2BHVA

Structure of comb10 of the com type iv secretion system of helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
191
Chain Sequence
NKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPRENEVIAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Two Core Subunits of the Bacterial Type Iv Secretion System, Virb8 from Brucella Suis and Comb10 from Helicobacter Pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Bacterial protein
molecule keywords COMB10
total genus 39
structure length 191
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03743 TrbI Bacterial conjugation TrbI-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.160 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2bhvA02
2.40.128.260 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bhvA01
2BHVA 3JQOA
chains in the Genus database with same CATH superfamily
2JU7A 4ORYA 3UEWA 7CEIA 3WZPA 3ZQ3A 1TW4A 4LKTA 4OMXA 4GETA 3OW2O 4U0BA 3P6FA 2M8LA 1RSUB 4GNWA 3RE5A 4I9RA 5D4AA 3O22A 4BBOA 3Q20A 1KT3A 4TLJA 3RDSA 5JR8A 2Y3EA 1E00A 1SWFA 4TQ2A 4IB9A 3JS1A 2DJGA 1KC8Q 4NV8A 2LL8A 1ZNDA 3BU9A 2FT9A 1NDJA 1ML7A 3RSWA 4ZHFA 5AEOA 5KP8B 3SLJA 1ZNGA 3NADA 4GGZA 2N5IA 1LIDA 4GE1A 1SXXA 3CCMP 1N9YA 4DCBA 2MM3A 4IB6A 5KICA 2OYBO 2QEXP 1YITP 1S7DA 4A1YA 2K0XA 1I4UA 4COTA 3LHNA 3WOVA 5F2KA 2FHLA 2Z4HA 5K67A 4GGRA 2QO6A 2L4BA 1BEBA 5HGLA 5IO6A 3UAQA 3ZUOA 2ERHA 5HZQA 2RTPB 3PEDA 4BVMA 5KP7B 4O4OA 2FWVA 1VWAB 3CCLP 5F6BA 1FR2A 2KG6A 2N98A 1AVEA 4NNTA 3CKGA 3ZW2A 5F1EA 4BPGA 1ZNVA 4CDCA 1Y0GA 1YIJP 3DS4A 5HA1A 3B4QA 4TJZA 1SY0A 1EPBA 3HOEA 2KWLA 1P6PA 4GH7A 5L8IA 4AZPA 2KOQA 5F58A 1VWOB 2FLJA 4IBAA 4AZQA 5HCCC 1UZ2X 1RSTB 3TF6A 2XT1A 4TNNA 1G74A 4EXZA 4O3XB 4MVKA 4NLIA 3G28A 1D2UA 1Y9TA 4U0CA 2F09A 5HZ5A 2X56A 1SWOA 5CYBA 3G6EP 1U18A 5CHKA 1SLGB 1NC9A 3ZI8A 1E0HA 1ACDA 1STSB 4AW8A 4CPHA 1VWJB 3GZMA 3M1MA 4K19A 1BXIA 2RTHB 3FR5A 1CBRA 