBA 1VQMP 3NPOA 1STPA 1JV4A 2AFDA 3VE2A 5JPAA 1DZJA 1VYGA 1K8AQ 3G7XA 4ID2A 3FIQA 4HFOA 4R0MA 3FYFA 4I3CA 2VFBA 3DS1A 1BWYA 1IJ8A 1T68X 4LZUA 2RD7C 1DNYA 3STKA 3EBKA 2DM5A 1TW4A 2RTKA 1SLGB 2Z4IA 4GETA 2JU8A 2M4LA 4XMEA 4FGIB 3FEKA 3CXCO 4Z2VA 2KTSA 5B29A 4XMHA 1K3BA 1IKJA 4GK9A 3WBGA 2RTQB 1GX9A 5CSEA 5AJBA 1CJ5A 3UEVA 4AZPA 3APUA 5HTDA 3WBHA 3U0DA 4L1NA 2MM3A 1DZKA 3HWGA 1XKIA 4Z28A 1YIVA 3T1DA 4IAWA 4IBAA 3SLTA 2XZ0D 3CQRA 3CCRP 1VWHB 3ZW2A 3Q20A 4ZFXA 5BYPA 1HQPA 4A1YA 5HV8A 5FQ8E 2IZLB 2Z46A 2OL7A 2RCQA 5L8NA 1ZNGA 3GZMA 5FFHA 3KQ0A 2A2UA 3MBTA 1AVGI 1CEIA 3WJDA 1BLRA 3B2LA 4QAEA 3WJFA 2BS5A 2JGSA 2BHVA 3E3CA 2KW2A 1M74A 3ZI8A 4ZH9A 2JAZA 1S72P 2A0AA 1YJNP 4NV7A 5D4AA 4AYHA 1SY1A 2PEQA 1SWOA 4LKPA 1ADLA 1SRFA 2FVFA 1LIBA 5LJGA 4ALBA 4HPCA 3CC7P 4OS3A 1SWSA 2LFOA 3CCUP 1YIJP 2JMBA 1QY0A 3ELXA 1NC9A 5HGNA 4U8UM 4YBUA 2I5VO 4EDEA 4XMDA 3CD6P 3VU1A 2YG2A 3EW2A 2OFRX 3G29A 5HZ6A 2IZGB 1KL4A 4CPHA 3C76X 1LIFA 3GAQA 3D4RA 1UJZA 2FS6A 1SWKA 5K68A 1GXHA 4XRQA 1JJJA 3FA8A 1G74A 3RE5A 1SWRA 2PI3O 3KFFA 1X71A 2AF5A 1W5RA 2JU1A 5D45A 1I06A 1LNMA 1X3OA 1FJ1E 3OJYC 1SY3A 2X56A 1VWKB 1NQNA 1NP1A 3B4QA 2CQ8A 4U0FA 2WPTA 1XCAA 1YITP 3LHNA 4IRWA 5CE4A 3B2HA 4RUUA 2KOOA 4XMFA 2WEXA 1LFOA 2F01A 5H9NA 3VG4A 1QG5A 1SRIA 3WJCA 4O4XA 3NP1A 3M1MA 1D3SA 5HCCC 1WUBA 1VWAB 4XMCA 1OEEA 2KG6A 3BDRA 3SLOA 1OPBA 3ZZVA 1SLEB 3RG6C 1YHQP 4JNJA 2XKLA 3P6FA 3JQOA 2A3FX 3RG2A 4IAXA 1P6PA 3O19A 3JSQA 4KH8A 4EQAC 3RSWA 2FQ2A 1KLPA 4NYRA 1Q81Q 2X8FA 3F9DA 5BVQA 1QY2A 2P8GA 3C78X 5L8OA 2A13A 2MO5A 3RZYA 1I78A 3PPTA 3PK2A 1EQDA 3C77X 2Z4HA 4ZHHA 1RXJA 5EEDA 1AUMA 1QY1A 5H9KA 2GJ5A 3FW4A 4U3QA 4ZHCA 2OL6O 1L0HA 1SWUA 4QQ1A 2FHLA 4ORWA 3Q6LA 2Z44A 2K93A 4A8ZA 1BM5A 1YP7A 2PEIA 4Y59A 1O1UA 2AL0X 3HWFA 4ES7A 3KVNA 3U9PC 4H2XC 2O62A 3CCEP 4U8UN 2X2BA 1EMVA 3I17A 1M6NA 1JJUA 3AKMA 2KTDA 4NLIA 1T8VA 4CPEA 4QNBA 4BPFA 1SRGA 2X45A 3CMAP 4ORRA 1LCZA 1RXKA 5FQ7E 2K62A 4PXHB 5KP8B 4GE1A 1KXOA 4PJ2A 1VKUA 1VQLP 2K94A 1NQ4A 1WBIA 4Y5DA 3TF6A 1HMSA 2LA7A 3D95A 1EOQA 1EIIA 4CDFA 1KL3A 2GC9A 1LELA 4YMYA 1S7DA 1CBSA 2FADA 3DS2A 2CM9A 3WZOA 5LKEA 4I9SA 2CG5B 3FR4A 4GJVA 1EUOA 4NNSA 5EEEA 1BEBA 2FRSA 1VQ7P 2IZKA 5AJCA 4BGFA 4D6AA 2OY5O 2OVDA 2MJIA 1EIOA 4O3YA 2MHDA 4CPIA 3WXQA 4NNTA 1ML7A 1N7YA 3HWEA 4PWVB 2K2QA 2GH7A 5B27A 1VWQB 3TGBA 4GGZA 2QO6A 4MIRA 5BS1A 2IZFB 5HAEA 3FELA 5KIDA 3QKGA 2ONTA 2CM4A 4TKJA 4FBRA 3I56P 4GDAA 1YI2P 1F80D 3HPEA 1FE3A 1BJ7A 1N4JA 1VWNB 4OMXA 2GZJA 3K3LA 3WJGA 2DGYA 2FHSC 2XSTA 4YDAA 2Q4NA 1HMTA 3STMX 1QFTA 4EXZA 2OVAA 3VE1A 4TKBA 4XFZA 4QNIA 2ZAGA 2GTLN 4GKCA 4AZNA 5LJDA 2CZTA 3VG7A 4PH1A 4I60A 1VQKP 3NTEA 4CSBA 1OBUA 2KGDA 3D97A 1OPAA 5BS2A 1T8KA 5AEOA 1QVFO 2MD9A 2ACOA 4RUNA 3NQ9A 1W2BO 4KIIA 1OEKA 2Q2MA 3WJBA 2MVUA 1X8NA 5D8JA 2BT9A 1RLBE 1K30A 1A2DA 1BBPA 3B2IA 1LUQA 5HZ5A 3PECA 1ALBA 4BPHA 2FWVA 4IB6A 1YWDA 1SA8A 5F2BA 4BBOA 1KOIA 1YUPA 5LJCA 4GR6A 2LBAA 3G28A 2GDXA 3RDQA 1MDCA 2OTJP 2OVSA 2G79A 1GT1A 1STSB 4WFVA 3H0DA 3GE2A 2N5IA 2FGSA 3HZQA 3G6EP 1RBPA 5LJEA 4BX5A 3APXA 2GDYA 5F7GA 3ZUIA 1VWEB 5KP7B 4Y0PA 1SWHA 7CEIA 3SOTA 2KD2A 4U46A 2RTNB 1KD1Q 4ORXA 3QQ2A 1GM6A 1K9MQ 1Z24A 1A3YA 3G71P 3MM0A 2A2GA 3CPWO 3APVA 2PEOA 4NYQA 4M0IA 2LPKA 1MUPA 1AVEA 1DF8A 1OSPO 1PMPA 2L9FA 4YCEA 2IZDB 3CCMP 1EPBA 1E5PA 2HNXA 5HZ8A 3DTJA 3P6EA 1STRB 2L22A 1VWCB 1A18A 4K19A 1HY2A 4Z6JA 3BX7A 3VHHA 3P6HA 3FENA 1LDOA 4GJSA 2BLGA 3CCSP 4A60A 4MEEA 3HOLA 4TKHA 2LOLA 4GGTA 2RTOB 4AZQA 3RDUA 2HMBA 3ZW1B 2Q39A 3DSZA 4OKAA 1VQ9P 2Y3EA 4CV7A 3T2WA 3OE3A 2K23A 2KGAA 1OBQA 4GUZA 3CKGA 1VQNP 1O8VA 4MVLA 4BX7A 3WVMA 1M1KQ 3PH5A 2AT0X 1A43A 2FACA
chains in the Genus database with same CATH topology
