2BHVA

Structure of comb10 of the com type iv secretion system of helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
191
Chain Sequence
NKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPRENEVIAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMB10
publication title Structures of Two Core Subunits of the Bacterial Type Iv Secretion System, Virb8 from Brucella Suis and Comb10 from Helicobacter Pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Bacterial protein
total genus 39
structure length 191
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03743 TrbI Bacterial conjugation TrbI-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.160 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2bhvA02
2.40.128.260 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bhvA01
3JQOA 2BHVA
chains in the Genus database with same CATH superfamily
4QAEA 3BX8A 4IMNA 1ZRYA 3WOVA 2XXMA 2OL8O 1OPBA 1SWTA 1RNIA 5LJEA 2A2GA 3SLTA 3LV4A 3CC2P 2WPUA 3TF6A 4GKCA 2RTOB 2WQAE 1LF7A 3ZW0B 1QFTA 3HPEA 2PEQA 4ML7B 4ZGFA 4ID2A 1RXKA 3F9DA 5LJHA 1H91A 2Z45A 2OTLP 2AFEA 2X8SA 1QWDA 1DZPA 1SRFA 3RG2A 2GJ5A 3CMAP 5L8NA 3FR4A 2Z4HA 4O3YA 2PEKA 1AVEA 1VWOB 3OE3A 1GT3A 1EUOA 2JMBA 2O62A 2X32A 3T2WA 3OJYC 4GGRA 2AF5A 1GT5A 4GRJA 2OFBA 1B4MA 4GU8A 1VWKB 4DQ3A 1JJUA 1PMPA 2KWLA 4GJSA 2A2UA 3NQ9A 1LCVA 1VWMB 3SZIA 1MUPA 4HKGA 1BRPA 5HCCC 1E5PA 4YBUA 4GZVA 1JJJA 5HA0A 5EJDA 4H2XC 4R0BA 2PEIA 4F37A 1B8EA 1E00A 2X2BA 1K73Q 2Q2PA 3SZHA 4MVEA 3NPOA 1SLEB 2LPKA 1KQWA 3B2KA 2W2BA 1BXIA 1YITP 3SZJA 1VWFB 4O4OA 4YFRA 2C4IA 2A5CA 2NNDA 5KP6B 2BC3A 1GXGA 3EJEA 1N9YA 5DPQA 1IKJA 1AVGI 5F2KA 2RTPB 1JYJA 2X46A 4IMOA 1AQBA 1KL3A 2LIUA 3RG6C 3S5XA 3BU1A 4LZVA 1LICA 5KHPA 4UHPB 3RDXA 1M74A 1G5WA 4WFVA 4O4UA 1MDCA 2GZIA 4ALOA 1KT6A 3ZUIA 3P6FA 3VU1A 2AT0X 2G8CO 5H9LA 3P6CA 3CXCO 2CAMA 1VQMP 1U0XA 4HPAA 1RO2A 1FEMA 3E2DA 4EKVA 3VG5A 1JMXA 1RSUB 2AMMX 2K0DX 4NLJA 3RDMA 4NLIA 1SA8A 1SRIA 1SLFB 1GX8A 1AB0A 2K5XA 2RTHB 3EM0A 4YGGA 4ARHA 1FENA 2KTDA 5FFHA 3CPWO 1EPBA 1SRHA 1X89A 1ACDA 1ZNLA 3GZMA 2CM4A 3BU9A 3VHMA 2KGCA 2L9FA 2A13A 2M5RA 2X56A 4I3CA 4YFQA 1SWEA 4CPHB 2CNRA 1YWDA 2RTJA 5HCEC 1N43A 1EXSA 1OEEA 4GUZA 2WEWA 1JZUA 3EBKA 5FAZA 1YWBA 3KVNA 2BS5A 3NTEA 4BX6B 3TGAA 3LHNA 2XSTA 3G1IA 2Q9SA 4ORSA 1T0VA 3QQ2A 2EIAA 1BLRA 2AF8A 3VHHA 1VWLB 4YMYA 1RXJA 1VQNP 1O8VA 1DV9A 1STRB 4AW8A 4AZQA 4GR6A 4GNYA 2VLOA 2QMIA 3PDFA 3G6EP 5HZ6A 3CC7P 4U0AA 2ROQA 2L67A 5D47A 2HMBA 3DS0A 4RUNA 4WFUA 1LFOA 4Z27A 1VQ9P 3NQ3A 3G71P 2RTIB 4XFXA 3NQKA 3OBLA 2VFCA 4CSBA 3ZWEA 2NNEA 3TZSA 2F01A 2OVAA 1HY8A 5BVQA 5FQ6E 2IZDB 3WJEA 1KZXA 1K30A 1NP1A 1JJ2O 3Q6LA 1S72P 3VHIA 2MF4A 4IB7A 1SRGA 4HFOA 2AKQA 2FVAA 2GZGA 1HXLA 3APXA 2IZEB 3JSQA 3B5IA 5JPAA 4ZHFA 4OS8A 3FA7A 3KFIA 4HWMA 2N98A 1NC9A 4AZRA 1TOUA 2A5BA 3AEHA 5KIDA 1AELA 5F7GA 2Y3FA 2XKLA 2KGDA 1VWDB 1N8RQ 5IRAA 1HXZA 1YUPA 3KZAA 4XFZA 1TOWA 1SWPA 2VLPA 2GTLO 2GDWA 5LKFA 3P05A 3F8AA 3GKLC 1UJZA 1SWQA 5HGNA 3VG4A 1VWRB 2EHTA 1DF8A 2HZRA 1E2TA 3NADA 2CQ8A 1I9HA 3JQOA 1Y0GA 4PJ2A 2C1SA 2K23A 4A60A 4GDZA 5CZDB 1DFVA 2N93A 2DGYA 5HGLA 3P6DA 1VWJB 1OBQA 1FTPA 3VG3A 5KP7B 3BDRA 4QYPA 4PSQA 3RDOA 3T6FA 1LDQA 1D2UA 1W4TA 2QOMA 4I3DA 4Y59A 1GKAA 3UEUA 5LKEA 1X3OA 1DZMA 5HV8A 1KZWA 2M8PA 1L0IA 2ZSCA 3NX2A 3JS1A 1BJ7A 5HWZA 4HPBA 2EU7X 1VKUA 2KGAA 5F6BA 3BSZE 3OW2O 4IAWA 2EFJA 4BCSA 5F1EA 4I9SA 2CM9A 2KW2A 3SLJA 1VWBB 3WJGA 4XMDA 5H9NA 4GGZA 1UREA 3ZUOA 2RTDB 4O4SA 3U0DA 1CBIA 3B2IA 3DS3A 3D97A 2YMSA 2XZ1C 5F2NA 5CYBA 2GDYA 4I60A 3G21A 3SOTA 2IZAA 3ZQ3A 2ZAIA 4QYNA 1ML7A 2CZUA 1KL4A 1KXOA 1YP6A 3FR5A 1N0SA 2QEXP 2BLGA 3CCVP 3V8UA 3LTWA 4ODDA 3UEVA 2A3FX 1EI5A 4FBOA 3I17A 2IZJA 3AKMA 1W2BO 1BM5A 3CR6A 2FS7A 2LFOA 4LZUA 2RCTA 2LA7A 1UNKA 2BSZA 3KFHA 2OVSA 3WJCA 3H3IA 3I0AA 2L4BA 4Y5DA 2I5ZO 1Q7YQ 4XFYA 3VE1A 1IUQA 4AZMA 3D4RA 1MX7A 3HOEA 2LOLA 3FR2A 2GTLN 5IO7A 1JV4A 1ZNEA 4CPFA 4N7DA 3CCSP 4EXZA 2FR2A 4HPCA 4QGWA 2RTAA 3X00A 4QRLA 1EQDA 2LMLA 3WZOA 4A1HA 3EJBA 5EPQA 3WZPA 1JQPA 2K94A 1KQXA 2OZQA 5HZ8A 4CV7A 2JOZA 4C5PA 3B2LA 5LJGA 2LKIA 4CPIA 4HPDA 3VG7A 2L9CA 1FR2A 1EIIA 3EW1A 3FIQA 3ELZA 2XZ0D 5FENA 4IZ6A 2FLJA 2K62A 4EQAC 3G0VA 3FW4A 4ORYA 3RSWA 1DF3A 2Z46A 2GH7A 5HZQA 2FQ1A 1QVGO 3DS4A 4O3WA 1KL5A 1WUBA 1GXAA 1TW4A 2KORA 3P02A 2QM9A 2WWPA 4L1NA 3FA8A 4TJZA 2FHLA 1MVGA 2RTKA 4OELA 1U17A 1UYNX 1RXHA 1QY0A 4PWVB 2K0YA 1VQLP 1EPAA 2Z44A 3AKNA 3I56P 1X8NA 1GX9A 2P9XA 3CD6P 2JGPA 1I4UA 5C0NA 2GDXA 1A2DA 4AZNA 3MBTA 1OEJA 1DZJA 4QKOA 2OY7A 1MX8A 4IPYA 5EDCA 2QNWA 5HCDC 1JMZA 2EHSA 1LNMA 1SWGA 2R74A 2JQ4A 2LTEA 3APVA 1HMSA 2ACPX 3DS1A 1VQPP 5EEEA 4K19A 4U0BA 4Y0RA 4BX5A 1VQ6P 1YWAA 4YBPA 1ALBA 2L22A 1LKEA 4GETA 1RBPA 1PEEA 4GDAA 2FADA 3F6ZB 3DTJA 3DPHA 1U18A 3FA9A 1GGLA 4NYQA 3CCRP 4GD9A 3P6HA 3WJBA 1BWYA 4N7CA 2Q4NA 1IW2A 4U0FA 1VQ8P 3DS5A 2XT1A 2NO8A 2RTMA 3PP6A 1ACPA 1HBPA 2OFMX 2WUTA 4M7MA 4CDCA 1PBYA 1JYDA 2GZFA 2RQ0A 3RZYA 4KC7A 4BOEA 4O9SA 3MVFA 1ERXA 3M1MA 2PY1A 1VPRA 3HWGA 2CBRA 2MVUA 1KT7A 2N6YA 1FJ1E 2PEJA 2L68A 4H2YC 5IRWA 1HY2A 3Q20A 2L6EA 1YIJP 2NNQA 2MWHA 2JU8A 2KW1A 3HWFA 1XKIA 4QGVA 4FBRA 3GAQA 2JBGA 1MM9A 2FHNX 2RA6A 2LB6A 5F58A 2DJGA 