1LIEA 3EBWA 4NP1A 2CNRA 1QFTA 1IIUA 5HTEA 2KOSA 2LMLA 2RD7C 2ONTA 2L6EA 1UJZA 1VQ6P 2BC3A 2EHSA 1VYOA 2RTFB 1GX3A 4I95A 1VWIB 3CPWO 3GAQA 5IO5A 1NQ4A 4IRWA 3S26A 1U0XA 1KZWA 3G26A 3S5XA 3FMZA 2DM5A 3SZHA 4XMDA 5HAEA 2DJFA 4OELA 4GDZA 1YWBA 1VWGB 1WBIA 3H3IA 4AZRA 3HTYA 4ALOA 1RBPA 2CM4A 2N5HA 2RCTA 5BS1A 2PEQA 2IZGB 2VLPA 4R0MA 5HTDA 2KR5A 3PP6A 2AT0X 2A5BA 1O1VA 3VRLC 1N7YA 3CMPA 1M1KQ 2A0AA 4I3BA 2JMBA 2NNEA 1MUPA 1OPAA 2IZFB 2K5XA 5EDBA 3AKMA 4L3RA 4MEEA 4GJSA 2DGYA 3MX7A 3NQ3A 2IZKA 1A2DA 4XMFA 2I5VO 4BX6B 4U0AA 1QY2A 1F80D 1IUQA 2CGQA 2EHTA 1HY2A 4YDAA 2AT6X 4ORRA 3P02A 1BWYA 4PWVB 1KFFA 4BPHA 2OF8A 3NTEA 4Y0PA 5DG4A 4CPEA 4U3QA 1OEKA 1LELA 4LZVA 4XFXA 4BX6A 1SWPA 3DS3A 1KL4A 2GTFX 3HYBA 1HMSA 3NR3A 1GX9A 1ZMBA 3H0DA 1DFVA 4YKMA 1GKAB 5AJBA 4ODDA 4XFYA 3P05A 3I56P 2CWOA 3FA8A 4KT5A 1ZNEA 3DPHA 2MY5A 2RTGB 1AVGI 1BSYA 3D96A 1JMZA 4XRQA 3H4EA 1HXZA 3VPJE 1BAJA 1JQPA 1OR5A 4EFGA 1X71A 5HBSA 3BLGA 4YFRA 3STKA 3VG6A 1TOUA 3FIDA 2ALLX 3FEPA 1LIBA 3DTJA 4CSBA 1K30A 5BVTA 3FA7A 4LZUA 3B2KA 1X8PA 1ZRYA 1RO2A 3QQ2A 2PEOA 2FR2A 3WVMA 2QMIA 2KODA 1A8OA 4U9CA 2JYLA 3MVFA 2WQ9A 3WXQA 1CBIA 1I78A 4OS3A 3APWA 2L22A 5IRWA 1OSPO 2M8PA 2C4IA 3G7XA 4IABA 2RA6A 3CBSA 3E2DA 3PQSA 3RKGA 2Z4IA 1DF3A 1Z6MA 3BSZE 3I17A 2R56A 1FTPA 4QGVA 1SRJA 2XZ0D 1ZNHA 2BLGA 1K8AQ 4ZHDA 1D1DA 1SWNA 3RY1A 4ZJ0A 3KFGA 1K73Q 1EW3A 3OJYC 4XMEA 1N43A 1BLRA 3GZLA 2A2UA 3VE2A 2ZAIA 2MVVA 1DZMA 1OBUA 1X89A 2WQAE 3CQRA 4BQUA 1B4MA 2RTKA 4ON1A 2GDWA 4NYRA 4WFUA 1BM5A 2AT8X 2RTCB 1VWHB 3STMX 3ZW1B 5HCDC 2O62A 1SLEB 1RXJA 2R73A 1W4TA 4I6SA 2EU7X 1RLBE 2K94A 2IFBA 2FR3A 3WJGA 2GTLM 2NNQA 4Y59A 2VDFA 4Z2OA 1VYFA 4TKHA 1T8VA 4BX7B 3CWKA 3PDFA 5FQ7E 3AUMO 5HZ6A 1OBPA 4FGIB 1E06A 4IMOA 1IKJA 1FJ1E 3WYPA 1L0IA 1SWUA 1DV5A 4KH8A 2NNDA 5KHPA 3B2LA 3UEXA 3VHMA 1KQWA 3LV4A 4ZGUA 1SRHA 4QRLA 3STNA 1SWCA 3SAOA 3EJBA 3IFBA 1MDCA 4UHPB 2WPUA 3HWFA 3IA8A 1M6EX 2BS6A 