1NP1A 4U8UO 3CCLP 2JO0A 4O3WA 4U0FA 1K73Q 1EI5A 5H8TA 5LKFA 3NADA 4Y0RA 2G78A 1XCAA 1YITP 3LHNA 1KZWA 3SAOA 1X8QA 5CE4A 2P9XA 3CR6A 5D47A 4ZJ0A 1VQOP 5DCKA 3EYCA 3DS4A 3O2YA 4YBPA 2ANSA 3B2HA 4U0DA 4RUUA 4XMFA 3RKGA 5IO5A 1U18A 2WEXA 1LFOA 2WWPA 3UAQA 5H9NA 3VG4A 1QG5A 5AQ6A 1BSOA 2Z45A 1AQBA 3WJCA 2KODA 1TOUA 1RO0A 3BY0A 5HWZA 4O4XA 1PBOA 2FT9A 3M1MA 3NP1A 1O1VA 1D3SA 3ZW0B 5HCCC 5FENA 2FTBA 1E06A 2W2AA 4KT5A 2R73A 3H47A 1NJIQ 1AELA 2FR2A 4XMCA 4UU3A 5K06A 1OEEA 1GXAA 2KT4B 3BDRA 3FEPA 1E02A 1OPBA 3ZZVA 2POAA 2AH7X 1ERBA 3LV4A 4MVEA 5IO6A 2JYLA 3RG6C 2WEWA 1YHQP 2GTLM 4I3BA 2XKLA 3P6FA 1NP4A 2A3FX 3JQOA 4HPDA 4L3RA 2PEJA 4ARHA 2HZQA 4IAXA 1OBPA 3BU9A 1H91A 4IMNA 3FLLA 4O9SA 3DS3A 2OARA 4ZR2A 3TGAA 3EM0A 3DS5A 1P6PA 2AT5X 3O19A 3JSQA 1LF7A 4KH8A 4IB7A 5CYBA 3AKNA 4QRLA 2R56A 4EQAC 3RSWA 1KZXA 4IB9A 2PY8A 3KFIA 4N7DA 3CBCA 1B56A 4NYRA 1Q81Q 1JYJA 1SXXA 2X8FA 3F9DA 5HA0A 5BVQA 1KT3A 1QY2A 2P8GA 2CZUA 3C78X 4EFGA 2A13A 3VG3A 5L8OA 1N8RQ 2JOZA 2MO5A 3F8AA 3RZYA 2JYGA 1SXYA 3PPTA 4GU8A 3NX1A 1SXWA 3S5XA 2AKQA 3ZW0A 1EQDA 3C77X 1BAJA 1IFBA 1E6JP 2Z4HA 4ZHHA 3CQNA 3I0AA 2BS6A 5EEDA 4COPA 3B2JA 1I04A 1AUMA 1QY1A 5H9KA 2M8PA 3CC2P 2GJ5A 5HA1A 5HZ9A 1B8EA 3FA6A 3FW4A 4COCA 5BVSA 4U3QA 4ZHCA 2Q9SA 4YH0A 5HGMA 4QQ1A 4PH0A 1ZRYA 3ZQ3A 3MGEA 3E2DA 2AMMX 1SY0A 1TVQA 1QWDA 4FBVA 4ORWA 2GTFX 1GT3A 3P05A 3Q6LA 1BRQA 2Z44A 1DZPA 4DQ3A 3HWDA 1I4UA 5F2OA 2QEXP 4GR2A 1YWAA 2JU3A 5HGOA 1ZNKA 4I6SA 4I9RA 4A8ZA 4QGVA 1A8OA 1BM5A 3FA9A 1IKEA 1IUQA 3CMEP 4KCAA 1YP7A 3CCJP 2PEIA 2XXMA 1BSYA 1O1UA 2L9CA 3PQSA 5FQ6E 1E00A 2AL0X 3HWFA 1YWCA 2W2FA 1KT7A 2X46A 4ES7A 2QA4P 3U9PC 2KW1A 2O62A 3CCEP 3HTYA 3NBXX 1YJWP 4U8UN 4D6BA 3I17A 3G1GA 1KQSO 1M6NA 1Q7YQ 1Q86Q 1LPJA 3AKMA 3DPHA 1N0SA 1SMPI 2KTDA 4NLIA 4QGWA 4YKMA 1MX7A 1EXSA 1T8VA 1ZNHA 3WOVA 1FENA 4QNBA 3VG6A 5EPQA 4OS0A 1ZNEA 5L8IA 4COTA 3NQKA 2X45A 3CMAP 3VRLC 4ORRA 4O4UA 4Y0SA 3V8UA 4U0BA 1ZNDA 3DTQA 4WYMA 4IMOA 1ZNLA 4QYPA 5D48A 5FQ7E 1QRJA 1QQSA 2K62A 3BX8A 3B5IA 2QOSC 4GE1A 2F09A 1KXOA 4U0CA 4ZH6A 3CCQP 1EALA 4PJ2A 1IW2A 1UZ2X 4FQBB 3H3IA 3MVFA 1GKAA 2YMSA 1G5WA 2CBSA 1VQLP 1TOWA 2OVEA 3BU1A 4EEJA 4ODDA 3TF6A 5DG4A 4U0AA 3FR5A 1X8PA 4PSQA 4GNWA 4GZVA 1CRBA 3IFBA 3VG2A 1HMSA 2LA7A 4KC7A 3TGCA 3D95A 1JZUA 1EOQA 1EIIA 3JS1A 4LKTA 3TZSA 1PEEA 2GC9A 3FR2A 4YFQA 4ML7B 4ZHFA 3BRNA 2NNDA 1S7DA 3O22A 2F73A 4YMYA 1CBSA 3DS2A 1GT4A 2CM9A 3OD9A 1HBQA 4GDZA 5LJKA 5HCDC 1U0XA 2LB6A 5LKEA 1S2PA 1GT5A 1VQ6P 4I9SA 1ERXA 1IIUA 3FR4A 4OMWA 1DV9A 1JYDA 1EUOA 4NNSA 1HBPA 1HN2A 5EEEA 1BEBA 3OW2O 2FRSA 1VQ7P 5AJCA 3F6ZB 4D6AA 1JBHA 2EU7X 2HZRA 4U0EA 1NGLA 1Y9TA 2FS7A 1VQ8P 2OVDA 2FLJA 3S26A 5F2NA 2MJIA 5H9AA 3VG5A 3ZUOA 2M8NA 1FDQA 2MHDA 4O3YA 1EIOA 4IABA 1JJXA 5EZ2A 1FTPA 3WXQA 4NNTA 1ML7A 2AT6X 4LZVA 3HWEA 2QM9A 5B27A 2LBVA 3TGBA 1HMRA 1I05A 2QO6A 4MIRA 4MVIA 3WJEA 3PEDA 1EW3A 5BS1A 1ICMA 1VYFA 4M7MA 5HAEA 3FELA 4UU2A 2E4JA 5KIDA 4HWMA 1GGLA 1QABE 4QYNA 4ZCBA 3QKGA 2RCTA 4AW8A 2PY1A 2ONTA 1BRPA 3PH6A 1X8OA 2CM4A 1T0VA 1ZMBA 2JN3A 3P6DA 4A1HA 4CK4A 3D96A 3CWKA 4TKJA 1DF3A 4NW4A 1GKAB 2LF4A 3FW5A 5F1EA 4FBRA 3I56P 2M8LA 4ZHGA 1Y9LA 1LKEA 3HOEA 1AB0A 1S44A 5FAZA 3MX7A 4BOEA 4IPYA 4NLJA 3G21A 1YI2P 1ACDA 4TLJA 1VQPP 2RA6A 4XMGA 5HBSA 4TJZA 1IFCA 2N93A 2Q2PA 4AZMA 1VQ4P 2XV6A 2QMIA 1FE3A 1KC8Q 1BJ7A 4OMXA 2ZAIA 1KQWA 4JGLA 3I55P 2ALLX 3K3LA 3L4RA 3WJGA 1RO2A 2PEKA 5H9LA 4XFXA 4OS8A 3VPJE 2DGYA 3FA7A 3IA8A 2XSTA 2WUTA 5F2KA 3B2KA 4YDAA 1EPAA 5HZQA 3FMZA 3KZAA 2EG5A 2Q4NA 5HTEA 1HMTA 3STMX 4YDBA 1QFTA 3G0VA 4EXZA 2L6EA 2OVAA 1GX8A 1R0UA 4WBKA 3CC4P 4YFPA 3VE1A 4TKBA 4XFZA 4KC8A 4QNIA 2ZAGA 4INNA 2GTLN 4AZOA 5HCEC 1DC9A 1YP6A 4YGGA 1VQ5P 3NQ3A 4GKCA 2L67A 4AZNA 2R74A 5LJDA 2CZTA 1VPRA 3VG7A 3U03A 3ELZA 4PH1A 4FBOA 1JIWI 4HPBA 2WR6A 1VQKP 1B0OA 3NTEA 2AT3X 3KFGA 4R0BA 1VQMP 5DPQA 1D1DA 3NPOA 3P6CA 2OZQA 1JV4A 4CSBA 3VE2A 1OBUA 5JPAA 1DZJA 2AT8X 1VYGA 1K8AQ 1MX8A 3G7XA 1KT6A 3D97A 1OPAA 1TXLA 3FIQA 4ID2A 1CBIA 5BS2A 4HFOA 3UEXA 3FYFA 5AEOA 3P02A 4I3CA 3DS0A 1DZMA 1QVFO 3CMPA 3RBYA 3DS1A 2WQ9A 3UEWA 1SY2A 1BWYA 2ACOA 1T68X 4XFYA 4Y0QA 4RUNA 4YCHA 4QZTA 4LZUA 2RD7C 1L6MA 4ZGUA 3NQ9A 3HYBA 1W2BO 3STKA 4KIIA 3EBKA 1Q82Q 2DM5A 1M90Q 5LJHA 1TW4A 2Z4IA 1OEKA 4GETA 4GH7A 5IO7A 2JU8A 2Q2MA 2M4LA 1KGLA 1LIEA 3WJBA 4XMEA 3PQUA 5HGLA 4FGIB 2IFBA 3FEKA 4N7CA 1X8NA 5D8JA 4BVMA 2BT9A 1RLBE 2MWHA 4LQZA 2EIAA 3CXCO 2KTSA 3S60A 1K30A 3G26A 1A2DA 1BBPA 1M6EX 3B2IA 5B29A 5HZ5A 3LRYA 4XMHA 3PECA 1IKJA 1ALBA 3G4SP 4GK9A 2JW1A 2FWVA 1LIDA 4IB6A 4WHIA 3WBGA 3ZW1A 1YWDA 4O3ZA 1SA8A 2JU7A 1GX9A 1G85A 1X8UA 2NP1A 4ORSA 3PP6A 2PENA 4TQ2A 1KT4A 1KQXA 5AJBA 1CJ5A 1JJ2O 1KOIA 3UEVA 4AZPA 1CBRA 2WSJA 1YUPA 3APUA 5LJCA 4GR6A 5HTDA 3WBHA 3U0DA 4L1NA 2LBAA 2MM3A 4YGZA 1DZKA 3G28A 3BSZE 3EBWA 1XKIA 3HWGA 1MVGA 1QVGO 1ICNA 1YIVA 3BLGA 4MISA 3T1DA 2ASNX 4IAWA 4IBAA 4DQ4A 1MDCA 2OTJP 2OVSA 3CCRP 3CQRA 3G1IA 1SXUA 2G79A 5EDBA 3ZW2A 2L5PA 4I3DA 1GT1A 3Q20A 