2X34A 1LIEA 1A43A 2L5PA 1SXYA 5KICA 2MHDA 4ZHHA 2JU1A 2PNGA 3Q34A 2P8GA 1M1KQ 3BY0A 4BPHA 2LBAA 4CK4A 2RTCB 1MZ8A 1UZ2X 1ERBA 2OVEA 5LJCA 2UZ2A 3G7XA 3PPTA 1VQ4P 3K3LA 2RTRB 1CBRA 1I78A 5FQ8E 3PECA 1Q81Q 3ZW1A 2MR7A 1EW3A 5IRUA 3WJDA 4A1YA 1YP7A 4BX7A 4FGIB 2BT9A 4ES7A 2ERHA 5FQ7E 2AH7X 4AZOA 3VRLC 4WYMA 5B29A 5LJDA 1AYIA 3DS2A 2JW1A 1KT5A 3VGWA 4CDDA 3CCMP 3B4QA 2JN3A 1R0UA 2M8NA 1W5RA 3VG2A 4ZH9A 5K68A 4TKBA 2GTLM 2OF9A 3CMPA 4XMFA 1RAVA 5D4AA 4COPA 5BVSA 4QZTA 1SWCA 1BEBA 3S60A 1ZMBA 1M6EX 2PENA 4YCEA 1LCZA 3CCJP 4IB9A 4MIRA 2VLQA 5B5FA 1BAJA 3KFFA 4ZHCA 1X71A 1SWBA 1K3BA 4PH1A 2E1MA 3FELA 1K8AQ 2QO4A 3NBXX 1ZNKA 3EYCA 3KQ0A 4TKHA 4EFGA 4YKOA 1IMPA 4TQ2A 4OMWA 2Q39A 1DC9A 4MVLA 4NV8A 3OD9A 2DM5A 4ORUA 1CBSA 2DJFA 4Y0SA 3TGBA 4BVMA 2AVAA 1KD1Q 2F73A 3PQSA 2Q2MA 4H2WC 5B11O 3CCEP 2GC9A 1X8PA 2IZLB 3STMX 5CSEA 1A3YA 3WJFA 3B2HA 4ON1A 1K9MQ 2UYWA 4O49A 4IRWA 1BSQA 1IKEA 1E06A 4IB6A 4BBOA 2Y3EA 5B10O 2ZAGA 4PH0A 2RTLA 5B27A 3UEWA 1OEKA 2FWVA 3APWA 5AJBA 4R0MA 2HNXA 2OARA 5HTDA 3ZW0A 1RSTB 1ICMA 2R56A 3CKFA 3WYPA 3BRNA 4Y0QA 1X8OA 1VYGA 2LBVA 3FW5A 1JJXA 2FKGA 1SXWA 5K67A 3C78X 2KOSA 3RDQA 3H0DA 2G79A 2OYBO 1OPAA 4QZUA 4U8UO 3U03A 2QO6A 1QY2A 3ZI8A 3KFGA 5L3YA 4O3XB 4INNA 5I4TG 3GJNA 4KIIA 3BX7A 1KFFA 1KLPA 2GTFX 3RDSA 1HMRA 1A8OA 2CWOA 2HLVA 1OSPO 4Y0PA 5HTEA 1NBXA 5F2BA 5DCKA 5EDBA 2KOQA 3HYBA 2JB0A 2FGSA 2IZCB 2MD9A 1HQQA 3G4SP 4ZGUA 5HZ5A 2ASNX 2RD7C 1LUQA 1YJWP 1SXUA 2VSQA 3CCUP 5F2OA 1FDQA 4Z28A 2VDFA 3O22A 1SWSA 2C1QA 3HWDA 5JR8A 1HN2A 5EEDA 2PEMA 3STKA 2EG5A 2JYGA 2AFDA 3PQUA 2OY8A 2K0XA 1ZNDA 1GT1A 4I95A 1LIBA 5H9KA 2IFBA 1QRJA 2K92A 3L4RA 1VWGB 1L0HA 3EC5A 3SAOA 4Z2VA 1N9MA 3CBCA 3APUA 1VQ5P 2KR5A 1Y55X 1VWNB 1Y9TA 4DCBA 3IFBA 5IXGA 5CHKA 4XMHA 2OL7A 1YJNP 1BSYA 3U9PC 3I55P 1VQOP 3H47A 2MO5A 4MRTC 3B2JA 3UEXA 1ADLA 1KT3A 2FS6A 2QCBA 2POAA 2RTNB 4BPGA 5IO6A 4JHQA 3NR3A 3BS2A 2RCQA 4ZFXA 2WPTA 3PK2A 1X8UA 3MGEA 1A18A 2OFRX 3RE6A 2KTSA 3FLLA 3RKGA 2N6ZA 3RWXA 2G5LA 1CRBA 1SWUA 1GPJA 2KOOA 3CCLP 1AF8A 4DG9A 5LJBA 4L3RA 4ZHGA 3FMZA 2N5HA 1D1DA 3MM0A 1QFVA 1M6NA 4CPHA 1ICNA 1KGLA 3LMOA 3GE2A 1VQKP 4OS0A 2DNWA 1TXLA 4QGXA 4KH8A 3O19A 2YG2A 1HMTA 4BX6A 2Z4IA 2MJIA 2FR3A 2FKJA 1SWJA 2AT8X 2GYKA 1LDOA 4TKJA 1EIOA 2LF4A 2CGQA 1MK5A 1NP4A 4XMGA 7CEIA 2X55A 1MEPA 3CMEP 4U0CA 5L8OA 4U8UN 2RTGB 2BHVA 2FAEA 1NJIQ 4GGTA 3RY1A 4Z2PA 2IZGB 1SWNA 5BVTA 2QOSC 5LJKA 4QNBA 5B2AO 4JGLA 2WEXA 1OBPA 2X8TA 3CQRA 1LIDA 2G78A 4CA3A 2FHSC 3FA6A 1HQBA 2FQ0A 4YH0A 2IZKA 4U3QA 3EJDA 4NP1A 1K24A 2AL0X 2LKKA 4IBAA 1ZNHA 3CE7A 3WBGA 2BUOA 1STSB 2FVFA 5EW5E 4AZPA 3P6GA 2RTEB 4U0EA 3ELXA 1IIUA 1A57A 2MF6A 1SLGB 4I6SA 3SLOA 1GKAB 1S2PA 1G74A 3QKGA 4KT5A 3ZZVA 1UYOX 3MG5A 4MEEA 4O4XA 2N50A 4RUUA 3FENA 5HGMA 3C77X 3NP1A 1KQSO 1OBUA 4YGHA 2GZEA 2OVDA 1VWEB 4NV7A 3PH6A 3D9WA 1P6PA 5HZ9A 4CDFA 4O3ZA 2AT6X 5KP8B 2NP1A 1YJ9P 2PI3O 2K93A 1IJ8A 4DNEA 5AJCA 2X45A 2K2QA 1JBHA 1SWOA 4YCHA 4M0IA 2KD2A 5D8JA 1M90Q 1NQMA 1PBOA 5EZ2A 2RN4A 4YDAA 4OKAA 1SWDA 3WYQA 3S26A 2FVEA 2IZHB 5B3MO 2CZTA 1HQPA 1DV5A 1LELA 1BBPA 4U46A 3FIDA 1N4JA 4JO6A 3WZQA 2VFBA 2FACA 2I5VO 1QG5A 4COTA 1OR5A 2JO0A 1DNYA 1GX3A 2WSJA 4ALBA 3CKGA 3FYFA 4ORWA 2ACOA 1SREA 1FE3A 1BRQA 1GT4A 3FEPA 3HWEA 1SWRA 1VYOA 1Y52X 3MX7A 4NNTA 1S7DA 4ZJ0A 3CCQP 1YI2P 1YHQP 2OL6O 1VWPB 4BJ8A 1QVFO 1I05A 4GH7A 4YVBA 1LCWA 2CG5B 2HKDA 3DTQA 3H4EA 4B55A 5HAEA 4OEMA 3WZNA 4IABA 2L0QA 2IZFB 1PTSA 4NW4A 3NY7B 4GR2A 4EEJA 1VWIB 5CE4A 4AYHA 2ANSA 1SY3A 2N5IA 2FRSA 2IZBA 5AQ6A 3EW2A 3HZQA 5D48A 4ZCBA 1SWAA 2WQ9A 3EBWA 1Y9LA 2X8FA 1Q82Q 2LL8A 2X4MA 2RTQB 2JU3A 1O1VA 2KODA 1E02A 2G7BA 3C76X 4ORXA 1VWAB 1Q86Q 3NX1A 2FT9A 4UU3A 1VWCB 3CWKA 1QQSA 4XMCA 2MR8A 3RY2A 3T6LA 4GNWA 1VWHB 1EOQA 3HK1A 3P24A 4NNSA 3TGCA 1AVDA 4WHIA 4COCA 1MOYA 3VG6A 2A8GA 4U0DA 3HOLA 1WBIA 4DQ4A 1D3SA 4ZHDA 1BSOA 1T8VA 1YIVA 3CC4P 1L6MA 4GE1A 3CBSA 3D96A 4JNJA 4ORRA 4U8UM 5B5GA 2KOPA 1TVQA 2MVVA 2IZIA 1X8QA 1SXXA 4D6BA 2BS6A 1Z24A 5IO5A 5H8TA 4CDEA 1SLDB 1VQ7P 4NEOA 2JAZA 5K06A 2R73A 1HBQA 2JYLA 2WR6A 4ZH6A 2PEOA 5DG4A 1EIAA 3UAQA 4BX5B 1W6FA 5F6ZA 2CBSA 1GM6A 4M6SA 5HGOA 2M4LA 1IMQA 4PXHB 5HVCA 2RTFB 4MISA 1SMPI 1VYFA 3GZLA 4XRQA 2KG6A 1ZNGA 3G28A 4YFPA 2GZJA 4OS3A 1I06A 3FDCA 3WXQA 5BYPA 2XV6A 2RTBB 1ZNVA 3VPJE 2KT4B 4UU2A 4Z6JA 4IB8A 3LRYA 4MVKA 1VHNA 1IFBA 2LIWA 1CJ5A 4I9RA 1PM1X 2JGSA 1LIFA 3RE5A 5BS2A 3G26A 1NQNA 2MY5A 1T68X 3E3CA 4FQBB 3WBHA 4ZR2A 2OTJP 3RBYA 1QY1A 2AT3X 1KT4A 4TLJA 2AVIA 4A8ZA 4CPEA 4MVIA 1YWCA 4NYRA 3DSZA 5BS1A 1SWLA 5AEOA 1O1UA 1NQ4A 3T2XA 4Z2OA 4YKMA 5H9AA 3AUMO 2W2FA 4FBVA 1SWKA 3ZW2A 3VE2A 1AUMA 1JIWI 3S5VA 1S44A 1Z6MA 3BLGA 2OFAA 2KGEA 3FEKA 2JU2A 2ALLX 4QQ1A 1SY1A 3U43A 3STNA 1QABE 1SWHA 2F09A 4BGFA 3P6EA 1SY0A 1E6JP 1GXHA 3G1GA 1B56A 2MM3A 3T1DA 3ZW1B 2HYSA 4GJVA 4KC8A 5D45A 2KG8A 1IFCA 2KG9A 5HA1A 4BX7B 1N7YA 1NGLA 4U9CA 2QA4P 1SY2A 3O2YA 1Y53X 1VWQB 3N91A 3EMMA 1CEIA 4I3BA 4YDBA 2M8LA 4YGZA 2OY1O 1B0OA 1KOIA 4XMEA 3RDUA 1E0HA 2OF8A 4D6AA 4XROA 4BQUA 5JD2A 4OMXA 1CBQA 4QNIA 1SRJA 3D95A 1EMVA 5HBSA 2HZQA 2FTBA 2JU7A 4EDEA 1G7NA 1FELA 3G29A 1G85A 3HTYA 1LPJA 4BPFA 2VLNA 1I04A 1STPA 1EALA 3PH5A 2QO5A 2PY8A 4WBKA 3WVMA 3CQNA 2FQ2A 2OY5O 1XCAA 3PEDA 2W2AA 4TNNA 2A0AA 1F80D 1SWFA 4LQZA 1KC8Q 1RO0A 5L8IA 2AT5X 4IAXA 4GK9A 4KCAA 2ONTA 2E4JA 1NDJA 1RLBE 3IA8A 4LKTA 1DZKA 2Y32A 1T8KA 4LKPA