1VQOP 3LTWA 1DC9A 4ID2A 3SLTA 2X34A 4YKOA 5K06A 4I9SA 1JIWI 2KOOA 5LJHA 1D3SA 2FVAA 2QM9A 3Q34A 2IZAA 1MVGA 2OVSA 4PXHB 4FBRA 4UU3A 3V8UA 1VPRA 4FQBB 5EJDA 3F6ZB 2Z46A 1HQPA 3BX8A 2ACOA 2OARA 5LJBA 4YBPA 4JHQA 1YHQP 1LNMA 3FENA 1JJUA 1SWRA 1EIOA 1YJNP 1EI5A 1K9MQ 3P6DA 1QABE 1UYNX 2IZLB 2M8NA 4O3ZA 1EIAA 5K68A 1RXKA 2A2GA 1YP6A 1BRPA 1GT1A 1ALBA 5B29A 2AT5X 3MBTA 1SXWA 1CBQA 4FBVA 2IZCB 1Z24A 3KVNA 2LBVA 2MD9A 1KQSO 2IZDB 4HPCA 3WZOA 4LQZA 4EEJA 3RDQA 3VHHA 3G29A 4CDDA 4COPA 4U0EA 2JU2A 2OY7A 2CZTA 4MVLA 3RDOA 1QVFO 3FDCA 2A13A 5LJKA 1VQLP 2X8SA 1VWCB 2QO5A 2Z44A 1Q7YQ 5HGOA 4O3YA 4YGZA 4H2WC 4GR2A 1VWNB 3RBYA 1OBQA 1MEPA 1LUQA 3OE3A 5EEDA 4GGTA 2OVDA 4ZGFA 5LJCA 2OTJP 2PY8A 1Q82Q 3P6HA 5L8NA 2JW1A 4UU2A 2CAMA 1S44A 3WBHA 5EDCA 2HNXA 3AKNA 2N50A 2RTQB 3TZSA 1NBXA 2JAZA 4WBKA 5BVQA 4JO6A 5HA0A 1RAVA 1LFOA 1GPJA 2EFJA 3CMEP 3EJDA 4HFOA 1VQNP 3TGBA 2RTDB 4QZUA 1G7NA 5AQ6A 2W2FA 4EDEA 2AFEA 4QNBA 4A60A 2MF4A 4RUUA 1SREA 1VHNA 2LIWA 3CR6A 4YMYA 4AYHA 4YCHA 3CCUP 4YDBA 2AF8A 3SOTA 3K3LA 3HPEA 1H91A 3O2YA 3KFIA 3PECA 2IZHB 2G8CO 4EKVA 4R0BA 1BRQA 3RG6C 4ALBA 3RG2A 2PEKA 4ORXA 3G71P 2OL8O 1VWBB 2GTLO 3WYQA 4ZR2A 2QOMA 4Z2VA 1STRB 4MISA 4PJ2A 1BBPA 1QY1A 3TGCA 4AZMA 4CA3A 1LKEA 5IXGA 2AL0X 4O49A 1LIFA 2NP1A 2FQ1A 1FELA 2P9XA 1VQKP 2ZAGA 3RZYA 2LKIA 1GT3A 2ASNX 2GTLN 4NEOA 4I3CA 3T2WA 4ORUA 4Y0QA 2L0QA 1QQSA 1IW2A 1UNKA 1EIIA 1ACPA 1CRBA 1IFCA 3O19A 1VWEB 4COCA 5B5FA 1S72P 1BSQA 2CG5B 3L4RA 3HOLA 3NX2A 4O9SA 4FBOA 3JQOA 2RTNB 2AF5A 3VE1A 3SLOA 2RTJA 2MO5A 4I60A 1LF7A 1SY3A 2HYSA 5LJEA 1JJXA 1ERXA 4XFZA 2GZIA 3MGEA 1JJ2O 2OL6O 5D8JA 2XKLA 1NP1A 2X46A 2POAA 2LIUA 2BUOA 2DNWA 3SZIA 2QA4P 1DF8A 3DS0A 2K93A 3NQKA 3I0AA 2JO0A 2Q4NA 5DPQA 4M7MA 1VWDB 4TKBA 4YGHA 1GXAA 1FEMA 3PQUA 2GH7A 4NNSA 1VQPP 1SWHA 2KT4B 4D6AA 2QO4A 2OTLP 5B11O 3MG5A 3BRNA 2PI3O 3BY0A 3P24A 1VWQB 2ANSA 1SWJA 2F01A 1ERBA 3T6FA 4D6BA 3NX1A 3CC2P 