1A57A 1YWBA 2OTLP 4ZFXA 5BYPA 4QZUA 1HQPA 2FR3A 4BQUA 3P24A 4WFVA 3H0DA 3GE2A 1DFVA 1G7NA 4A1YA 5C0NA 4U9CA 5FQ8E 2Z46A 3HZQA 5F58A 3G6EP 1RBPA 2RCQA 5LJEA 5L8NA 3APXA 1ZNGA 2W2BA 2CWOA 3STNA 5F7GA 3ZUIA 5FFHA 3KQ0A 2A2UA 5BVTA 3KFHA 4Y0PA 4ORYA 3EMMA 1PM1X 3MBTA 4O4OA 1AVGI 2OFMX 3WJDA 3CCVP 4O3XB 1BLRA 1OEJA 3B2LA 4QAEA 2BS5A 3WJFA 2BHVA 3SOTA 2KD2A 3E3CA 1U17A 4XROA 4IB8A 1M74A 1KD1Q 4ORXA 3ZI8A 4ZH9A 1YJ9P 1S72P 2A0AA 4WFUA 1YJNP 4AYHA 4TNNA 5D4AA 1SY1A 1GM6A 2RQ0A 2PEQA 4LKPA 1K9MQ 1Z24A 4ZHDA 1ADLA 4HPAA 1A3YA 1LIBA 3G71P 2BUOA 4YKOA 5LJGA 3UEUA 4ALBA 4ALOA 2RN4A 2XT1A 4HPCA 5I4TG 5KHPA 2A2GA 3CC7P 3CPWO 3APVA 4GNYA 2PEOA 4NYQA 1B4MA 4M0IA 4OS3A 1MUPA 2LFOA 5JR8A 2L68A 3CCUP 1YIJP 1FELA 2QO4A 2JMBA 1QY0A 1PMPA 1X89A 3ELXA 2E1MA 4YCEA 3NX2A 3CCMP 4QGXA 3ZWEA 5EDCA 1EPBA 2NNEA 1E5PA 2HNXA 2X8TA 5HZ8A 3DTJA 3P6EA 2EFJA 4ORUA 5HGNA 3S5VA 4MVKA 4NP1A 4U8UM 1A18A 4K19A 2HYSA 3RWXA 1LICA 2WQAE 4YBUA 2CBRA 4EDEA 4XMDA 3CD6P 3VU1A 2X8SA 3CBSA 2YG2A 1EIAA 3BX7A 4YFRA 4YGHA 2PEMA 2OFRX 4O49A 3P6HA 3FENA 4AZRA 3BS2A 3G29A 2BLGA 3CCSP 3N91A 4O4SA 5HZ6A 3C76X 1LIFA 3APWA 3GAQA 3D4RA 4M6SA 1KT5A 4A60A 1D2UA 3HOLA 2FS6A 4TKHA 4GRJA 4I95A 4ZGFA 5F6ZA 4AZQA 3P6GA 4XRQA 1JJJA 3FA8A 1RNIA 3NR3A 2HMBA 3ZW1B 2Q39A 1G74A 2G7BA 3DSZA 1VQ9P 5LJBA 3KFFA 4CV7A 3H4EA 1X71A 3HK1A 5D45A 2HLVA 1I06A 3OE3A 1CBQA 1LNMA 2K23A 1FEMA 1OBQA 5F6BA 1BSQA 3OJYC 2QO5A 2LKKA 2ACPX 1SY3A 1VQNP 1O8VA 1UREA 3OBLA 4MVLA 2GTLO 3WVMA 1M1KQ 4ON1A 2NNQA 3PH5A 1QFVA 2AT0X 1A43A 5KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHV A;  3JQO A; 
#chains in the Genus database with same CATH topology
 2L0Q A;  1K73 Q;  3NAD A;  2G78 A;  1KZW A;  3SAO A;  1HQB A;  5DCK A;  3EYC A;  3O2Y A;  2LKI A;  2OFA A;  2K0X A;  5IO5 A;  3UAQ A;  2JBG A;  1Y0G A;  5HWZ A;  1K24 A;  2FTB A;  1E06 A;  1HXL A;  1NJI Q;  2FR2 A;  4UU3 A;  5K06 A;  1GXA A;  2KT4 B;  2POA A;  2AH7 X;  1ERB A;  3LV4 A;  4MVE A;  5IO6 A;  3RDO A;  4I3B A;  1NP4 A;  3VGW A;  1H91 A;  1SRJ A;  4IMN A;  3FLL A;  4O9S A;  3DS3 A;  4ZR2 A;  3TGA A;  2AT5 X;  1N43 A;  1JMX A;  5CYB A;  4OEL A;  2G5L A;  1SWQ A;  4IB9 A;  5B11 O;  2PY8 A;  1BXI A;  1KT3 A;  3VG3 A;  2JOZ A;  2VLN A;  3F8A A;  1SXY A;  3EJD A;  3MG5 A;  3S5X A;  2AKQ A;  1BAJ A;  1E6J P;  3WZP A;  1UYO X;  3CQN A;  2DNW A;  4COC A;  4YH0 A;  5HGM A;  1VWP B;  1VWO B;  1SY0 A;  2MF6 A;  4DQ3 A;  1DZP A;  3HWD A;  1Z6M A;  2ZSC A;  5F2O A;  1YWA A;  2VDF A;  5HGO A;  1N9M A;  2IZI A;  4QGV A;  1SLF B;  3FA9 A;  1IKE A;  1MOY A;  2XXM A;  2MF4 A;  1E00 A;  2W2F A;  1KT7 A;  2X46 A;  5EJD A;  2QA4 P;  3HTY A;  3G1G A;  1Q86 Q;  3DPH A;  4QGW A;  4YKM A;  1HXZ A;  2ROQ A;  3WOV A;  2IZJ A;  4OS0 A;  4Y0S A;  3VRL C;  4O4U A;  4U0B A;  1ZND A;  4IMO A;  5D48 A;  3B5I A;  4FQB B;  3H3I A;  2FVA A;  2CBS A;  3BU1 A;  1SWB A;  2AVA A;  4U0A A;  1X8P A;  3VG2 A;  1CRB A;  2OY7 A;  3RY2 A;  2K0Y A;  2RTG B;  4OEM A;  2RTC B;  3FR2 A;  3CE7 A;  4YFQ A;  4ML7 B;  2NND A;  5IRA A;  2MR7 A;  3RDM A;  2VSQ A;  5HCD C;  1RSU B;  4OMW A;  1DV9 A;  1JYD A;  1VWI B;  4CDC A;  2HZR A;  1VQ8 P;  5B5G A;  5F2N A;  5H9A A;  1FDQ A;  4IAB A;  1JJX A;  5JD2 A;  1LDQ A;  1NQM A;  4LZV A;  2QM9 A;  1VWM B;  3SZI A;  1HMR A;  1ICM A;  4M7M A;  2N50 A;  2E4J A;  2RTF B;  2RTR B;  2OF8 A;  3PH6 A;  1X8O A;  2JN3 A;  4A1H A;  4CPH B;  1SWC A;  1DF3 A;  4NW4 A;  2LF4 A;  5F1E A;  1Y9L A;  2KGC A;  3HOE A;  5FAZ A;  4BOE A;  2LIU A;  3G21 A;  2RA6 A;  2DJG A;  5HBS A;  2UYW A;  1IFC A;  4AZM A;  1KC8 Q;  2ZAI A;  2FVE A;  3L4R A;  3FMZ A;  4YDB A;  1GX8 A;  2KOQ A;  5HCE C;  1DC9 A;  4YGG A;  3NQ3 A;  1VWL B;  2WR6 A;  3CKF A;  4R0B A;  1VWB B;  3P6C A;  2OZQ A;  2LML A;  1MX8 A;  1KT6 A;  1TXL A;  1CBI A;  3UEX A;  3P02 A;  3T2X A;  3DS0 A;  1GX3 A;  3CMP A;  3RBY A;  2OY1 O;  1UYN X;  2WQ9 A;  1SY2 A;  4BX5 B;  4Y0Q A;  4YCH A;  4QZT A;  3RDX A;  3HYB A;  4JHQ A;  5LJH A;  4GH7 A;  3WYP A;  5IO7 A;  3LMO A;  1LIE A;  3EJE A;  3GZL A;  2IFB A;  2MWH A;  4LQZ A;  2EIA A;  3G26 A;  1M6E X;  3LRY A;  4GGR A;  4WHI A;  3G4S P;  2JW1 A;  3ZW1 A;  4O3Z A;  2KGE A;  2JU7 A;  1X8U A;  2PEN A;  4NEO A;  1MZ8 A;  1KQX A;  1JJ2 O;  1CBR A;  2WSJ A;  4YGZ A;  2VFC A;  3BSZ E;  3EBW A;  1ICN A;  