chains in the Genus database with same CATH topology
4HPBA 4M0IA 2EU7X 4PH1A 2KD2A 4QAEA 2E1MA 5D8JA 3FELA 3BX8A 4IMNA 1ZRYA 3WOVA 1K8AQ 1M90Q 2XXMA 1PBOA 2QO4A 3NBXX 5F6BA 1ZNKA 3EYCA 2RN4A 5EZ2A 1OPBA 3KQ0A 3BSZE 4YDAA 4TKHA 1RNIA 4EFGA 2A2GA 5LJEA 4YKOA 3OW2O 4IAWA 2EFJA 5F1EA 4I9SA 3LV4A 4TQ2A 4OMWA 3CC2P 2CM9A 3TF6A 2Q39A 3S26A 1DC9A 4GKCA 2WQAE 4MVLA 1LF7A 3OD9A 3ZW0B 2DM5A 4ORUA 1CBSA 2CZTA 4XMDA 3WJGA 5H9NA 1HQPA 1QFTA 4Y0SA 2PEQA 1BBPA 1UREA 3ZUOA 4ML7B 3TGBA 4O4SA 4BVMA 3U0DA 1CBIA 4ID2A 4ZGFA 3B2IA 3DS3A 1KD1Q 3D97A 1QG5A 2F73A 2YMSA 3PQSA 2Q2MA 3F9DA 4COTA 5LJHA 5F2NA 5CYBA 1H91A 2Z45A 2OTLP 2JO0A 3G21A 2X8SA 1QWDA 2WSJA 4ALBA 1DZPA 3SOTA 3CCEP 2GC9A 1X8PA 3FYFA 3STMX 4ORWA 2ACOA 1A3YA 2GJ5A 3CMAP 3B2HA 3WJFA 3FR4A 2Z4HA 5L8NA 4O3YA 1FE3A 2PEKA 1BRQA 1GT4A 3FEPA 3HWEA 4NNTA 1K9MQ 4ON1A 3MX7A 3OE3A 3ZQ3A 1GT3A 1S7DA 4ZJ0A 4O49A 3CCQP 1YI2P 1EUOA 2ZAIA 2JMBA 4QYNA 1YHQP 1ML7A 2CZUA 2O62A 1BSQA 1IKEA 1E06A 3OJYC 4IB6A 1KXOA 1QVFO 1GT5A 1I05A 1YP6A 3FR5A 1N0SA 2ZAGA 4PH0A 4GH7A 4GRJA 2QEXP 5B27A 3UEWA 2BLGA 1B4MA 3DTQA 3CCVP 3H4EA 1OEKA 2FWVA 3APWA 4GU8A 3V8UA 5HAEA 5AJBA 4DQ3A 4IABA 2HNXA 2OARA 4ODDA 5HTDA 1PMPA 3UEVA 2A3FX 3ZW0A 2A2UA 3NQ9A 1EI5A 1ICMA 2R56A 4NW4A 4FBOA 3I17A 4GR2A 1MUPA 4EEJA 3BRNA 1BRPA 3AKMA 1W2BO 4Y0QA 5CE4A 1BM5A 5HCCC 1X8OA 1VYGA 2FS7A 2LFOA 3CR6A 3FW5A 2LBVA 4LZUA 1E5PA 4YBUA 4GZVA 1JJJA 4AYHA 2ANSA 2RCTA 5HA0A 1JJXA 2LA7A 1SY3A 1SXWA 3C78X 2FRSA 3KFHA 4R0BA 2PEIA 2OVSA 1B8EA 1E00A 5AQ6A 3HZQA 3H0DA 2G79A 3H3IA 1K73Q 1OPAA 2Q2PA 4QZUA 4MVEA 3NPOA 4U8UO 2QO6A 5D48A 3U03A 3I0AA 4ZCBA 1KQWA 1QY2A 2WQ9A 3EBWA 3ZI8A 3B2KA 1Q7YQ 4XFYA 3VE1A 1Y9LA 2W2BA 2X8FA 3KFGA 1IUQA 1YITP 1Q82Q 4O3XB 4AZMA 4INNA 5I4TG 2JU3A 3D4RA 1O1VA 2KODA 1E02A 4KIIA 1MX7A 3BX7A 4O4OA 2G7BA 2GTFX 3C76X 4YFRA 3HOEA 4ORXA 3FR2A 1Q86Q 2GTLN 2NNDA 5IO7A 3NX1A 1JV4A 1ZNEA 2FT9A 4UU3A 1HMRA 4N7DA 1A8OA 2CWOA 5DPQA 3CCSP 2HLVA 1IKJA 3CWKA 1QQSA 4EXZA 4Y0PA 5HTEA 1AVGI 5F2KA 4XMCA 1JYJA 5DCKA 4ARHA 5EDBA 2X46A 4IMOA 3HYBA 1AQBA 2FR2A 4GNWA 3RG6C 1EOQA 3HK1A 3S5XA 4HPCA 3P24A 3BU1A 4LZVA 4QGWA 4A1HA 1LICA 3G4SP 1EQDA 4NNSA 4QRLA 4ZGUA 5HZ5A 3TGCA 2ASNX 2RD7C 5KHPA 1YJWP 5EPQA 1SXUA 3CCUP 4WHIA 5F2OA 1FDQA 1M74A 4COCA 1G5WA 4WFVA 3O22A 4O4UA 3VG6A 1KQXA 4U0DA 3HOLA 1MDCA 3HWDA 4DQ4A 5JR8A 2OZQA 5HZ8A 1D3SA 4CV7A 2JOZA 4ZHDA 1BSOA 1HN2A 3B2LA 1T8VA 4ALOA 1KT6A 5EEDA 1YIVA 5LJGA 3P6FA 3ZUIA 3VU1A 2PEMA 4HPDA 3CC4P 1L6MA 2AT0X 2L9CA 4GE1A 3STKA 3VG7A 1EIIA 3CBSA 2EG5A 3D96A 2JYGA 5H9LA 3P6CA 3PQUA 3CXCO 1VQMP 3FIQA 4ORRA 1U0XA 3ELZA 4U8UM 4HPAA 1ZNDA 1GT1A 1RO2A 5FENA 4I95A 1LIBA 1FEMA 2FLJA 3E2DA 1TVQA 2K62A 5H9KA 2IFBA 1X8QA 4EQAC 3G0VA 1QRJA 3FW4A 3WJCA 1SXXA 4ORYA 3VG5A 4D6BA 3L4RA 2BS6A 3RSWA 1DF3A 2AMMX 3SAOA 1Z24A 4NLJA 5IO5A 4NLIA 5H8TA 1SA8A 2Z46A 3CBCA 5HZQA 1VQ7P 1QVGO 3DS4A 3APUA 4O3WA 1VQ5P 1GX8A 1AB0A 5K06A 2R73A 1HBQA 3EM0A 2JYLA 4YGGA 1FENA 1GXAA 2KTDA 1TW4A 2PEOA 1Y9TA 2WR6A 5DG4A 4ZH6A 5FFHA 3P02A 2QM9A 3IFBA 1EIAA 3CPWO 2WWPA 4L1NA 3FA8A 1EPBA 1X89A 3UAQA 4TJZA 1ACDA 1ZNLA 2CM4A 4XMHA 3BU9A 1MVGA 1YJNP 1BSYA 2CBSA 5F6ZA 2A13A 3U9PC 1GM6A 3I55P 1VQOP 3H47A 4M6SA 4I3CA 1U17A 2MO5A 4YFQA 1QY0A 1YWDA 5HGOA 5HCEC 2M4LA 1VQLP 3B2JA 1EPAA 3UEXA 2Z44A 1ADLA 1KT3A 3I56P 1EXSA 1X8NA 2FS6A 1OEEA 3AKNA 2POAA 1SMPI 4MISA 1GX9A 5IO6A 2P9XA 2WEWA 1VYFA 1JZUA 3CD6P 4XRQA 1I4UA 3NR3A 1ZNGA 3G28A 3BS2A 3EBKA 4OS3A 4YFPA 5FAZA 5C0NA 1YWBA 1I06A 2RCQA 4ZFXA 2BS5A 3WXQA 3NTEA 5BYPA 1X8UA 2XV6A 3MGEA 1A18A 3TGAA 3LHNA 2OFRX 1A2DA 2XSTA 4AZNA 3MBTA 3VPJE 1OEJA 3G1IA 1DZJA 2KT4B 2Q9SA 4ORSA 4UU2A 2KTSA 4IB8A 1T0VA 1MX8A 2EIAA 4IPYA 3LRYA 3FLLA 4MVKA 5EDCA 3RKGA 1BLRA 3RWXA 5HCDC 1IFBA 1CRBA 1LNMA 2R74A 1CJ5A 4I9RA 3APVA 1HMSA 1PM1X 2ACPX 3DS1A 1VQPP 3CCLP 5EEEA 4YMYA 1LIFA 4K19A 5BS2A 3G26A 1VQNP 4U0BA 4Y0RA 1VQ6P 1T68X 5LJBA 1O8VA 1YWAA 3E3CA 4L3RA 4FQBB 3FMZA 4ZHGA 1DV9A 3WBHA 4YBPA 4ZR2A 1ALBA 4AW8A 2OTJP 3RBYA 1LKEA 4AZQA 4GR6A 1D1DA 1QY1A 2AT3X 1KT4A 4TLJA 4GNYA 1QFVA 4A8ZA 4GETA 1M6NA 4MVIA 1RBPA 1YWCA 2QMIA 4NYRA 1PEEA 3DSZA 5BS1A 3G6EP 5HZ6A 3F6ZB 3DTJA 3DPHA 3CC7P 1U18A 5AEOA 1ICNA 3FA9A 1GGLA 3GE2A 4NYQA 1KGLA 1VQKP 4OS0A 4U0AA 1O1UA 2L67A 5D47A 3CCRP 1TXLA 4QGXA 2HMBA 3P6HA 3DS0A 4KH8A 3O19A 2YG2A 4RUNA 4WFUA 1LFOA 4YKMA 3WJBA 1BWYA 4N7CA 2Q4NA 5H9AA 1IW2A 1VQ9P 1HMTA 4U0FA 3G71P 2W2FA 3NQ3A 4FBVA 1VQ8P 3DS5A 2XT1A 2Z4IA 3VE2A 3ZW2A 1AUMA 3PP6A 2MJIA 1JIWI 1HBPA 2FR3A 4XFXA 1S44A 2OFMX 3S5VA 2WUTA 3NQKA 3BLGA 2AT8X 3OBLA 4CSBA 4M7MA 3ZWEA 3FEKA 2NNEA 3TZSA 2ALLX 4TKJA 2OVAA 1EIOA 2LF4A 5BVQA 1NP4A 4QQ1A 1SY1A 4XMGA 5FQ6E 1JYDA 3STNA 2RQ0A 3CMEP 1QABE 3WJEA 4U0CA 3RZYA 4KC7A 1KZXA 2F09A 4BOEA 4O9SA 3MVFA 5L8OA 1ERXA 3M1MA 2PY1A 1VPRA 3P6EA 3HWGA 1SY0A 1E6JP 1K30A 2CBRA 1KT7A 4U8UN 1NP1A 2BHVA 1NJIQ 1JJ2O 2PEJA 3Q6LA 1S72P 2L68A 4IB7A 3G1GA 4HFOA 2AKQA 3Q20A 2L6EA 1YIJP 1B56A 5BVTA 2QOSC 5LJKA 3APXA 2MM3A 3T1DA 4QNBA 2NNQA 2MWHA 4JGLA 3ZW1B 2JU8A 2HYSA 2WEXA 1OBPA 3B5IA 2KW1A 3JSQA 2X8TA 