2VFBA 4GZVA 3DS2A 4CDFA 1AELA 2CM9A 1AQBA 2AFDA 4DG9A 1QG5A 3G0VA 1NQNA 4IB7A 5FAZA 1B56A 1JYDA 2KGCA 4OS8A 3CC4P 5HGNA 4YCEA 2MWHA 2FKJA 4I3DA 2ROQA 1T8KA 3U0DA 5HCEC 3RWXA 1SA8A 1N4JA 1O1UA 3DS1A 1ICMA 3WJCA 1VWKB 2WSJA 4QYPA 4H2XC 4CDEA 2X55A 4IMNA 4BX7A 4DQ4A 3T2XA 2XXMA 1JYJA 5CZDB 4MVIA 5CE4A 3FR4A 2RTRB 3B2IA 1T68X 3WJDA 2MR7A 4CPHB 3B2JA 1L6MA 3F9DA 4NW4A 4ZHGA 3OD9A 3UEUA 2Q9SA 1X8UA 4BJ8A 1KOIA 3KZAA 2XSTA 1MM9A 1JZUA 1PBOA 2Q39A 5B3MO 4O4XA 2AMMX 1DZPA 2MJIA 1VWLB 4H2YC 3P6CA 3PH5A 2Q2MA 4M0IA 2CBSA 2L9CA 1SRIA 4KC7A 5IO7A 2OY8A 3RE6A 1SWEA 1KT7A 5HV8A 1VWFB 3FA6A 2VLQA 5IRUA 4Z28A 2JU8A 3WBGA 4IAWA 1SWDA 2RTEB 1EUOA 3ZW0B 3U43A 2F73A 4WYMA 4YFQA 1ADLA 1KT4A 2E4JA 2BT9A 1VQMP 5C0NA 3B2HA 4C5PA 2G79A 1B8EA 5F2NA 2PY1A 5B27A 1IFBA 5AJCA 3FIQA 3KQ0A 3NPOA 2XV6A 4QGWA 1SY2A 4QQ1A 4CK4A 4NV7A 3BDRA 2L9FA 5D48A 1RXHA 2OF9A 3BX7A 1AVDA 4HPDA 1KL3A 2YMSA 2FQ2A 2L5PA 3CCQP 3RDUA 2QCBA 3VG5A 1QWDA 3CQNA 3FW4A 2WPTA 2K92A 3T1DA 1A18A 2IZEB 2K62A 2FRSA 4MRTC 4A1HA 1Y52X 1CBSA 2FACA 3NP1A 2AH7X 2KW1A 3HK1A 2CZUA 2G5LA 4Z27A 3SZJA 3U9PC 1I05A 1YUPA 3D4RA 1VWPB 5BS2A 1MK5A 2FS6A 3CCJP 3CC7P 2ACPX 1EPAA 5BYPA 4ZH6A 3FA9A 5FENA 2KGAA 1Q86Q 2RCQA 1A43A 2C1SA 3DSZA 3OBLA 1WUBA 5KP6B 2X8FA 1QFVA 4GDAA 2HZRA 1LCZA 2OFAA 1KT6A 3WZQA 5D47A 1PBYA 1KT5A 2UZ2A 5LKEA 4JNJA 3APXA 4HPBA 3CBCA 2G7BA 2MVUA 1E6JP 4GR6A 2MF6A 4XMCA 3ZW1A 3VU1A 4U8UN 1VQ9P 2GDXA 1JJJA 2BS5A 2FS7A 2QOSC 2JB0A 2K0YA 4QNIA 3QKGA 2QNWA 1GM6A 2JGSA 5L3YA 4HPAA 2RTAA 3BS2A 2KTSA 2FQ0A 5EPQA 4BOEA 4QAEA 2KW2A 5F6ZA 1QVGO 3G1IA 2VLOA 4KIIA 4KC8A 5LJDA 3VG7A 4OEMA 4IB8A 4U0DA 4JGLA 2KD2A 1O8VA 1HY8A 3VGWA 4CPIA 1X3OA 1LCVA 4ZHHA 5CSEA 1SXUA 2IZIA 2Q2PA 4GD9A 3GJNA 2K0DX 2JQ4A 1GXGA 2LTEA 2HKDA 3APUA 1NP4A 1SY1A 1EQDA 1AF8A 4QGXA 1DZJA 1E5PA 4IAXA 1NGLA 4Y5DA 3TGAA 1QRJA 1SWGA 5HZ9A 1I06A 2MR8A 1HN2A 3RDXA 3T6LA 1KLPA 3FLLA 4AZNA 1SRFA 2OY1O 2JBGA 