4DQ4 A;  2HKD A;  4NV8 A;  4QKO A;  3G1I A;  1SXU A;  1MEP A;  1A57 A;  1YWB A;  2OTL P;  4QZU A;  1G7N A;  2XZ1 C;  5F58 A;  5B5F A;  2W2B A;  3STN A;  3FDC A;  1VWG B;  5BVT A;  3KFH A;  4ORY A;  4O4O A;  1PM1 X;  3CCV P;  4O3X B;  1OEJ A;  4XRO A;  4IB8 A;  2I5Z O;  1YJ9 P;  4WFU A;  4TNN A;  2RQ0 A;  4ZHD A;  1KL5 A;  3SZJ A;  4ALO A;  2BUO A;  4YKO A;  2XT1 A;  5KHP A;  4GNY A;  1B4M A;  1VYO A;  2L68 A;  1FEL A;  2QO4 A;  1X89 A;  4BX6 A;  3NX2 A;  3ZWE A;  5EDC A;  2NNE A;  1KFF A;  4CPF A;  2HYS A;  3RWX A;  1LIC A;  2CBR A;  4YGH A;  2PEM A;  3BS2 A;  2JB0 A;  4O4S A;  1SWL A;  2GDW A;  3APW A;  1KT5 A;  1D2U A;  4GRJ A;  5F6Z A;  1RNI A;  2G7B A;  3WZQ A;  3H4E A;  2RTA A;  1FEM A;  2NO8 A;  5F6B A;  1BSQ A;  2BC3 A;  4CA3 A;  2LKK A;  2QO5 A;  2ACP X;  3T6L A;  2NNQ A;  3GJN A;  2X32 A;  2JO0 A;  4O3W A;  5H8T A;  1EI5 A;  1ZNV A;  4Y0R A;  2P9X A;  2ANS A;  1U18 A;  2WWP A;  4C5P A;  1RXH A;  2RTB B;  2Z45 A;  2RTE B;  1AQB A;  2KOD A;  1TOU A;  1RO0 A;  1PBO A;  2FT9 A;  1O1V A;  3ZW0 B;  2C1S A;  5FEN A;  2GZG A;  2FHN X;  2CNR A;  1VWJ B;  1Y52 X;  2MR8 A;  2K0D X;  1AF8 A;  2PEJ A;  3DS5 A;  3U43 A;  1LF7 A;  2A5C A;  4EKV A;  3KFI A;  2KR5 A;  2GZE A;  1B56 A;  1OR5 A;  1SWD A;  3EC5 A;  1JYJ A;  1SXX A;  1PTS A;  2N6Z A;  2LL8 A;  1VWD B;  4EFG A;  1N8R Q;  1VWF B;  2FQ1 A;  3ZW0 A;  4HKG A;  2BS6 A;  4COP A;  4Z2P A;  3B2J A;  1Y55 X;  2RTH B;  2M8P A;  3CC2 P;  5HA1 A;  5HZ9 A;  3SZH A;  3FA6 A;  4GD9 A;  2Q9S A;  4PH0 A;  3MGE A;  3E2D A;  2G8C O;  1LCV A;  3P05 A;  1I4U A;  1ZNK A;  1A8O A;  1JQP A;  1IUQ A;  3CME P;  3PDF A;  4KCA A;  3CCJ P;  2L9C A;  3PQS A;  1RST B;  3NBX X;  4D6B A;  4F37 A;  1LPJ A;  1N0S A;  2KG9 A;  2GZI A;  1MX7 A;  1EXS A;  1ZNH A;  1FEN A;  5EPQ A;  1ZNE A;  3V8U A;  3BX8 A;  2QOS C;  4U0C A;  1EAL A;  3CCQ P;  1UZ2 X;  1GKA A;  1HY8 A;  2YMS A;  2JGP A;  1TOW A;  2OVE A;  4ODD A;  1I9H A;  4GNW A;  1SWE A;  2FKG A;  2OFB A;  1GXG A;  4KC7 A;  3TGC A;  3JS1 A;  1SWA A;  3TZS A;  2K5X A;  2BSZ A;  3BRN A;  3O22 A;  4ZHF A;  5LJK A;  2FQ0 A;  1U0X A;  2LB6 A;  1S2P A;  1VQ6 P;  1ERX A;  1IIU A;  1HBP A;  1HN2 A;  1SWG A;  3RE6 A;  1JBH A;  2EU7 X;  1NGL A;  2RTM A;  2OYB O;  2AT6 X;  2LBV A;  5B2A O;  1VYF A;  2L4B A;  2RTI B;  1QAB E;  1PBY A;  2PY1 A;  1BRP A;  5IRU A;  1T0V A;  1ZMB A;  1ACP A;  3P6D A;  4CK4 A;  3CWK A;  1E0H A;  1VHN A;  3FW5 A;  3EJB A;  2M8L A;  3MX7 A;  4TLJ A;  4NLJ A;  4IPY A;  3Q34 A;  4XMG A;  1NBX A;  4TJZ A;  2OF9 A;  2QMI A;  1KQW A;  4JGL A;  3I55 P;  3SLJ A;  1L0I A;  5H9L A;  4XFX A;  1SWN A;  3FA7 A;  2WUT A;  5F2K A;  3B2K A;  3AEH A;  2EG5 A;  3FID A;  2L6E A;  4YFP A;  2AVI A;  3CC4 P;  4KC8 A;  1IMP A;  4JO6 A;  3NY7 B;  1YP6 A;  2L67 A;  3WZN A;  1VPR A;  3RY1 A;  1MM9 A;  2GZF A;  1B0O A;  2WPU A;  2AT3 X;  2C4I A;  3KFG A;  5DPQ A;  2KOP A;  1D1D A;  2IZE B;  2AT8 X;  1FR2 A;  1N9Y A;  1DZM A;  2QCB A;  3UEW A;  1Y53 X;  1SWF A;  4XFY A;  1UNK A;  1L6M A;  4ZGU A;  1Q82 Q;  1M90 Q;  1AYI A;  1KGL A;  2FAE A;  3PQU A;  5HGL A;  4N7C A;  4BVM A;  3GKL C;  3S60 A;  5CZD B;  1LID A;  2X34 A;  5IRW A;  1G85 A;  2NP1 A;  4ORS A;  3PP6 A;  4TQ2 A;  1KT4 A;  2PNG A;  2Y3F A;  2EHS A;  2UZ2 A;  4MIS A;  2A5B A;  1MVG A;  1QVG O;  3BLG A;  2VLQ A;  2ASN X;  4DG9 A;  2KWL A;  5EDB A;  2JQ4 A;  2L5P A;  4I3D A;  2A8G A;  2FR3 A;  3D9W A;  4BQU A;  3P24 A;  1DFV A;  5C0N A;  4U9C A;  2N6Y A;  2CWO A;  3EMM A;  2OFM X;  1W4T A;  1U17 A;  5EW5 E;  2MY5 A;  1E2T A;  4HPA A;  3UEU A;  2GYK A;  2RN4 A;  5I4T G;  4H2W C;  5JR8 A;  2RTP B;  3AUM O;  5CHK A;  2E1M A;  4QGX A;  2X8T A;  2EFJ A;  4ORU A;  3S5V A;  4MVK A;  4NP1 A;  2WQA E;  2K92 A;  2Y32 A;  2X8S A;  3CBS A;  4YFR A;  1EIA A;  4O49 A;  4AZR A;  3N91 A;  4M6S A;  2X55 A;  3RDS A;  4I95 A;  4ZGF A;  1RAV A;  3P6G A;  3NR3 A;  5LJB A;  1DV5 A;  1NDJ A;  3HK1 A;  1SWJ A;  2HLV A;  1CBQ A;  2CGQ A;  5B10 O;  2AFE A;  1URE A;  3OBL A;  2GTL O;  4ON1 A;  4BCS A;  1QFV A;  5KIC A;  2ERH A;  4U8U O;  3CCL P;  5HVC A;  5LKF A;  2OY8 A;  1X8Q A;  3CR6 A;  5D47 A;  4ZJ0 A;  1VQO P;  3DS4 A;  4YBP A;  4U0D A;  3RKG A;  5AQ6 A;  1BSO A;  5K67 A;  3BY0 A;  2W2A A;  4KT5 A;  2R73 A;  3H47 A;  2C1Q A;  1AEL A;  