3CQRA 4KC8A 1LIDA 5JPAA 3HWFA 1XKIA 5D45A 4OS8A 4ZHFA 4QGVA 1IFCA 2G78A 3FA7A 3GAQA 3KFIA 4FBRA 5HA1A 4HWMA 4AZRA 1TOUA 2RA6A 3FA6A 5KIDA 1NGLA 5F7GA 1AELA 4U9CA 2XKLA 2QA4P 2LB6A 1N8RQ 1SY2A 4YH0A 5F58A 4U3QA 3O2YA 3N91A 1LIEA 1A43A 3EMMA 1YUPA 3KZAA 4XFZA 4I3BA 1TOWA 2L5PA 1SXYA 4YDBA 5KICA 2M8LA 4YGZA 2GTLO 2MHDA 5LKFA 4ZHHA 1B0OA 3P05A 4NP1A 1KOIA 3F8AA 4XMEA 2AL0X 1M1KQ 2P8GA 2LKKA 4D6AA 4IBAA 1ZNHA 5HGNA 3BY0A 4XROA 3VG4A 2LBAA 4BQUA 3WBGA 4CK4A 2BUOA 2HZRA 1UZ2X 3NADA 1ERBA 2OVEA 5LJCA 3G7XA 3PPTA 4OMXA 1VQ4P 1CBQA 3K3LA 4QNIA 4AZPA 3P6GA 3D95A 1CBRA 4U0EA 5FQ8E 3ELXA 1IIUA 3PECA 1A57A 4I6SA 1Q81Q 3JQOA 1GKAB 1S2PA 3ZW1A 1G74A 1EW3A 5HBSA 4PJ2A 2K23A 3WJDA 4A1YA 4A60A 2HZQA 2FTBA 3QKGA 1YP7A 2JU7A 4EDEA 1G7NA 4FGIB 4GDZA 1DFVA 2N93A 1FELA 4KT5A 3G29A 3ZZVA 1G85A 3HTYA 2DGYA 5HGLA 2BT9A 4ES7A 3P6DA 1LPJA 4RUUA 4O4XA 5FQ7E 2AH7X 4AZOA 3FENA 5HGMA 3C77X 3VRLC 4WYMA 5B29A 3NP1A 1KQSO 1OBQA 5LJDA 1I04A 3DS2A 2JW1A 1EALA 1KT5A 1OBUA 3CCMP 3PH5A 2QO5A 2PY8A 1FTPA 4WBKA 2JN3A 4YGHA 3VG3A 1R0UA 3WVMA 3CQNA 2OVDA 2M8NA 3VG2A 3BDRA 4ZH9A 4TKBA 3PH6A 1XCAA 2GTLM 3PEDA 4QYPA 1P6PA 2W2AA 3CMPA 4PSQA 4XMFA 5HZ9A 4TNNA 5D4AA 4COPA 5BVSA 2A0AA 1D2UA 4QZTA 4LQZA 4O3ZA 1BEBA 2AT6X 2NP1A 3S60A 1KC8Q 1ZMBA 1YJ9P 1M6EX 1RO0A 4I3DA 5L8IA 2PENA 4YCEA 1GKAA 2AT5X 4IAXA 3UEUA 4GK9A 3CCJP 4IB9A 4KCAA 5LKEA 2ONTA 4MIRA 1DZMA 5AJCA 2E4JA 1KZWA 2X45A 2M8PA 1RLBE 3IA8A 1JBHA 4LKTA 1DZKA 1BAJA 3KFFA 4ZHCA 3NX2A 4LKPA 3JS1A 1X71A 1BJ7A 5HWZA 4YCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQO A;  2BHV A; 
#chains in the Genus database with same CATH topology
 4QAE A;  3BX8 A;  4IMN A;  1ZRY A;  3WOV A;  2XXM A;  2OL8 O;  1OPB A;  1SWT A;  1RNI A;  5LJE A;  2A2G A;  3SLT A;  3LV4 A;  3CC2 P;  2WPU A;  3TF6 A;  4GKC A;  2RTO B;  2WQA E;  1LF7 A;  3ZW0 B;  1QFT A;  3HPE A;  2PEQ A;  4ML7 B;  4ZGF A;  4ID2 A;  1RXK A;  3F9D A;  5LJH A;  1H91 A;  2Z45 A;  2OTL P;  2AFE A;  2X8S A;  1QWD A;  1DZP A;  1SRF A;  3RG2 A;  2GJ5 A;  3CMA P;  5L8N A;  3FR4 A;  2Z4H A;  4O3Y A;  2PEK A;  1AVE A;  1VWO B;  3OE3 A;  1GT3 A;  1EUO A;  2JMB A;  2O62 A;  2X32 A;  3T2W A;  3OJY C;  4GGR A;  2AF5 A;  1GT5 A;  4GRJ A;  2OFB A;  1B4M A;  4GU8 A;  1VWK B;  4DQ3 A;  1JJU A;  1PMP A;  2KWL A;  4GJS A;  2A2U A;  3NQ9 A;  1LCV A;  1VWM B;  3SZI A;  1MUP A;  4HKG A;  1BRP A;  5HCC C;  1E5P A;  4YBU A;  4GZV A;  1JJJ A;  5HA0 A;  5EJD A;  4H2X C;  4R0B A;  2PEI A;  4F37 A;  1B8E A;  1E00 A;  2X2B A;  1K73 Q;  2Q2P A;  3SZH A;  4MVE A;  3NPO A;  1SLE B;  2LPK A;  1KQW A;  3B2K A;  2W2B A;  1BXI A;  1YIT P;  3SZJ A;  1VWF B;  4O4O A;  4YFR A;  2C4I A;  2A5C A;  2NND A;  5KP6 B;  2BC3 A;  1GXG A;  3EJE A;  1N9Y A;  5DPQ A;  1IKJ A;  1AVG I;  5F2K A;  2RTP B;  1JYJ A;  2X46 A;  4IMO A;  1AQB A;  1KL3 A;  2LIU A;  3RG6 C;  3S5X A;  3BU1 A;  4LZV A;  1LIC A;  5KHP A;  4UHP B;  3RDX A;  1M74 A;  1G5W A;  4WFV A;  4O4U A;  1MDC A;  2GZI A;  4ALO A;  1KT6 A;  3ZUI A;  3P6F A;  3VU1 A;  2AT0 X;  2G8C O;  5H9L A;  3P6C A;  3CXC O;  2CAM A;  1VQM P;  1U0X A;  4HPA A;  1RO2 A;  1FEM A;  3E2D A;  4EKV A;  3VG5 A;  1JMX A;  1RSU B;  2AMM X;  2K0D X;  4NLJ A;  3RDM A;  4NLI A;  1SA8 A;  1SRI A;  1SLF B;  1GX8 A;  1AB0 A;  2K5X A;  2RTH B;  3EM0 A;  4YGG A;  4ARH A;  1FEN A;  2KTD A;  5FFH A;  3CPW O;  1EPB A;  1SRH A;  1X89 A;  1ACD A;  1ZNL A;  3GZM A;  2CM4 A;  3BU9 A;  3VHM A;  2KGC A;  2L9F A;  2A13 A;  2M5R A;  2X56 A;  4I3C A;  4YFQ A;  1SWE A;  4CPH B;  2CNR A;  1YWD A;  2RTJ A;  5HCE C;  1N43 A;  1EXS A;  1OEE A;  4GUZ A;  2WEW A;  1JZU A;  3EBK A;  5FAZ A;  1YWB A;  3KVN A;  2BS5 A;  3NTE A;  4BX6 B;  3TGA A;  3LHN A;  2XST A;  3G1I A;  2Q9S A;  4ORS A;  1T0V A;  3QQ2 A;  2EIA A;  1BLR A;  2AF8 A;  3VHH A;  1VWL B;  4YMY A;  1RXJ A;  1VQN P;  1O8V A;  1DV9 A;  1STR B;  4AW8 A;  4AZQ A;  4GR6 A;  4GNY A;  2VLO A;  2QMI A;  3PDF A;  3G6E P;  5HZ6 A;  3CC7 P;  4U0A A;  2ROQ A;  2L67 A;  5D47 A;  2HMB A;  3DS0 A;  4RUN A;  4WFU A;  1LFO A;  4Z27 A;  1VQ9 P;  3NQ3 A;  3G71 P;  2RTI B;  4XFX A;  3NQK A;  3OBL A;  2VFC A;  4CSB A;  3ZWE A;  2NNE A;  3TZS A;  2F01 A;  2OVA A;  1HY8 A;  5BVQ A;  5FQ6 E;  2IZD B;  3WJE A;  1KZX A;  1K30 A;  1NP1 A;  1JJ2 O;  3Q6L A;  1S72 P;  3VHI A;  2MF4 A;  4IB7 A;  1SRG A;  4HFO A;  2AKQ A;  2FVA A;  2GZG A;  1HXL A;  3APX A;  2IZE B;  3JSQ A;  3B5I A;  5JPA A;  4ZHF A;  4OS8 A;  3FA7 A;  3KFI A;  4HWM A;  2N98 A;  1NC9 A;  4AZR A;  1TOU A;  2A5B A;  3AEH A;  5KID A;  1AEL A;  5F7G A;  2Y3F A;  2XKL A;  2KGD A;  1VWD B;  1N8R Q;  5IRA A;  1HXZ A;  1YUP A;  3KZA A;  4XFZ A;  1TOW A;  1SWP A;  2VLP A;  2GTL O;  2GDW A;  5LKF A;  3P05 A;  3F8A A;  3GKL C;  1UJZ A;  1SWQ A;  5HGN A;  3VG4 A;  1VWR B;  2EHT A;  1DF8 A;  2HZR A;  1E2T A;  3NAD A;  2CQ8 A;  1I9H A;  3JQO A;  1Y0G A;  4PJ2 A;  2C1S A;  2K23 A;  4A60 A;  4GDZ A;  5CZD B;  1DFV A;  2N93 A;  2DGY A;  5HGL A;  3P6D A;  1VWJ B;  1OBQ A;  1FTP A;  3VG3 A;  5KP7 B;  3BDR A;  4QYP A;  4PSQ A;  3RDO A;  3T6F A;  1LDQ A;  1D2U A;  1W4T A;  2QOM A;  4I3D A;  4Y59 A;  1GKA A;  3UEU A;  5LKE A;  1X3O A;  1DZM