3D97A 3ZZVA 2A5CA 3KFHA 1YWCA 2KTDA 1YWAA 1VQ7P 1OPBA 2FKGA 3FW5A 1SLDB 1M90Q 1FDQA 4XMHA 3BU1A 1SWSA 3VG2A 4WFVA 1AYIA 4ORWA 2FHSC 5EEEA 2PENA 3KFFA 5B2AO 1YWDA 2P8GA 3CCSP 4GUZA 1EOQA 4ZH9A 1SWKA 4M6SA 1N8RQ 2JOZA 1FE3A 1KZXA 1HXLA 2RTBB 4QKOA 1Y55X 5HGMA 3S60A 3PK2A 4CV7A 4BX5A 4BPFA 4A8ZA 3PPTA 2OZQA 5H8TA 2JGPA 3NY7B 1VQ5P 2NO8A 4YGGA 2EG5A 1SWAA 2RTLA 5F7GA 4MIRA 2AVIA 2WEWA 3FYFA 3HWDA 5F2BA 5H9LA 2JN3A 2GC9A 2WEXA 2GZJA 1XKIA 1KL5A 3Q6LA 3PH6A 3EBKA 1AB0A 3EC5A 1XCAA 1TVQA 3U03A 4BX5B 4NYQA 1RO0A 3CXCO 4LKPA 3P6EA 2OL7A 1E02A 2N93A 4OMWA 1HBQA 4OS0A 3X00A 3G4SP 4U8UM 4HKGA 4BCSA 1I04A 4ES7A 3C76X 1GT5A 2FVFA 1EALA 3FEKA 1JMXA 1SRGA 1A57A 1LICA 3HZQA 2VSQA 2MHDA 3S5VA 4GU8A 3WZNA 3FELA 1S2PA 1Y9LA 3B5IA 2KG8A 1VQ8P 4Z2PA 1YJWP 2KGEA 1SLFB 2AKQA 4N7CA 1AUMA 3JSQA 1PEEA 4GRJA 1IKEA 2RTIB 1K3BA 2JU3A 4L1NA 4XMGA 1GXHA 2K2QA 2HZQA 4YH0A 1HMTA 4PH0A 2RN4A 3VG4A 2FGSA 2RQ0A 1GX8A 1DNYA 1BJ7A 1YP7A 2PNGA 1EMVA 1UYOX 1ZNKA 1OEJA 4YBUA 3CCEP 2CQ8A 3CCRP 1MOYA 4GJVA 1VWMB 2LF4A 2OFMX 5H9NA 2WR6A 3EM0A 4ORSA 1PMPA 4U46A 5LJGA 4GKCA 2FVEA 1PM1X 4ZFXA 4YVBA 5F2OA 1Y53X 5H9AA 1VQ4P 4QZTA 1QY0A 3LRYA 4N7DA 2FTBA 3CE7A 4INNA 5FQ8E 3CCVP 5KIDA 1L0HA 3UEVA 5EZ2A 3WJBA 2LB6A 3WJEA 3P6GA 1N9MA 1X8QA 4ML7B 4DNEA 3G21A 3EW2A 4GNYA 2LPKA 4BGFA 1R0UA 3DS5A 5L8OA 4HWMA 5B5GA 3EYCA 2N6YA 1YI2P 4ARHA 2Y32A 1KD1Q 4O4SA 4Y0SA 2FAEA 2AVAA 5H9KA 1MZ8A 4PH1A 4F37A 2LOLA 3EJEA 2XZ1C 2KGDA 2LFOA 3NBXX 4CPFA 5JD2A 2C1QA 5I4TG 1CEIA 4ZCBA 2W2AA 2GJ5A 2PEMA 1IJ8A 5JPAA 2FHNX 2G78A 2UYWA 1FENA 1HBPA 1X8OA 3DTQA 3GE2A 5HWZA 2FADA 3EMMA 2OY5O 3C78X 1STPA 1U17A 2I5ZO 5EW5E 3E3CA 2GZFA 1YIVA 2WWPA 4Z6JA 3AEHA 2GYKA 1OEEA 2BSZA 2IZBA 2HMBA 4QYNA 4AZOA 5DCKA 1TXLA 3EW1A 2LA7A 2KORA 2JYGA 2CBRA 1I9HA 4EQAC 1X8NA 2PEIA 2GZEA 2R74A 1Q81Q 1JV4A 4O3WA 2A3FX 1YJ9P 2L67A 4B55A 2K23A 4ZHCA 4NLJA 1MX8A 5IRAA 3CMAP 2WUTA 4GK9A 3N91A 3D9WA 4XROA 3VG3A 