2M5R A;  1JMZ A;  2IZA A;  3FEP A;  1E02 A;  2IZC B;  2JYL A;  2WEW A;  2GTL M;  4HPD A;  4L3R A;  4Z27 A;  4ARH A;  2HZQ A;  1OBP A;  3BU9 A;  4CDD A;  2X4M A;  2OAR A;  2IZH B;  3EM0 A;  4IB7 A;  3AKN A;  4QRL A;  2R56 A;  1KZX A;  1W6F A;  3LTW A;  4N7D A;  3CBC A;  2VLP A;  5HA0 A;  2QOM A;  2N98 A;  2CZU A;  2JYG A;  4GU8 A;  3NX1 A;  1SXW A;  3EW1 A;  4BPG A;  1IFB A;  3I0A A;  2KOS A;  1I04 A;  2RTJ A;  1B8E A;  5BVS A;  4UHP B;  1ZRY A;  1MK5 A;  3ZQ3 A;  2AMM X;  4FBV A;  1TVQ A;  1QWD A;  2KG8 A;  2GTF X;  1GT3 A;  1BRQ A;  2QEX P;  4GR2 A;  2JU3 A;  4I6S A;  4I9R A;  2RTL A;  5KP6 B;  1BSY A;  5FQ6 E;  1AVD A;  1YWC A;  2KW1 A;  1YJW P;  2IZB A;  1KQS O;  1Q7Y Q;  1SMP I;  4DCB A;  2QNW A;  3VG6 A;  5L8I A;  3VHM A;  4COT A;  3NQK A;  3T6F A;  3DTQ A;  4WYM A;  1ZNL A;  4QYP A;  1QRJ A;  1QQS A;  1HQQ A;  2F09 A;  4ZH6 A;  1IW2 A;  3MVF A;  1G5W A;  4EEJ A;  2JU2 A;  5DG4 A;  3FR5 A;  4PSQ A;  4GZV A;  3IFB A;  1JZU A;  4BX6 B;  2LTE A;  4LKT A;  1PEE A;  2OL8 O;  1SWT A;  2F73 A;  2RTD B;  4Z2O A;  1SWP A;  1GT4 A;  3OD9 A;  4GDZ A;  1HBQ A;  1GPJ A;  1GT5 A;  1LCW A;  2KOR A;  1IMQ A;  4CDE A;  3OW2 O;  3F6Z B;  3X00 A;  4U0E A;  1Y9T A;  2FS7 A;  3S26 A;  2FLJ A;  3VG5 A;  2LIW A;  3ZUO A;  2M8N A;  5EZ2 A;  1FTP A;  5B3M O;  2VLO A;  1VWR B;  1I05 A;  4MVI A;  3WJE A;  3PED A;  1EW3 A;  2CAM A;  4UU2 A;  4HWM A;  1GGL A;  4QYN A;  2N5H A;  4ZCB A;  2RCT A;  4AW8 A;  3D96 A;  1GKA B;  4H2Y C;  4ZHG A;  1LKE A;  1AB0 A;  1S44 A;  1ACD A;  2FKJ A;  1VQP P;  1SLD B;  2N93 A;  2Q2P A;  4IZ6 A;  1VQ4 P;  2XV6 A;  4B55 A;  2ALL X;  1RO2 A;  2PEK A;  3VHI A;  4OS8 A;  3VPJ E;  5L3Y A;  3WYQ A;  3IA8 A;  4MRT C;  2DJF A;  4BX7 B;  1EPA A;  2AF8 A;  5HZQ A;  3KZA A;  5HTE A;  3G0V A;  1R0U A;  4WBK A;  5IXG A;  4INN A;  4YVB A;  4AZO A;  2EHT A;  4DNE A;  4BJ8 A;  1VQ5 P;  2MVV A;  2R74 A;  1SRE A;  3U03 A;  1SRH A;  3ELZ A;  4FBO A;  1JIW I;  4HPB A;  1VQM P;  3NPO A;  1STP A;  1JV4 A;  2AFD A;  3VE2 A;  5JPA A;  1DZJ A;  1VYG A;  1K8A Q;  3G7X A;  4ID2 A;  3FIQ A;  4HFO A;  4R0M A;  3FYF A;  4I3C A;  2VFB A;  3DS1 A;  1BWY A;  1IJ8 A;  1T68 X;  4LZU A;  2RD7 C;  1DNY A;  3STK A;  3EBK A;  2DM5 A;  1TW4 A;  2RTK A;  1SLG B;  2Z4I A;  4GET A;  2JU8 A;  2M4L A;  4XME A;  4FGI B;  3FEK A;  3CXC O;  4Z2V A;  2KTS A;  5B29 A;  4XMH A;  1K3B A;  1IKJ A;  4GK9 A;  3WBG A;  2RTQ B;  1GX9 A;  5CSE A;  5AJB A;  1CJ5 A;  3UEV A;  4AZP A;  3APU A;  5HTD A;  3WBH A;  3U0D A;  4L1N A;  2MM3 A;  1DZK A;  3HWG A;  1XKI A;  4Z28 A;  1YIV A;  3T1D A;  4IAW A;  4IBA A;  3SLT A;  2XZ0 D;  3CQR A;  3CCR P;  1VWH B;  3ZW2 A;  3Q20 A;  4ZFX A;  5BYP A;  1HQP A;  4A1Y A;  5HV8 A;  5FQ8 E;  2IZL B;  2Z46 A;  2OL7 A;  2RCQ A;  5L8N A;  1ZNG A;  3GZM A;  5FFH A;  3KQ0 A;  2A2U A;  3MBT A;  1AVG I;  1CEI A;  3WJD A;  1BLR A;  3B2L A;  4QAE A;  3WJF A;  2BS5 A;  2JGS A;  2BHV A;  3E3C A;  2KW2 A;  1M74 A;  3ZI8 A;  4ZH9 A;  2JAZ A;  1S72 P;  2A0A A;  1YJN P;  4NV7 A;  5D4A A;  4AYH A;  1SY1 A;  2PEQ A;  1SWO A;  4LKP A;  1ADL A;  1SRF A;  2FVF A;  1LIB A;  5LJG A;  4ALB A;  4HPC A;  3CC7 P;  4OS3 A;  1SWS A;  2LFO A;  3CCU P;  1YIJ P;  2JMB A;  1QY0 A;  3ELX A;  1NC9 A;  5HGN A;  4U8U M;  4YBU A;  2I5V O;  4EDE A;  4XMD A;  3CD6 P;  3VU1 A;  2YG2 A;  3EW2 A;  2OFR X;  3G29 A;  5HZ6 A;  2IZG B;  1KL4 A;  4CPH A;  3C76 X;  1LIF A;  3GAQ A;  3D4R A;  1UJZ A;  2FS6 A;  1SWK A;  5K68 A;  1GXH A;  4XRQ A;  1JJJ A;  3FA8 A;  1G74 A;  3RE5 A;  1SWR A;  2PI3 O;  3KFF A;  1X71 A;  2AF5 A;  1W5R A;  2JU1 A;  5D45 A;  1I06 A;  1LNM A;  1X3O A;  1FJ1 E;  3OJY C;  1SY3 A;  2X56 A;  1VWK B;  1NQN A;  1NP1 A;  3B4Q A;  2CQ8 A;  4U0F A;  2WPT A;  1XCA A;  1YIT P;  3LHN A;  4IRW A;  5CE4 A;  3B2H A;  4RUU A;  2KOO A;  4XMF A;  2WEX A;  1LFO A;  2F01 A;  5H9N A;  3VG4 A;  1QG5 A;  1SRI A;  3WJC A;  4O4X A;  3NP1 A;  3M1M A;  1D3S A;  5HCC C;  1WUB A;  1VWA B;  4XMC A;  1OEE A;  2KG6 A;  3BDR A;  3SLO A;  1OPB A;  3ZZV A;  1SLE B;  3RG6 C;  1YHQ P;  4JNJ A;  2XKL A;  3P6F A;  3JQO A;  2A3F X;  3RG2 A;  4IAX A;  1P6P A;  3O19 A;  3JSQ A;  4KH8 A;  4EQA C;  3RSW A;  2FQ2 A;  1KLP A;  4NYR A;  1Q81 Q;  2X8F A;  3F9D A;  5BVQ A;  1QY2 A;  2P8G A;  3C78 X;  5L8O A;  2A13 A;  