A;  5HV8 A;  1KZW A;  2M8P A;  1L0I A;  2ZSC A;  3NX2 A;  3JS1 A;  1BJ7 A;  5HWZ A;  4HPB A;  2EU7 X;  1VKU A;  2KGA A;  5F6B A;  3BSZ E;  3OW2 O;  4IAW A;  2EFJ A;  4BCS A;  5F1E A;  4I9S A;  2CM9 A;  2KW2 A;  3SLJ A;  1VWB B;  3WJG A;  4XMD A;  5H9N A;  4GGZ A;  1URE A;  3ZUO A;  2RTD B;  4O4S A;  3U0D A;  1CBI A;  3B2I A;  3DS3 A;  3D97 A;  2YMS A;  2XZ1 C;  5F2N A;  5CYB A;  2GDY A;  4I60 A;  3G21 A;  3SOT A;  2IZA A;  3ZQ3 A;  2ZAI A;  4QYN A;  1ML7 A;  2CZU A;  1KL4 A;  1KXO A;  1YP6 A;  3FR5 A;  1N0S A;  2QEX P;  2BLG A;  3CCV P;  3V8U A;  3LTW A;  4ODD A;  3UEV A;  2A3F X;  1EI5 A;  4FBO A;  3I17 A;  2IZJ A;  3AKM A;  1W2B O;  1BM5 A;  3CR6 A;  2FS7 A;  2LFO A;  4LZU A;  2RCT A;  2LA7 A;  1UNK A;  2BSZ A;  3KFH A;  2OVS A;  3WJC A;  3H3I A;  3I0A A;  2L4B A;  4Y5D A;  2I5Z O;  1Q7Y Q;  4XFY A;  3VE1 A;  1IUQ A;  4AZM A;  3D4R A;  1MX7 A;  3HOE A;  2LOL A;  3FR2 A;  2GTL N;  5IO7 A;  1JV4 A;  1ZNE A;  4CPF A;  4N7D A;  3CCS P;  4EXZ A;  2FR2 A;  4HPC A;  4QGW A;  2RTA A;  3X00 A;  4QRL A;  1EQD A;  2LML A;  3WZO A;  4A1H A;  3EJB A;  5EPQ A;  3WZP A;  1JQP A;  2K94 A;  1KQX A;  2OZQ A;  5HZ8 A;  4CV7 A;  2JOZ A;  4C5P A;  3B2L A;  5LJG A;  2LKI A;  4CPI A;  4HPD A;  3VG7 A;  2L9C A;  1FR2 A;  1EII A;  3EW1 A;  3FIQ A;  3ELZ A;  2XZ0 D;  5FEN A;  4IZ6 A;  2FLJ A;  2K62 A;  4EQA C;  3G0V A;  3FW4 A;  4ORY A;  3RSW A;  1DF3 A;  2Z46 A;  2GH7 A;  5HZQ A;  2FQ1 A;  1QVG O;  3DS4 A;  4O3W A;  1KL5 A;  1WUB A;  1GXA A;  1TW4 A;  2KOR A;  3P02 A;  2QM9 A;  2WWP A;  4L1N A;  3FA8 A;  4TJZ A;  2FHL A;  1MVG A;  2RTK A;  4OEL A;  1U17 A;  1UYN X;  1RXH A;  1QY0 A;  4PWV B;  2K0Y A;  1VQL P;  1EPA A;  2Z44 A;  3AKN A;  3I56 P;  1X8N A;  1GX9 A;  2P9X A;  3CD6 P;  2JGP A;  1I4U A;  5C0N A;  2GDX A;  1A2D A;  4AZN A;  3MBT A;  1OEJ A;  1DZJ A;  4QKO A;  2OY7 A;  1MX8 A;  4IPY A;  5EDC A;  2QNW A;  5HCD C;  1JMZ A;  2EHS A;  1LNM A;  1SWG A;  2R74 A;  2JQ4 A;  2LTE A;  3APV A;  1HMS A;  2ACP X;  3DS1 A;  1VQP P;  5EEE A;  4K19 A;  4U0B A;  4Y0R A;  4BX5 A;  1VQ6 P;  1YWA A;  4YBP A;  1ALB A;  2L22 A;  1LKE A;  4GET A;  1RBP A;  1PEE A;  4GDA A;  2FAD A;  3F6Z B;  3DTJ A;  3DPH A;  1U18 A;  3FA9 A;  1GGL A;  4NYQ A;  3CCR P;  4GD9 A;  3P6H A;  3WJB A;  1BWY A;  4N7C A;  2Q4N A;  1IW2 A;  4U0F A;  1VQ8 P;  3DS5 A;  2XT1 A;  2NO8 A;  2RTM A;  3PP6 A;  1ACP A;  1HBP A;  2OFM X;  2WUT A;  4M7M A;  4CDC A;  1PBY A;  1JYD A;  2GZF A;  2RQ0 A;  3RZY A;  4KC7 A;  4BOE A;  4O9S A;  3MVF A;  1ERX A;  3M1M A;  2PY1 A;  1VPR A;  3HWG A;  2CBR A;  2MVU A;  1KT7 A;  2N6Y A;  1FJ1 E;  2PEJ A;  2L68 A;  4H2Y C;  5IRW A;  1HY2 A;  3Q20 A;  2L6E A;  1YIJ P;  2NNQ A;  2MWH A;  2JU8 A;  2KW1 A;  3HWF A;  1XKI A;  4QGV A;  4FBR A;  3GAQ A;  2JBG A;  1MM9 A;  2FHN X;  2RA6 A;  2LB6 A;  5F58 A;  2DJG A;  2X34 A;  1LIE A;  1A43 A;  2L5P A;  1SXY A;  5KIC A;  2MHD A;  4ZHH A;  2JU1 A;  2PNG A;  3Q34 A;  2P8G A;  1M1K Q;  3BY0 A;  4BPH A;  2LBA A;  4CK4 A;  2RTC B;  1MZ8 A;  1UZ2 X;  1ERB A;  2OVE A;  5LJC A;  2UZ2 A;  3G7X A;  3PPT A;  1VQ4 P;  3K3L A;  2RTR B;  1CBR A;  1I78 A;  5FQ8 E;  3PEC A;  1Q81 Q;  3ZW1 A;  2MR7 A;  1EW3 A;  5IRU A;  3WJD A;  4A1Y A;  1YP7 A;  4BX7 A;  4FGI B;  2BT9 A;  4ES7 A;  2ERH A;  5FQ7 E;  2AH7 X;  4AZO A;  3VRL C;  4WYM A;  5B29 A;  5LJD A;  1AYI A;  3DS2 A;  2JW1 A;  1KT5 A;  3VGW A;  4CDD A;  3CCM P;  3B4Q A;  2JN3 A;  1R0U A;  2M8N A;  1W5R A;  3VG2 A;  4ZH9 A;  5K68 A;  4TKB A;  2GTL M;  2OF9 A;  3CMP A;  4XMF A;  1RAV A;  5D4A A;  4COP A;  5BVS A;  4QZT A;  1SWC A;  1BEB A;  3S60 A;  1ZMB A;  1M6E X;  2PEN A;  4YCE A;  1LCZ A;  3CCJ P;  4IB9 A;  4MIR A;  2VLQ A;  5B5F A;  1BAJ A;  3KFF A;  4ZHC A;  1X71 A;  1SWB A;  1K3B A;  4PH1 A;  2E1M A;  3FEL A;  1K8A Q;  2QO4 A;  3NBX X;  1ZNK A;  3EYC A;  3KQ0 A;  4TKH A;  4EFG A;  4YKO A;  1IMP A;  4TQ2 A;  4OMW A;  2Q39 A;  1DC9 A;  4MVL A;  4NV8 A;  3OD9 A;  2DM5 A;  4ORU A;  1CBS A;  2DJF A;  4Y0S A;  3TGB A;  4BVM A;  2AVA A;  1KD1 Q;  2F73 A;  3PQS A;  2Q2M A;  4H2W C;  5B11 O;  3CCE P;  2GC9 A;  1X8P A;  2IZL B;  3STM X;  5CSE A;  1A3Y A;  3WJF A;  3B2H A;  4ON1 A;  1K9M Q;  2UYW A;  4O49 A;  4IRW A;  1BSQ A;  1IKE A;  1E06 A;  4IB6 A;  4BBO A;  2Y3E A;  5B10 O;  2ZAG A;  4PH0 A;  2RTL A;  5B27 A;  3UEW A;  1OEK A;  2FWV A;  3APW A;  5AJB A;  4R0M A;  2HNX A;  2OAR A;  5HTD A;  3ZW0 A;  1RST B;  1ICM A;  2R56 A;  3CKF A;  3WYP A;  3BRN A;  4Y0Q A;  1X8O A;  1VYG A;  2LBV A;  3FW5 A;  1JJX A;  2FKG A;  1SXW A;  5K67 A;  3C78 X;  2KOS A;  3RDQ A;  3H0D A;  2G79 A;  2OYB O;  1OPA A;  4QZU A;  4U8U O;  3U03 A;  2QO6 A;  1QY2 A;  3ZI8 A;  3KFG A;  5L3Y A;  4O3X B;  4INN A;  5I4T G;  3GJN A;  4KII A;  3BX7 A;  1KFF A;  1KLP A;  2GTF X;  3RDS A;  1HMR A;  1A8O A;  2CWO A;  2HLV A;  1OSP O;  4Y0P A;  5HTE A;  1NBX A;  5F2B A;  5DCK A;  5EDB A;  2KOQ A;  3HYB A;  2JB0 A;  2FGS A;  2IZC B;  2MD9 A;  1HQQ A;  3G4S P;  4ZGU A;  5HZ5 A;  2ASN X;  2RD7 C;  1LUQ A;  1YJW P;  1SXU A;  2VSQ A;  3CCU P;  5F2O A;  1FDQ A;  4Z28 A;  2VDF A;  3O22 A;  1SWS A;  2C1Q A;  3HWD A;  5JR8 A;  1HN2 A;  5EED