4PSQA 1ZNLA 1IMQA 1SWQA 4U0FA 2OVEA 2IZJA 2X8TA 4OKAA 2ZSCA 1VKUA 2KG9A 2GDYA 1KXOA 1KQXA 1VYGA 2RTMA 1VWRB 3ZWEA 1UREA 2VFCA 2A8GA 1GKAA 3ELZA 3H47A 1B0OA 2RTOB 1MX7A 1T0VA 2OFBA 4MVEA 1SMPI 3RDMA 4IPYA 4U8UO 3CKFA 2Z45A 1LDOA 4WHIA 1PTSA 3NQ9A 1A3YA 1E2TA 5B10O 2M4LA 1G5WA 3ZW0A 5D45A 2JU1A 1M6NA 1NJIQ 2AT3X 2VLNA 3C77X 1BSOA 5HZ8A 2L68A 4IZ6A 3HWEA 2OVAA 5BVSA 4DQ3A 3D95A 1NQMA 3G1GA 1N0SA 2LBAA 1HMRA 1IMPA 1W2BO 3ELXA 2Y3FA 4RUNA 1G85A 2GZGA 4YFPA 2X32A 3FR2A 1HQBA 3CD6P 3VHIA 3ZUIA 1SWLA 1W6FA 1JBHA 1ICNA 1SXYA 3LMOA 5FFHA 1K24A 3WJFA 4TKJA 3MM0A 1LDQA 1LCWA 2X45A 4Y0RA 3I55P 2EIAA 1M74A 5FQ6E 2X2BA 2LKKA 3APVA 2YG2A 1RNIA 1W5RA 1TOWA 1EXSA 1CJ5A 5LKFA 2KOPA 4KCAA 1GGLA 4O4UA 3F8AA 1KGLA 3GKLC 2PEJA 2N6ZA 1LPJA 1DZKA 2M5RA 1GT4A 5HVCA 1HQQA 2X4MA 1SWTA 2W2BA 3HWGA 1SWBA 1DV9A 3RY2A 2OFRX 2BHVA 2E1MA 2HLVA
chains in the Genus database with same CATH topology
2A2UA 3S60A 2JU7A 4NNSA 4ORYA 3VE2A 4CV7A 3UEWA 1VQPP 2KT4B 4D6AA 4A8ZA 3PPTA 2ZAIA 2OZQA 2QO4A 1DZMA 5H8TA 1OBUA 3ZQ3A 2OTLP 1TW4A 1X89A 4YGGA 1VQ5P 2WQAE 3BRNA 2EG5A 4LKTA 4OMXA 3CQRA 4GETA 4BQUA 1B4MA 3BY0A 3OW2O 4U0BA 4ON1A 5F7GA 4MIRA 2WEWA 3P6FA 2M8LA 4GNWA 3P24A 4NYRA 3FYFA 2ANSA 3HWDA 5H9LA 4I9RA 2JN3A 4WFUA 1BM5A 1ERBA 2GC9A 2WEXA 5D4AA 1XKIA 2AT8X 3O22A 3Q6LA 3PH6A 3Q20A 1AB0A 1KT3A 3EBKA 4TLJA 4D6BA 5JR8A 3STMX 3ZW1B 1XCAA 3NX1A 1TVQA 5HCDC 3CC2P 3U03A 4GZVA 1E00A 3DS2A 2O62A 1AELA 4TQ2A 4NYQA 2CM9A 4IB9A 1RO0A 3JS1A 1AQBA 2R73A 3CXCO 4I6SA 2EU7X 4LKPA 3P6EA 1KC8Q 1RLBE 1QG5A 1E02A 1ZNDA 3G0VA 2FR3A 2FT9A 2IFBA 2N93A 3BU9A 4OMWA 2GTLM 2NNQA 3WJGA 4IB7A 5FAZA 1ML7A 1HBQA 4OS0A 3RSWA 1B56A 1VYFA 4ZHFA 1JYDA 5AEOA 4TKHA 1T8VA 4OS8A 3CC4P 5HGNA 4U8UM 4YCEA 2MWHA 3CWKA 4I3DA 5FQ7E 1ZNGA 1I04A 4ES7A 3NADA 3C76X 1GT5A 1LIDA 5HZ6A 1OBPA 4GE1A 4FGIB 1E06A 3CCMP 1SXXA 4IMOA 1IKJA 2MM3A 1EALA 4IB6A 5KICA 3FEKA 4KH8A 2NNDA 2QEXP 5KHPA 3U0DA 