2MO5 A;  3RZY A;  1I78 A;  3PPT A;  3PK2 A;  1EQD A;  3C77 X;  2Z4H A;  4ZHH A;  1RXJ A;  5EED A;  1AUM A;  1QY1 A;  5H9K A;  2GJ5 A;  3FW4 A;  4U3Q A;  4ZHC A;  2OL6 O;  1L0H A;  1SWU A;  4QQ1 A;  2FHL A;  4ORW A;  3Q6L A;  2Z44 A;  2K93 A;  4A8Z A;  1BM5 A;  1YP7 A;  2PEI A;  4Y59 A;  1O1U A;  2AL0 X;  3HWF A;  4ES7 A;  3KVN A;  3U9P C;  4H2X C;  2O62 A;  3CCE P;  4U8U N;  2X2B A;  1EMV A;  3I17 A;  1M6N A;  1JJU A;  3AKM A;  2KTD A;  4NLI A;  1T8V A;  4CPE A;  4QNB A;  4BPF A;  1SRG A;  2X45 A;  3CMA P;  4ORR A;  1LCZ A;  1RXK A;  5FQ7 E;  2K62 A;  4PXH B;  5KP8 B;  4GE1 A;  1KXO A;  4PJ2 A;  1VKU A;  1VQL P;  2K94 A;  1NQ4 A;  1WBI A;  4Y5D A;  3TF6 A;  1HMS A;  2LA7 A;  3D95 A;  1EOQ A;  1EII A;  4CDF A;  1KL3 A;  2GC9 A;  1LEL A;  4YMY A;  1S7D A;  1CBS A;  2FAD A;  3DS2 A;  2CM9 A;  3WZO A;  5LKE A;  4I9S A;  2CG5 B;  3FR4 A;  4GJV A;  1EUO A;  4NNS A;  5EEE A;  1BEB A;  2FRS A;  1VQ7 P;  2IZK A;  5AJC A;  4BGF A;  4D6A A;  2OY5 O;  2OVD A;  2MJI A;  1EIO A;  4O3Y A;  2MHD A;  4CPI A;  3WXQ A;  4NNT A;  1ML7 A;  1N7Y A;  3HWE A;  4PWV B;  2K2Q A;  2GH7 A;  5B27 A;  1VWQ B;  3TGB A;  4GGZ A;  2QO6 A;  4MIR A;  5BS1 A;  2IZF B;  5HAE A;  3FEL A;  5KID A;  3QKG A;  2ONT A;  2CM4 A;  4TKJ A;  4FBR A;  3I56 P;  4GDA A;  1YI2 P;  1F80 D;  3HPE A;  1FE3 A;  1BJ7 A;  1N4J A;  1VWN B;  4OMX A;  2GZJ A;  3K3L A;  3WJG A;  2DGY A;  2FHS C;  2XST A;  4YDA A;  2Q4N A;  1HMT A;  3STM X;  1QFT A;  4EXZ A;  2OVA A;  3VE1 A;  4TKB A;  4XFZ A;  4QNI A;  2ZAG A;  2GTL N;  4GKC A;  4AZN A;  5LJD A;  2CZT A;  3VG7 A;  4PH1 A;  4I60 A;  1VQK P;  3NTE A;  4CSB A;  1OBU A;  2KGD A;  3D97 A;  1OPA A;  5BS2 A;  1T8K A;  5AEO A;  1QVF O;  2MD9 A;  2ACO A;  4RUN A;  3NQ9 A;  1W2B O;  4KII A;  1OEK A;  2Q2M A;  3WJB A;  2MVU A;  1X8N A;  5D8J A;  2BT9 A;  1RLB E;  1K30 A;  1A2D A;  1BBP A;  3B2I A;  1LUQ A;  5HZ5 A;  3PEC A;  1ALB A;  4BPH A;  2FWV A;  4IB6 A;  1YWD A;  1SA8 A;  5F2B A;  4BBO A;  1KOI A;  1YUP A;  5LJC A;  4GR6 A;  2LBA A;  3G28 A;  2GDX A;  3RDQ A;  1MDC A;  2OTJ P;  2OVS A;  2G79 A;  1GT1 A;  1STS B;  4WFV A;  3H0D A;  3GE2 A;  2N5I A;  2FGS A;  3HZQ A;  3G6E P;  1RBP A;  5LJE A;  4BX5 A;  3APX A;  2GDY A;  5F7G A;  3ZUI A;  1VWE B;  5KP7 B;  4Y0P A;  1SWH A;  7CEI A;  3SOT A;  2KD2 A;  4U46 A;  2RTN B;  1KD1 Q;  4ORX A;  3QQ2 A;  1GM6 A;  1K9M Q;  1Z24 A;  1A3Y A;  3G71 P;  3MM0 A;  2A2G A;  3CPW O;  3APV A;  2PEO A;  4NYQ A;  4M0I A;  2LPK A;  1MUP A;  1AVE A;  1DF8 A;  1OSP O;  1PMP A;  2L9F A;  4YCE A;  2IZD B;  3CCM P;  1EPB A;  1E5P A;  2HNX A;  5HZ8 A;  3DTJ A;  3P6E A;  1STR B;  2L22 A;  1VWC B;  1A18 A;  4K19 A;  1HY2 A;  4Z6J A;  3BX7 A;  3VHH A;  3P6H A;  3FEN A;  1LDO A;  4GJS A;  2BLG A;  3CCS P;  4A60 A;  4MEE A;  3HOL A;  4TKH A;  2LOL A;  4GGT A;  2RTO B;  4AZQ A;  3RDU A;  2HMB A;  3ZW1 B;  2Q39 A;  3DSZ A;  4OKA A;  1VQ9 P;  2Y3E A;  4CV7 A;  3T2W A;  3OE3 A;  2K23 A;  2KGA A;  1OBQ A;  4GUZ A;  3CKG A;  1VQN P;  1O8V A;  4MVL A;  4BX7 A;  3WVM A;  1M1K Q;  3PH5 A;  2AT0 X;  1A43 A;  2FAC A; 
#chains in the Genus database with same CATH homology
 1NP1 A;  4U8U O;  3CCL P;  2JO0 A;  4O3W A;  4U0F A;  1K73 Q;  1EI5 A;  5H8T A;  5LKF A;  3NAD A;  4Y0R A;  2G78 A;  1XCA A;  1YIT P;  3LHN A;  1KZW A;  3SAO A;  1X8Q A;  5CE4 A;  2P9X A;  3CR6 A;  5D47 A;  4ZJ0 A;  1VQO P;  5DCK A;  3EYC A;  3DS4 A;  3O2Y A;  4YBP A;  2ANS A;  3B2H A;  4U0D A;  4RUU A;  4XMF A;  3RKG A;  5IO5 A;  1U18 A;  2WEX A;  1LFO A;  2WWP A;  3UAQ A;  5H9N A;  3VG4 A;  1QG5 A;  5AQ6 A;  1BSO A;  2Z45 A;  1AQB A;  3WJC A;  2KOD A;  1TOU A;  1RO0 A;  3BY0 A;  5HWZ A;  4O4X A;  1PBO A;  2FT9 A;  3M1M A;  3NP1 A;  1O1V A;  1D3S A;  3ZW0 B;  5HCC C;  5FEN A;  2FTB A;  1E06 A;  2W2A A;  4KT5 A;  2R73 A;  3H47 A;  1NJI Q;  1AEL A;  2FR2 A;  4XMC A;  4UU3 A;  5K06 A;  1OEE A;  1GXA A;  2KT4 B;  3BDR A;  3FEP A;  1E02 A;  1OPB A;  3ZZV A;  2POA A;  2AH7 X;  1ERB A;  3LV4 A;  4MVE A;  5IO6 A;  2JYL A;  3RG6 C;  2WEW A;  1YHQ P;  2GTL M;  4I3B A;  2XKL A;  3P6F A;  1NP4 A;  2A3F X;  3JQO A;  4HPD A;  4L3R A;  2PEJ A;  4ARH A;  2HZQ A;  4IAX A;  1OBP A;  3BU9 A;  1H91 A;  4IMN A;  3FLL A;  4O9S A;  3DS3 A;  2OAR A;  4ZR2 A;  3TGA A;  3EM0 A;  3DS5 A;  1P6P