A;  2PEM A;  3STK A;  2EG5 A;  2JYG A;  2AFD A;  3PQU A;  2OY8 A;  2K0X A;  1ZND A;  1GT1 A;  4I95 A;  1LIB A;  5H9K A;  2IFB A;  1QRJ A;  2K92 A;  3L4R A;  1VWG B;  1L0H A;  3EC5 A;  3SAO A;  4Z2V A;  1N9M A;  3CBC A;  3APU A;  1VQ5 P;  2KR5 A;  1Y55 X;  1VWN B;  1Y9T A;  4DCB A;  3IFB A;  5IXG A;  5CHK A;  4XMH A;  2OL7 A;  1YJN P;  1BSY A;  3U9P C;  3I55 P;  1VQO P;  3H47 A;  2MO5 A;  4MRT C;  3B2J A;  3UEX A;  1ADL A;  1KT3 A;  2FS6 A;  2QCB A;  2POA A;  2RTN B;  4BPG A;  5IO6 A;  4JHQ A;  3NR3 A;  3BS2 A;  2RCQ A;  4ZFX A;  2WPT A;  3PK2 A;  1X8U A;  3MGE A;  1A18 A;  2OFR X;  3RE6 A;  2KTS A;  3FLL A;  3RKG A;  2N6Z A;  3RWX A;  2G5L A;  1CRB A;  1SWU A;  1GPJ A;  2KOO A;  3CCL P;  1AF8 A;  4DG9 A;  5LJB A;  4L3R A;  4ZHG A;  3FMZ A;  2N5H A;  1D1D A;  3MM0 A;  1QFV A;  1M6N A;  4CPH A;  1ICN A;  1KGL A;  3LMO A;  3GE2 A;  1VQK P;  4OS0 A;  2DNW A;  1TXL A;  4QGX A;  4KH8 A;  3O19 A;  2YG2 A;  1HMT A;  4BX6 A;  2Z4I A;  2MJI A;  2FR3 A;  2FKJ A;  1SWJ A;  2AT8 X;  2GYK A;  1LDO A;  4TKJ A;  1EIO A;  2LF4 A;  2CGQ A;  1MK5 A;  1NP4 A;  4XMG A;  7CEI A;  2X55 A;  1MEP A;  3CME P;  4U0C A;  5L8O A;  4U8U N;  2RTG B;  2BHV A;  2FAE A;  1NJI Q;  4GGT A;  3RY1 A;  4Z2P A;  2IZG B;  1SWN A;  5BVT A;  2QOS C;  5LJK A;  4QNB A;  5B2A O;  4JGL A;  2WEX A;  1OBP A;  2X8T A;  3CQR A;  1LID A;  2G78 A;  4CA3 A;  2FHS C;  3FA6 A;  1HQB A;  2FQ0 A;  4YH0 A;  2IZK A;  4U3Q A;  3EJD A;  4NP1 A;  1K24 A;  2AL0 X;  2LKK A;  4IBA A;  1ZNH A;  3CE7 A;  3WBG A;  2BUO A;  1STS B;  2FVF A;  5EW5 E;  4AZP A;  3P6G A;  2RTE B;  4U0E A;  3ELX A;  1IIU A;  1A57 A;  2MF6 A;  1SLG B;  4I6S A;  3SLO A;  1GKA B;  1S2P A;  1G74 A;  3QKG A;  4KT5 A;  3ZZV A;  1UYO X;  3MG5 A;  4MEE A;  4O4X A;  2N50 A;  4RUU A;  3FEN A;  5HGM A;  3C77 X;  3NP1 A;  1KQS O;  1OBU A;  4YGH A;  2GZE A;  2OVD A;  1VWE B;  4NV7 A;  3PH6 A;  3D9W A;  1P6P A;  5HZ9 A;  4CDF A;  4O3Z A;  2AT6 X;  5KP8 B;  2NP1 A;  1YJ9 P;  2PI3 O;  2K93 A;  1IJ8 A;  4DNE A;  5AJC A;  2X45 A;  2K2Q A;  1JBH A;  1SWO A;  4YCH A;  4M0I A;  2KD2 A;  5D8J A;  1M90 Q;  1NQM A;  1PBO A;  5EZ2 A;  2RN4 A;  4YDA A;  4OKA A;  1SWD A;  3WYQ A;  3S26 A;  2FVE A;  2IZH B;  5B3M O;  2CZT A;  1HQP A;  1DV5 A;  1LEL A;  1BBP A;  4U46 A;  3FID A;  1N4J A;  4JO6 A;  3WZQ A;  2VFB A;  2FAC A;  2I5V O;  1QG5 A;  4COT A;  1OR5 A;  2JO0 A;  1DNY A;  1GX3 A;  2WSJ A;  4ALB A;  3CKG A;  3FYF A;  4ORW A;  2ACO A;  1SRE A;  1FE3 A;  1BRQ A;  1GT4 A;  3FEP A;  3HWE A;  1SWR A;  1VYO A;  1Y52 X;  3MX7 A;  4NNT A;  1S7D A;  4ZJ0 A;  3CCQ P;  1YI2 P;  1YHQ P;  2OL6 O;  1VWP B;  4BJ8 A;  1QVF O;  1I05 A;  4GH7 A;  4YVB A;  1LCW A;  2CG5 B;  2HKD A;  3DTQ A;  3H4E A;  4B55 A;  5HAE A;  4OEM A;  3WZN A;  4IAB A;  2L0Q A;  2IZF B;  1PTS A;  4NW4 A;  3NY7 B;  4GR2 A;  4EEJ A;  1VWI B;  5CE4 A;  4AYH A;  2ANS A;  1SY3 A;  2N5I A;  2FRS A;  2IZB A;  5AQ6 A;  3EW2 A;  3HZQ A;  5D48 A;  4ZCB A;  1SWA A;  2WQ9 A;  3EBW A;  1Y9L A;  2X8F A;  1Q82 Q;  2LL8 A;  2X4M A;  2RTQ B;  2JU3 A;  1O1V A;  2KOD A;  1E02 A;  2G7B A;  3C76 X;  4ORX A;  1VWA B;  1Q86 Q;  3NX1 A;  2FT9 A;  4UU3 A;  1VWC B;  3CWK A;  1QQS A;  4XMC A;  2MR8 A;  3RY2 A;  3T6L A;  4GNW A;  1VWH B;  1EOQ A;  3HK1 A;  3P24 A;  4NNS A;  3TGC A;  1AVD A;  4WHI A;  4COC A;  1MOY A;  3VG6 A;  2A8G A;  4U0D A;  3HOL A;  1WBI A;  4DQ4 A;  1D3S A;  4ZHD A;  1BSO A;  1T8V A;  1YIV A;  3CC4 P;  1L6M A;  4GE1 A;  3CBS A;  3D96 A;  4JNJ A;  4ORR A;  4U8U M;  5B5G A;  2KOP A;  1TVQ A;  2MVV A;  2IZI A;  1X8Q A;  1SXX A;  4D6B A;  2BS6 A;  1Z24 A;  5IO5 A;  5H8T A;  4CDE A;  1SLD B;  1VQ7 P;  4NEO A;  2JAZ A;  5K06 A;  2R73 A;  1HBQ A;  2JYL A;  2WR6 A;  4ZH6 A;  2PEO A;  5DG4 A;  1EIA A;  3UAQ A;  4BX5 B;  1W6F A;  5F6Z A;  2CBS A;  1GM6 A;  4M6S A;  5HGO A;  2M4L A;  1IMQ A;  4PXH B;  5HVC A;  2RTF B;  4MIS A;  1SMP I;  1VYF A;  3GZL A;  4XRQ A;  2KG6 A;  1ZNG A;  3G28 A;  4YFP A;  2GZJ A;  4OS3 A;  1I06 A;  3FDC A;  3WXQ A;  5BYP A;  2XV6 A;  2RTB B;  1ZNV A;  3VPJ E;  2KT4 B;  4UU2 A;  4Z6J A;  4IB8 A;  3LRY A;  4MVK A;  1VHN A;  1IFB A;  2LIW A;  1CJ5 A;  4I9R A;  1PM1 X;  2JGS A;  1LIF A;  3RE5 A;  5BS2 A;  3G26 A;  1NQN A;  2MY5 A;  1T68 X;  3E3C A;  4FQB B;  3WBH A;  4ZR2 A;  2OTJ P;  3RBY A;  1QY1 A;  2AT3 X;  1KT4 A;  4TLJ A;  2AVI A;  4A8Z A;  4CPE A;  4MVI A;  1YWC A;  4NYR A;  3DSZ A;  5BS1 A;  1SWL A;  5AEO A;  1O1U A;  1NQ4 A;  3T2X A;  4Z2O A;  4YKM A;  5H9A A;  3AUM O;  2W2F A;  4FBV A;  1SWK A;  3ZW2 A;  3VE2 A;  1AUM A;  1JIW I;  3S5V A;  1S44 A;  1Z6M A;  3BLG A;  2OFA A;  2KGE A;  3FEK A;  2JU2 A;  2ALL X;  4QQ1 A;  1SY1 A;  3U43 A;  3STN A;  1QAB E;  1SWH A;  2F09 A;  4BGF A;  3P6E A;  1SY0 A;  1E6J P;  1GXH A;  3G1G A;  1B56 A;  2MM3 A;  3T1D A;  3ZW1 B;  2HYS A;  4GJV A;  4KC8 A;  5D45 A;  2KG8 A;  1IFC A;  2KG9 A;  5HA1 A;  4BX7 B;  1N7Y A;  1NGL A;  4U9C A;  2QA4 P;  1SY2 A;  3O2Y A;  1Y53 X;  1VWQ B;  3N91 A;  3EMM A;  1CEI A;  4I3B A;  4YDB A;  2M8L A;  4YGZ A;  2OY1 O;  1B0O A;  1KOI A;  4XME A;  3RDU A;  1E0H A;  2OF8 A;  4D6A A;  4XRO A;  4BQU A;  5JD2 A;  4OMX A;  1CBQ A;  4QNI A;  1SRJ A;  3D95 A;  1EMV A;  5HBS A;  2HZQ A;  2FTB A;  2JU7 A;  4EDE A;  1G7N A;  1FEL A;  3G29 A;  1G85 A;  3HTY A;  1LPJ A;  4BPF A;  2VLN A;  1I04 A;  1STP A;  1EAL A;  3PH5 A;  2QO5 A;  2PY8 A;  4WBK A;  3WVM A;  3CQN A;  2FQ2 A;  2OY5 O;  1XCA A;  3PED A;  2W2A A;  4TNN A;  2A0A A;  1F80 D;  1SWF A;  4LQZ A;  1KC8 Q;  1RO0 A;  5L8I A;  2AT5 X;  4IAX A;  4GK9 A;  4KCA A;  2ONT A;  2E4J A;  1NDJ A;  1RLB E;  3IA8 A;  4LKT A;  1DZK A;  2Y32 A;  1T8K A;  4LKP A; 