3B2LA 3UEXA 5HCEC 1YITP 1S7DA 4A1YA 3RWXA 1KQWA 1I4UA 1SA8A 1A57A 1LICA 4COTA 1O1UA 3DS1A 1ICMA 3WJCA 3LV4A 3LHNA 3HZQA 2WSJA 4QYPA 5F2KA 3WOVA 4ZGUA 2Z4HA 2MHDA 4IMNA 4DQ4A 2QO6A 4QRLA 3S5VA 3STNA 1BEBA 4GU8A 5HGLA 5IO6A 3UAQA 2XXMA 3FELA 1JYJA 1S2PA 3SAOA 1Y9LA 3IFBA 1MDCA 3ZUOA 3B5IA 4MVIA 5HZQA 1VQ8P 5CE4A 3FR4A 3B2IA 3PEDA 4BVMA 1YJWP 1T68X 3WJDA 3HWFA 3IA8A 3B2JA 1M6EX 1L6MA 4O4OA 2FWVA 2AKQA 4N7CA 3CCLP 1AUMA 2BS6A 3F9DA 3JSQA 1PEEA 1VQOP 1IKEA 4GRJA 4NW4A 5F6BA 4ZHGA 1DC9A 4ID2A 3OD9A 3UEUA 2JU3A 4L1NA 2Q9SA 1X8UA 4XMGA 2HZQA 4YH0A 1HMTA 1KOIA 4NNTA 4PH0A 2RN4A 3KZAA 4YKOA 3ZW2A 3VG4A 2RQ0A 5K06A 2XSTA 1JZUA 1GX8A 5F1EA 1PBOA 2Q39A 4I9SA 4O4XA 1BJ7A 1YP7A 2AMMX 1YIJP 1DZPA 3DS4A 1JIWI 1ZNKA 2MJIA 5HA1A 1OEJA 4TJZA 4YBUA 3P6CA 5LJHA 1SY0A 1D3SA 1EPBA 2QM9A 3PH5A 3CCEP 1MVGA 3CCRP 3HOEA 2Q2MA 2OVSA 4FBRA 4UU3A 4M0IA 1P6PA 2CBSA 3V8UA 2LF4A 2L9CA 4GH7A 4KC7A 5IO7A 1VPRA 2OFMX 5L8IA 4FQBB 3F6ZB 2Z46A 1HQPA 1KT7A 3BX8A 5H9NA 4AZPA 2WR6A 5F58A 3EM0A 3FA6A 2ACOA 2OARA 2FLJA 4ORSA 1PMPA 4IBAA 3WBGA 2JU8A 4AZQA 5HCCC 5LJBA 4IAWA 4YBPA 1EUOA 1UZ2X 3TF6A 3ZW0B 1YHQP 2XT1A 4GKCA 1LNMA 2F73A 4TNNA 3FENA 5LJGA 1PM1X 4WYMA 4ZFXA 1G74A 4YFQA 4EXZA 4O3XB 1ADLA 1KT4A 2E4JA 1EIOA 1YJNP 1VQMP 1K9MQ 1EI5A 2BT9A 3B2HA 4MVKA 5C0NA 5F2OA 4NLIA 3G28A 2G79A 1VQ4P 1D2UA 1QABE 1Y9TA 4U0CA 3P6DA 5H9AA 4QZTA 1B8EA 2M8NA 1QY0A 2F09A 5HZ5A 3LRYA 4N7DA 2FTBA 5F2NA 2PY1A 4O3ZA 5CYBA 1EIAA 3G6EP 1U18A 4INNA 3CCVP 5FQ8E 5B27A 1IFBA 2A2GA 5KIDA 1YP6A 1BRPA 5AJCA 3UEVA 5EZ2A 3WJBA 1GT1A 2LB6A 3ZI8A 3FIQA 1ALBA 3KQ0A 3NPOA 3WJEA 5B29A 3P6GA 1ACDA 2XV6A 4AW8A 4QGWA 2AT5X 1SY2A 3MBTA 1X8QA 1SXWA 1CBQA 4FBVA 3M1MA 4ML7B 4K19A 4QQ1A 3G21A 4CK4A 4GNYA 3BDRA 1Z24A 5D48A 3FR5A 1CBRA 1R0UA 3DS5A 1LIEA 5L8OA 2LBVA 3EBWA 1KQSO 4HWMA 4NP1A 3EYCA 1QFTA 1IIUA 5HTEA 1YI2P 4ARHA 4HPCA 4LQZA 4EEJA 1KD1Q 4O4SA 4Y0SA 3G29A 3BX7A 4COPA 5H9KA 4U0EA 