A;  2AT5 X;  3O19 A;  3JSQ A;  1LF7 A;  4KH8 A;  4IB7 A;  5CYB A;  3AKN A;  4QRL A;  2R56 A;  4EQA C;  3RSW A;  1KZX A;  4IB9 A;  2PY8 A;  3KFI A;  4N7D A;  3CBC A;  1B56 A;  4NYR A;  1Q81 Q;  1JYJ A;  1SXX A;  2X8F A;  3F9D A;  5HA0 A;  5BVQ A;  1KT3 A;  1QY2 A;  2P8G A;  2CZU A;  3C78 X;  4EFG A;  2A13 A;  3VG3 A;  5L8O A;  1N8R Q;  2JOZ A;  2MO5 A;  3F8A A;  3RZY A;  2JYG A;  1SXY A;  3PPT A;  4GU8 A;  3NX1 A;  1SXW A;  3S5X A;  2AKQ A;  3ZW0 A;  1EQD A;  3C77 X;  1BAJ A;  1IFB A;  1E6J P;  2Z4H A;  4ZHH A;  3CQN A;  3I0A A;  2BS6 A;  5EED A;  4COP A;  3B2J A;  1I04 A;  1AUM A;  1QY1 A;  5H9K A;  2M8P A;  3CC2 P;  2GJ5 A;  5HA1 A;  5HZ9 A;  1B8E A;  3FA6 A;  3FW4 A;  4COC A;  5BVS A;  4U3Q A;  4ZHC A;  2Q9S A;  4YH0 A;  5HGM A;  4QQ1 A;  4PH0 A;  1ZRY A;  3ZQ3 A;  3MGE A;  3E2D A;  2AMM X;  1SY0 A;  1TVQ A;  1QWD A;  4FBV A;  4ORW A;  2GTF X;  1GT3 A;  3P05 A;  3Q6L A;  1BRQ A;  2Z44 A;  1DZP A;  4DQ3 A;  3HWD A;  1I4U A;  5F2O A;  2QEX P;  4GR2 A;  1YWA A;  2JU3 A;  5HGO A;  1ZNK A;  4I6S A;  4I9R A;  4A8Z A;  4QGV A;  1A8O A;  1BM5 A;  3FA9 A;  1IKE A;  1IUQ A;  3CME P;  4KCA A;  1YP7 A;  3CCJ P;  2PEI A;  2XXM A;  1BSY A;  1O1U A;  2L9C A;  3PQS A;  5FQ6 E;  1E00 A;  2AL0 X;  3HWF A;  1YWC A;  2W2F A;  1KT7 A;  2X46 A;  4ES7 A;  2QA4 P;  3U9P C;  2KW1 A;  2O62 A;  3CCE P;  3HTY A;  3NBX X;  1YJW P;  4U8U N;  4D6B A;  3I17 A;  3G1G A;  1KQS O;  1M6N A;  1Q7Y Q;  1Q86 Q;  1LPJ A;  3AKM A;  3DPH A;  1N0S A;  1SMP I;  2KTD A;  4NLI A;  4QGW A;  4YKM A;  1MX7 A;  1EXS A;  1T8V A;  1ZNH A;  3WOV A;  1FEN A;  4QNB A;  3VG6 A;  5EPQ A;  4OS0 A;  1ZNE A;  5L8I A;  4COT A;  3NQK A;  2X45 A;  3CMA P;  3VRL C;  4ORR A;  4O4U A;  4Y0S A;  3V8U A;  4U0B A;  1ZND A;  3DTQ A;  4WYM A;  4IMO A;  1ZNL A;  4QYP A;  5D48 A;  5FQ7 E;  1QRJ A;  1QQS A;  2K62 A;  3BX8 A;  3B5I A;  2QOS C;  4GE1 A;  2F09 A;  1KXO A;  4U0C A;  4ZH6 A;  3CCQ P;  1EAL A;  4PJ2 A;  1IW2 A;  1UZ2 X;  4FQB B;  3H3I A;  3MVF A;  1GKA A;  2YMS A;  1G5W A;  2CBS A;  1VQL P;  1TOW A;  2OVE A;  3BU1 A;  4EEJ A;  4ODD A;  3TF6 A;  5DG4 A;  4U0A A;  3FR5 A;  1X8P A;  4PSQ A;  4GNW A;  4GZV A;  1CRB A;  3IFB A;  3VG2 A;  1HMS A;  2LA7 A;  4KC7 A;  3TGC A;  3D95 A;  1JZU A;  1EOQ A;  1EII A;  3JS1 A;  4LKT A;  3TZS A;  1PEE A;  2GC9 A;  3FR2 A;  4YFQ A;  4ML7 B;  4ZHF A;  3BRN A;  2NND A;  1S7D A;  3O22 A;  2F73 A;  4YMY A;  1CBS A;  3DS2 A;  1GT4 A;  2CM9 A;  3OD9 A;  1HBQ A;  4GDZ A;  5LJK A;  5HCD C;  1U0X A;  2LB6 A;  5LKE A;  1S2P A;  1GT5 A;  1VQ6 P;  4I9S A;  1ERX A;  1IIU A;  3FR4 A;  4OMW A;  1DV9 A;  1JYD A;  1EUO A;  4NNS A;  1HBP A;  1HN2 A;  5EEE A;  1BEB A;  3OW2 O;  2FRS A;  1VQ7 P;  5AJC A;  3F6Z B;  4D6A A;  1JBH A;  2EU7 X;  2HZR A;  4U0E A;  1NGL A;  1Y9T A;  2FS7 A;  1VQ8 P;  2OVD A;  2FLJ A;  3S26 A;  5F2N A;  2MJI A;  5H9A A;  3VG5 A;  3ZUO A;  2M8N A;  1FDQ A;  2MHD A;  4O3Y A;  1EIO A;  4IAB A;  1JJX A;  5EZ2 A;  1FTP A;  3WXQ A;  4NNT A;  1ML7 A;  2AT6 X;  4LZV A;  3HWE A;  2QM9 A;  5B27 A;  2LBV A;  3TGB A;  1HMR A;  1I05 A;  2QO6 A;  4MIR A;  4MVI A;  3WJE A;  3PED A;  1EW3 A;  5BS1 A;  1ICM A;  1VYF A;  4M7M A;  5HAE A;  3FEL A;  4UU2 A;  2E4J A;  5KID A;  4HWM A;  1GGL A;  1QAB E;  4QYN A;  4ZCB A;  3QKG A;  2RCT A;  4AW8 A;  2PY1 A;  2ONT A;  1BRP A;  3PH6 A;  1X8O A;  2CM4 A;  1T0V A;  1ZMB A;  2JN3 A;  3P6D A;  4A1H A;  4CK4 A;  3D96 A;  3CWK A;  4TKJ A;  1DF3 A;  4NW4 A;  1GKA B;  2LF4 A;  3FW5 A;  5F1E A;  4FBR A;  3I56 P;  2M8L A;  4ZHG A;  1Y9L A;  1LKE A;  3HOE A;  1AB0 A;  1S44 A;  5FAZ A;  3MX7 A;  4BOE A;  4IPY A;  4NLJ A;  3G21 A;  1YI2 P;  1ACD A;  4TLJ A;  1VQP P;  2RA6 A;  4XMG A;  5HBS A;  4TJZ A;  1IFC A;  2N93 A;  2Q2P A;  4AZM A;  1VQ4 P;  2XV6 A;  2QMI A;  1FE3 A;  1KC8 Q;  1BJ7 A;  4OMX A;  2ZAI A;  1KQW A;  4JGL A;  3I55 P;  2ALL X;  3K3L A;  3L4R A;  3WJG A;  1RO2 A;  2PEK A;  5H9L A;  4XFX A;  4OS8 A;  3VPJ E;  2DGY A;  3FA7 A;  3IA8 A;  2XST A;  2WUT A;  5F2K A;  3B2K A;  4YDA A;  1EPA A;  5HZQ A;  3FMZ A;  3KZA A;  2EG5 A;  2Q4N A;  5HTE A;  1HMT A;  3STM X;  4YDB A;  1QFT A;  3G0V A;  4EXZ A;  2L6E A;  2OVA A;  1GX8 A;  1R0U A;  4WBK A;  3CC4 P;  4YFP A;  3VE1 A;  4TKB A;  4XFZ A;  4KC8 A;  4QNI A;  2ZAG A;  4INN A;  2GTL