#chains in the Genus database with same CATH homology
 4HPB A;  4M0I A;  2EU7 X;  4PH1 A;  2KD2 A;  4QAE A;  2E1M A;  5D8J A;  3FEL A;  3BX8 A;  4IMN A;  1ZRY A;  3WOV A;  1K8A Q;  1M90 Q;  2XXM A;  1PBO A;  2QO4 A;  3NBX X;  5F6B A;  1ZNK A;  3EYC A;  2RN4 A;  5EZ2 A;  1OPB A;  3KQ0 A;  3BSZ E;  4YDA A;  4TKH A;  1RNI A;  4EFG A;  2A2G A;  5LJE A;  4YKO A;  3OW2 O;  4IAW A;  2EFJ A;  5F1E A;  4I9S A;  3LV4 A;  4TQ2 A;  4OMW A;  3CC2 P;  2CM9 A;  3TF6 A;  2Q39 A;  3S26 A;  1DC9 A;  4GKC A;  2WQA E;  4MVL A;  1LF7 A;  3OD9 A;  3ZW0 B;  2DM5 A;  4ORU A;  1CBS A;  2CZT A;  4XMD A;  3WJG A;  5H9N A;  1HQP A;  1QFT A;  4Y0S A;  2PEQ A;  1BBP A;  1URE A;  3ZUO A;  4ML7 B;  3TGB A;  4O4S A;  4BVM A;  3U0D A;  1CBI A;  4ID2 A;  4ZGF A;  3B2I A;  3DS3 A;  1KD1 Q;  3D97 A;  1QG5 A;  2F73 A;  2YMS A;  3PQS A;  2Q2M A;  3F9D A;  4COT A;  5LJH A;  5F2N A;  5CYB A;  1H91 A;  2Z45 A;  2OTL P;  2JO0 A;  3G21 A;  2X8S A;  1QWD A;  2WSJ A;  4ALB A;  1DZP A;  3SOT A;  3CCE P;  2GC9 A;  1X8P A;  3FYF A;  3STM X;  4ORW A;  2ACO A;  1A3Y A;  2GJ5 A;  3CMA P;  3B2H A;  3WJF A;  3FR4 A;  2Z4H A;  5L8N A;  4O3Y A;  1FE3 A;  2PEK A;  1BRQ A;  1GT4 A;  3FEP A;  3HWE A;  4NNT A;  1K9M Q;  4ON1 A;  3MX7 A;  3OE3 A;  3ZQ3 A;  1GT3 A;  1S7D A;  4ZJ0 A;  4O49 A;  3CCQ P;  1YI2 P;  1EUO A;  2ZAI A;  2JMB A;  4QYN A;  1YHQ P;  1ML7 A;  2CZU A;  2O62 A;  1BSQ A;  1IKE A;  1E06 A;  3OJY C;  4IB6 A;  1KXO A;  1QVF O;  1GT5 A;  1I05 A;  1YP6 A;  3FR5 A;  1N0S A;  2ZAG A;  4PH0 A;  4GH7 A;  4GRJ A;  2QEX P;  5B27 A;  3UEW A;  2BLG A;  1B4M A;  3DTQ A;  3CCV P;  3H4E A;  1OEK A;  2FWV A;  3APW A;  4GU8 A;  3V8U A;  5HAE A;  5AJB A;  4DQ3 A;  4IAB A;  2HNX A;  2OAR A;  4ODD A;  5HTD A;  1PMP A;  3UEV A;  2A3F X;  3ZW0 A;  2A2U A;  3NQ9 A;  1EI5 A;  1ICM A;  2R56 A;  4NW4 A;  4FBO A;  3I17 A;  4GR2 A;  1MUP A;  4EEJ A;  3BRN A;  1BRP A;  3AKM A;  1W2B O;  4Y0Q A;  5CE4 A;  1BM5 A;  5HCC C;  1X8O A;  1VYG A;  2FS7 A;  2LFO A;  3CR6 A;  3FW5 A;  2LBV A;  4LZU A;  1E5P A;  4YBU A;  4GZV A;  1JJJ A;  4AYH A;  2ANS A;  2RCT A;  5HA0 A;  1JJX A;  2LA7 A;  1SY3 A;  1SXW A;  3C78 X;  2FRS A;  3KFH A;  4R0B A;  2PEI A;  2OVS A;  1B8E A;  1E00 A;  5AQ6 A;  3HZQ A;  3H0D A;  2G79 A;  3H3I A;  1K73 Q;  1OPA A;  2Q2P A;  4QZU A;  4MVE A;  3NPO A;  4U8U O;  2QO6 A;  5D48 A;  3U03 A;  3I0A A;  4ZCB A;  1KQW A;  1QY2 A;  2WQ9 A;  3EBW A;  3ZI8 A;  3B2K A;  1Q7Y Q;  4XFY A;  3VE1 A;  1Y9L A;  2W2B A;  2X8F A;  3KFG A;  1IUQ A;  1YIT P;  1Q82 Q;  4O3X B;  4AZM A;  4INN A;  5I4T G;  2JU3 A;  3D4R A;  1O1V A;  2KOD A;  1E02 A;  4KII A;  1MX7 A;  3BX7 A;  4O4O A;  2G7B A;  2GTF X;  3C76 X;  4YFR A;  3HOE A;  4ORX A;  3FR2 A;  1Q86 Q;  2GTL N;  2NND A;  5IO7 A;  3NX1 A;  1JV4 A;  1ZNE A;  2FT9 A;  4UU3 A;  1HMR A;  4N7D A;  1A8O A;  2CWO A;  5DPQ A;  3CCS P;  2HLV A;  1IKJ A;  3CWK A;  1QQS A;  4EXZ A;  4Y0P A;  5HTE A;  1AVG I;  5F2K A;  4XMC A;  1JYJ A;  5DCK A;  4ARH A;  5EDB A;  2X46 A;  4IMO A;  3HYB A;  1AQB A;  2FR2 A;  4GNW A;  3RG6 C;  1EOQ A;  3HK1 A;  3S5X A;  4HPC A;  3P24 A;  3BU1 A;  4LZV A;  4QGW A;  4A1H A;  1LIC A;  3G4S P;  1EQD A;  4NNS A;  4QRL A;  4ZGU A;  5HZ5 A;  3TGC A;  2ASN X;  2RD7 C;  5KHP A;  1YJW P;  5EPQ A;  1SXU A;  3CCU P;  4WHI A;  5F2O A;  1FDQ A;  1M74 A;  4COC A;  1G5W A;  4WFV A;  3O22 A;  4O4U A;  3VG6 A;  1KQX A;  4U0D A;  3HOL A;  1MDC A;  3HWD A;  4DQ4 A;  5JR8 A;  2OZQ A;  5HZ8 A;  1D3S A;  4CV7 A;  2JOZ A;  4ZHD A;  1BSO A;  1HN2 A;  3B2L A;  1T8V A;  4ALO A;  1KT6 A;  5EED A;  1YIV A;  5LJG A;  3P6F A;  3ZUI A;  3VU1 A;  2PEM A;  4HPD A;  3CC4 P;  1L6M A;  2AT0 X;  2L9C A;  4GE1 A;  3STK A;  3VG7 A;  1EII A;  3CBS A;  2EG5 A;  3D96 A;  2JYG A;  5H9L A;  3P6C A;  3PQU A;  3CXC O;  1VQM P;  3FIQ A;  4ORR A;  1U0X A;  3ELZ A;  4U8U M;  4HPA A;  1ZND A;  1GT1 A;  1RO2 A;  5FEN A;  4I95 A;  1LIB A;  1FEM A;  2FLJ A;  3E2D A;  1TVQ A;  2K62 A;  5H9K A;  2IFB A;  1X8Q A;  4EQA C;  3G0V A;  1QRJ A;  3FW4 A;  3WJC A;  1SXX A;  4ORY A;  3VG5 A;  4D6B A;  3L4R A;  2BS6 A;  3RSW A;  1DF3 A;  2AMM X;  3SAO A;  1Z24 A;  4NLJ A;  5IO5 A;  4NLI A;  5H8T A;  1SA8 A;  2Z46 A;  3CBC A;  5HZQ A;  1VQ7 P;  1QVG O;  3DS4 A;  3APU A;  4O3W A;  1VQ5 P;  1GX8 A;  1AB0 A;  5K06 A;  2R73 A;  1HBQ A;  3EM0 A;  2JYL A;  4YGG A;  1FEN A;  1GXA A;  2KTD A;  1TW4 A;  2PEO A;  1Y9T A;  2WR6 A;  5DG4 A;  4ZH6 A;  5FFH A;  3P02 A;  2QM9 A;  3IFB A;  1EIA A;  3CPW O;  2WWP A;  4L1N A;  3FA8 A;  1EPB A;  1X89 A;  3UAQ A;  4TJZ A;  1ACD A;  1ZNL A;  2CM4 A;  4XMH A;  3BU9 A;  1MVG A;  1YJN P;  1BSY