N;  4AZO A;  5HCE C;  1DC9 A;  1YP6 A;  4YGG A;  1VQ5 P;  3NQ3 A;  4GKC A;  2L67 A;  4AZN A;  2R74 A;  5LJD A;  2CZT A;  1VPR A;  3VG7 A;  3U03 A;  3ELZ A;  4PH1 A;  4FBO A;  1JIW I;  4HPB A;  2WR6 A;  1VQK P;  1B0O A;  3NTE A;  2AT3 X;  3KFG A;  4R0B A;  1VQM P;  5DPQ A;  1D1D A;  3NPO A;  3P6C A;  2OZQ A;  1JV4 A;  4CSB A;  3VE2 A;  1OBU A;  5JPA A;  1DZJ A;  2AT8 X;  1VYG A;  1K8A Q;  1MX8 A;  3G7X A;  1KT6 A;  3D97 A;  1OPA A;  1TXL A;  3FIQ A;  4ID2 A;  1CBI A;  5BS2 A;  4HFO A;  3UEX A;  3FYF A;  5AEO A;  3P02 A;  4I3C A;  3DS0 A;  1DZM A;  1QVF O;  3CMP A;  3RBY A;  3DS1 A;  2WQ9 A;  3UEW A;  1SY2 A;  1BWY A;  2ACO A;  1T68 X;  4XFY A;  4Y0Q A;  4RUN A;  4YCH A;  4QZT A;  4LZU A;  2RD7 C;  1L6M A;  4ZGU A;  3NQ9 A;  3HYB A;  1W2B O;  3STK A;  4KII A;  3EBK A;  1Q82 Q;  2DM5 A;  1M90 Q;  5LJH A;  1TW4 A;  2Z4I A;  1OEK A;  4GET A;  4GH7 A;  5IO7 A;  2JU8 A;  2Q2M A;  2M4L A;  1KGL A;  1LIE A;  3WJB A;  4XME A;  3PQU A;  5HGL A;  4FGI B;  2IFB A;  3FEK A;  4N7C A;  1X8N A;  5D8J A;  4BVM A;  2BT9 A;  1RLB E;  2MWH A;  4LQZ A;  2EIA A;  3CXC O;  2KTS A;  3S60 A;  1K30 A;  3G26 A;  1A2D A;  1BBP A;  1M6E X;  3B2I A;  5B29 A;  5HZ5 A;  3LRY A;  4XMH A;  3PEC A;  1IKJ A;  1ALB A;  3G4S P;  4GK9 A;  2JW1 A;  2FWV A;  1LID A;  4IB6 A;  4WHI A;  3WBG A;  3ZW1 A;  1YWD A;  4O3Z A;  1SA8 A;  2JU7 A;  1GX9 A;  1G85 A;  1X8U A;  2NP1 A;  4ORS A;  3PP6 A;  2PEN A;  4TQ2 A;  1KT4 A;  1KQX A;  5AJB A;  1CJ5 A;  1JJ2 O;  1KOI A;  3UEV A;  4AZP A;  1CBR A;  2WSJ A;  1YUP A;  3APU A;  5LJC A;  4GR6 A;  5HTD A;  3WBH A;  3U0D A;  4L1N A;  2LBA A;  2MM3 A;  4YGZ A;  1DZK A;  3G28 A;  3BSZ E;  3EBW A;  1XKI A;  3HWG A;  1MVG A;  1QVG O;  1ICN A;  1YIV A;  3BLG A;  4MIS A;  3T1D A;  2ASN X;  4IAW A;  4IBA A;  4DQ4 A;  1MDC A;  2OTJ P;  2OVS A;  3CCR P;  3CQR A;  3G1I A;  1SXU A;  2G79 A;  5EDB A;  3ZW2 A;  2L5P A;  4I3D A;  1GT1 A;  3Q20 A;  1A57 A;  1YWB A;  2OTL P;  4ZFX A;  5BYP A;  4QZU A;  1HQP A;  2FR3 A;  4BQU A;  3P24 A;  4WFV A;  3H0D A;  3GE2 A;  1DFV A;  1G7N A;  4A1Y A;  5C0N A;  4U9C A;  5FQ8 E;  2Z46 A;  3HZQ A;  5F58 A;  3G6E P;  1RBP A;  2RCQ A;  5LJE A;  5L8N A;  3APX A;  1ZNG A;  2W2B A;  2CWO A;  3STN A;  5F7G A;  3ZUI A;  5FFH A;  3KQ0 A;  2A2U A;  5BVT A;  3KFH A;  4Y0P A;  4ORY A;  3EMM A;  1PM1 X;  3MBT A;  4O4O A;  1AVG I;  2OFM X;  3WJD A;  3CCV P;  4O3X B;  1BLR A;  1OEJ A;  3B2L A;  4QAE A;  2BS5 A;  3WJF A;  2BHV A;  3SOT A;  2KD2 A;  3E3C A;  1U17 A;  4XRO A;  4IB8 A;  1M74 A;  1KD1 Q;  4ORX A;  3ZI8 A;  4ZH9 A;  1YJ9 P;  1S72 P;  2A0A A;  4WFU A;  1YJN P;  4AYH A;  4TNN A;  5D4A A;  1SY1 A;  1GM6 A;  2RQ0 A;  2PEQ A;  4LKP A;  1K9M Q;  1Z24 A;  4ZHD A;  1ADL A;  4HPA A;  1A3Y A;  1LIB A;  3G71 P;  2BUO A;  4YKO A;  5LJG A;  3UEU A;  4ALB A;  4ALO A;  2RN4 A;  2XT1 A;  4HPC A;  5I4T G;  5KHP A;  2A2G A;  3CC7 P;  3CPW O;  3APV A;  4GNY A;  2PEO A;  4NYQ A;  1B4M A;  4M0I A;  4OS3 A;  1MUP A;  2LFO A;  5JR8 A;  2L68 A;  3CCU P;  1YIJ P;  1FEL A;  2QO4 A;  2JMB A;  1QY0 A;  1PMP A;  1X89 A;  3ELX A;  2E1M A;  4YCE A;  3NX2 A;  3CCM P;  4QGX A;  3ZWE A;  5EDC A;  1EPB A;  2NNE A;  1E5P A;  2HNX A;  2X8T A;  5HZ8 A;  3DTJ A;  3P6E A;  2EFJ A;  4ORU A;  5HGN A;  3S5V A;  4MVK A;  4NP1 A;  4U8U M;  1A18 A;  4K19 A;  2HYS A;  3RWX A;  1LIC A;  2WQA E;  4YBU A;  2CBR A;  4EDE A;  4XMD A;  3CD6 P;  3VU1 A;  2X8S A;  3CBS A;  2YG2 A;  1EIA A;  3BX7 A;  4YFR A;  4YGH A;  2PEM A;  2OFR X;  4O49 A;  3P6H A;  3FEN A;  4AZR A;  3BS2 A;  3G29 A;  2BLG A;  3CCS P;  3N91 A;  4O4S A;  5HZ6 A;  3C76 X;  1LIF A;  3APW A;  3GAQ A;  3D4R A;  4M6S A;  1KT5 A;  4A60 A;  1D2U A;  3HOL A;  2FS6 A;  4TKH A;  4GRJ A;  4I95 A;  4ZGF A;  5F6Z A;  4AZQ A;  3P6G A;  4XRQ A;  1JJJ A;  3FA8 A;  1RNI A;  3NR3 A;  2HMB A;  3ZW1 B;  2Q39 A;  1G74 A;  2G7B A;  3DSZ A;  1VQ9 P;  5LJB A;  3KFF A;  4CV7 A;  3H4E A;  1X71 A;  3HK1 A;  5D45 A;  2HLV A;  1I06 A;  3OE3 A;  1CBQ A;  1LNM A;  2K23 A;  1FEM A;  1OBQ A;  5F6B A;  1BSQ A;  3OJY C;  2QO5 A;  2LKK A;  2ACP X;  1SY3 A;  1VQN P;  1O8V A;  1URE A;  3OBL A;  4MVL A;  2GTL O;  3WVM A;  1M1K Q;  4ON1 A;  2NNQ A;  3PH5 A;  1QFV A;  2AT0 X;  1A43 A;  5KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...