A;  2CBS A;  5F6Z A;  2A13 A;  3U9P C;  1GM6 A;  3I55 P;  1VQO P;  3H47 A;  4M6S A;  4I3C A;  1U17 A;  2MO5 A;  4YFQ A;  1QY0 A;  1YWD A;  5HGO A;  5HCE C;  2M4L A;  1VQL P;  3B2J A;  1EPA A;  3UEX A;  2Z44 A;  1ADL A;  1KT3 A;  3I56 P;  1EXS A;  1X8N A;  2FS6 A;  1OEE A;  3AKN A;  2POA A;  1SMP I;  4MIS A;  1GX9 A;  5IO6 A;  2P9X A;  2WEW A;  1VYF A;  1JZU A;  3CD6 P;  4XRQ A;  1I4U A;  3NR3 A;  1ZNG A;  3G28 A;  3BS2 A;  3EBK A;  4OS3 A;  4YFP A;  5FAZ A;  5C0N A;  1YWB A;  1I06 A;  2RCQ A;  4ZFX A;  2BS5 A;  3WXQ A;  3NTE A;  5BYP A;  1X8U A;  2XV6 A;  3MGE A;  1A18 A;  3TGA A;  3LHN A;  2OFR X;  1A2D A;  2XST A;  4AZN A;  3MBT A;  3VPJ E;  1OEJ A;  3G1I A;  1DZJ A;  2KT4 B;  2Q9S A;  4ORS A;  4UU2 A;  2KTS A;  4IB8 A;  1T0V A;  1MX8 A;  2EIA A;  4IPY A;  3LRY A;  3FLL A;  4MVK A;  5EDC A;  3RKG A;  1BLR A;  3RWX A;  5HCD C;  1IFB A;  1CRB A;  1LNM A;  2R74 A;  1CJ5 A;  4I9R A;  3APV A;  1HMS A;  1PM1 X;  2ACP X;  3DS1 A;  1VQP P;  3CCL P;  5EEE A;  4YMY A;  1LIF A;  4K19 A;  5BS2 A;  3G26 A;  1VQN P;  4U0B A;  4Y0R A;  1VQ6 P;  1T68 X;  5LJB A;  1O8V A;  1YWA A;  3E3C A;  4L3R A;  4FQB B;  3FMZ A;  4ZHG A;  1DV9 A;  3WBH A;  4YBP A;  4ZR2 A;  1ALB A;  4AW8 A;  2OTJ P;  3RBY A;  1LKE A;  4AZQ A;  4GR6 A;  1D1D A;  1QY1 A;  2AT3 X;  1KT4 A;  4TLJ A;  4GNY A;  1QFV A;  4A8Z A;  4GET A;  1M6N A;  4MVI A;  1RBP A;  1YWC A;  2QMI A;  4NYR A;  1PEE A;  3DSZ A;  5BS1 A;  3G6E P;  5HZ6 A;  3F6Z B;  3DTJ A;  3DPH A;  3CC7 P;  1U18 A;  5AEO A;  1ICN A;  3FA9 A;  1GGL A;  3GE2 A;  4NYQ A;  1KGL A;  1VQK P;  4OS0 A;  4U0A A;  1O1U A;  2L67 A;  5D47 A;  3CCR P;  1TXL A;  4QGX A;  2HMB A;  3P6H A;  3DS0 A;  4KH8 A;  3O19 A;  2YG2 A;  4RUN A;  4WFU A;  1LFO A;  4YKM A;  3WJB A;  1BWY A;  4N7C A;  2Q4N A;  5H9A A;  1IW2 A;  1VQ9 P;  1HMT A;  4U0F A;  3G71 P;  2W2F A;  3NQ3 A;  4FBV A;  1VQ8 P;  3DS5 A;  2XT1 A;  2Z4I A;  3VE2 A;  3ZW2 A;  1AUM A;  3PP6 A;  2MJI A;  1JIW I;  1HBP A;  2FR3 A;  4XFX A;  1S44 A;  2OFM X;  3S5V A;  2WUT A;  3NQK A;  3BLG A;  2AT8 X;  3OBL A;  4CSB A;  4M7M A;  3ZWE A;  3FEK A;  2NNE A;  3TZS A;  2ALL X;  4TKJ A;  2OVA A;  1EIO A;  2LF4 A;  5BVQ A;  1NP4 A;  4QQ1 A;  1SY1 A;  4XMG A;  5FQ6 E;  1JYD A;  3STN A;  2RQ0 A;  3CME P;  1QAB E;  3WJE A;  4U0C A;  3RZY A;  4KC7 A;  1KZX A;  2F09 A;  4BOE A;  4O9S A;  3MVF A;  5L8O A;  1ERX A;  3M1M A;  2PY1 A;  1VPR A;  3P6E A;  3HWG A;  1SY0 A;  1E6J P;  1K30 A;  2CBR A;  1KT7 A;  4U8U N;  1NP1 A;  2BHV A;  1NJI Q;  1JJ2 O;  2PEJ A;  3Q6L A;  1S72 P;  2L68 A;  4IB7 A;  3G1G A;  4HFO A;  2AKQ A;  3Q20 A;  2L6E A;  1YIJ P;  1B56 A;  5BVT A;  2QOS C;  5LJK A;  3APX A;  2MM3 A;  3T1D A;  4QNB A;  2NNQ A;  2MWH A;  4JGL A;  3ZW1 B;  2JU8 A;  2HYS A;  2WEX A;  1OBP A;  3B5I A;  2KW1 A;  3JSQ A;  2X8T A;  3CQR A;  4KC8 A;  1LID A;  5JPA A;  3HWF A;  1XKI A;  5D45 A;  4OS8 A;  4ZHF A;  4QGV A;  1IFC A;  2G78 A;  3FA7 A;  3GAQ A;  3KFI A;  4FBR A;  5HA1 A;  4HWM A;  4AZR A;  1TOU A;  2RA6 A;  3FA6 A;  5KID A;  1NGL A;  5F7G A;  1AEL A;  4U9C A;  2XKL A;  2QA4 P;  2LB6 A;  1N8R Q;  1SY2 A;  4YH0 A;  5F58 A;  4U3Q A;  3O2Y A;  3N91 A;  1LIE A;  1A43 A;  3EMM A;  1YUP A;  3KZA A;  4XFZ A;  4I3B A;  1TOW A;  2L5P A;  1SXY A;  4YDB A;  5KIC A;  2M8L A;  4YGZ A;  2GTL O;  2MHD A;  5LKF A;  4ZHH A;  1B0O A;  3P05 A;  4NP1 A;  1KOI A;  3F8A A;  4XME A;  2AL0 X;  1M1K Q;  2P8G A;  2LKK A;  4D6A A;  4IBA A;  1ZNH A;  5HGN A;  3BY0 A;  4XRO A;  3VG4 A;  2LBA A;  4BQU A;  3WBG A;  4CK4 A;  2BUO A;  2HZR A;  1UZ2 X;  3NAD A;  1ERB A;  2OVE A;  5LJC A;  3G7X A;  3PPT A;  4OMX A;  1VQ4 P;  1CBQ A;  3K3L A;  4QNI A;  4AZP A;  3P6G A;  3D95 A;  1CBR A;  4U0E A;  5FQ8 E;  3ELX A;  1IIU A;  3PEC A;  1A57 A;  4I6S A;  1Q81 Q;  3JQO A;  1GKA B;  1S2P A;  3ZW1 A;  1G74 A;  1EW3 A;  5HBS A;  4PJ2 A;  2K23 A;  3WJD A;  4A1Y A;  4A60 A;  2HZQ A;  2FTB A;  3QKG A;  1YP7 A;  2JU7 A;  4EDE A;  1G7N A;  4FGI B;  4GDZ A;  1DFV A;  2N93 A;  1FEL A;  4KT5 A;  3G29 A;  3ZZV A;  1G85 A;  3HTY A;  2DGY A;  5HGL A;  2BT9 A;  4ES7 A;  3P6D A;  1LPJ A;  4RUU A;  4O4X A;  5FQ7 E;  2AH7 X;  4AZO A;  3FEN A;  5HGM A;  3C77 X;  3VRL C;  4WYM A;  5B29 A;  3NP1 A;  1KQS O;  1OBQ A;  5LJD A;  1I04 A;  3DS2 A;  2JW1 A;  1EAL A;  1KT5 A;  1OBU A;  3CCM P;  3PH5 A;  2QO5 A;  2PY8 A;  1FTP A;  4WBK A;  2JN3 A;  4YGH A;  3VG3 A;  1R0U A;  3WVM A;  3CQN A;  2OVD A;  2M8N A;  3VG2 A;  3BDR A;  4ZH9 A;  4TKB A;  3PH6 A;  1XCA A;  2GTL M;  3PED A;  4QYP A;  1P6P A;  2W2A A;  3CMP A;  4PSQ A;  4XMF A;  5HZ9 A;  4TNN A;  5D4A A;  4COP A;  5BVS A;  2A0A A;  1D2U A;  4QZT A;  4LQZ A;  4O3Z A;  1BEB A;  2AT6 X;  2NP1 A;  3S60 A;  1KC8 Q;  1ZMB A;  1YJ9 P;  1M6E X;  1RO0 A;  4I3D A;  5L8I A;  2PEN A;  4YCE A;  1GKA A;  2AT5 X;  4IAX A;  3UEU A;  4GK9 A;  3CCJ P;  4IB9 A;  4KCA A;  5LKE A;  2ONT A;  4MIR A;  1DZM A;  5AJC A;  2E4J A;  1KZW A;  2X45 A;  2M8P A;  1RLB E;  3IA8 A;  1JBH A;  4LKT A;  1DZK A;  1BAJ A;  3KFF A;  4ZHC A;  3NX2 A;  4LKP A;  3JS1 A;  1X71 A;  1BJ7 A;  5HWZ A;  4YCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...