2CZTA 4HPDA 4MVLA 2YMSA 4PH1A 2RD7C 2L5PA 3CCQP 1QVFO 2A13A 5LJKA 2ONTA 3VG5A 2L6EA 1VQLP 2X8SA 1QWDA 1VQ6P 2LFOA 3CQNA 3FW4A 2QO5A 3NBXX 3T1DA 1A18A 5I4TG 2K62A 2Z44A 2FRSA 1Q7YQ 5HGOA 4I95A 4O3YA 2W2AA 4ZCBA 4A1HA 2GJ5A 2PEMA 3CPWO 1CBSA 4YGZA 4GR2A 5JPAA 2G78A 3GAQA 1FENA 1OBQA 3NP1A 2AH7X 3RBYA 5IO5A 1HBPA 1X8OA 2KW1A 3S26A 1U0XA 3DTQA 3GE2A 5HWZA 3G26A 3HK1A 3OE3A 5EEDA 1KZWA 2CZUA 3EMMA 3C78X 3S5XA 3FMZA 2DM5A 4XMDA 2OVDA 4ZGFA 3U9PC 1I05A 1YUPA 3D4RA 5HAEA 5LJCA 2OTJP 2PY8A 1Q82Q 5BS2A 1U17A 3P6HA 2FS6A 5L8NA 3E3CA 2JW1A 4GDZA 1YWBA 3CCJP 4UU2A 1S44A 3H3IA 4AZRA 1YIVA 3WBHA 2WWPA 3HTYA 5EDCA 4ALOA 3CC7P 2HNXA 3AKNA 2ACPX 1OEEA 1RBPA 2CM4A 1EPAA 5BYPA 2RCTA 5BS1A 2HMBA 2PEQA 4ZH6A 4QYNA 3FA9A 3TZSA 5FENA 4AZOA 5DCKA 1TXLA 2LA7A 5HTDA 2JYGA 2CBRA 3PP6A 4EQAC 2AT0X 1Q86Q 2RCQA 1X8NA 1A43A 2PEIA 2R74A 4WBKA 1Q81Q 3DSZA 3OBLA 5BVQA 5HA0A 1JV4A 4O3WA 1O1VA 2A3FX 3VRLC 1QFVA 1LFOA 2X8FA 1YJ9P 2L67A 2HZRA 3CMPA 2K23A 1M1KQ 2A0AA 4I3BA 2JMBA 4ZHCA 4NLJA 1MX8A 2EFJA 3CMAP 3CMEP 1KT6A 2WUTA 2NNEA 4GK9A 3N91A 1MUPA 1OPAA 4HFOA 4XROA 1VQNP 3VG3A 4PSQA 5D47A 3TGBA 4QZUA 1KT5A 1ZNLA 5LKEA 5EDBA 3APXA 1G7NA 4HPBA 3AKMA 3CBCA 2G7BA 5AQ6A 4L3RA 1E6JP 4GR6A 2W2FA 4XMCA 3ZW1A 3VU1A 2DGYA 3MX7A 4U8UN 4EDEA 3NQ3A 1VQ9P 1A2DA 4QNBA 4XMFA 1JJJA 2BS5A 4A60A 4RUUA 2FS7A 4U0FA 4U0AA 1QY2A 2OVEA 2QOSC 3CR6A 4YMYA 4QNIA 2X8TA 4AYHA 3QKGA 4YCHA 3CCUP 4YDBA 1IUQA 1GM6A 3SOTA 1KXOA 1KQXA 3K3LA 1H91A 1VYGA 3O2YA 4HPAA 2AT6X 4YDAA 4ORRA 3ZWEA 3BS2A 3P02A 3KFIA 1UREA 1BWYA 3PECA 2KTSA 1GKAA 4R0BA 1BRQA 3H47A 3ELZA 3RG6C 4ALBA 4Y0PA 3NTEA 1B0OA 5EPQA 4BOEA 4QAEA 5DG4A 1MX7A 1T0VA 4MVEA 1SMPI 5F6ZA 4U3QA 1OEKA 1QVGO 4IPYA 4LZVA 4U8UO 2Z45A 3G1IA 4KIIA 4KC8A 2PEKA 4XFXA 4ORXA 3G71P 5LJDA 3VG7A 4WHIA 3DS3A 2GTLO 2GTFX 3HYBA 4ZR2A 4IB8A 4U0DA 1HMSA 3NR3A 4JGLA 3NQ9A 4MISA 1GX9A 1O8VA 1A3YA 2KD2A 4PJ2A 1ZMBA 3H0DA 1DFVA 4ZHHA 1BBPA 1QY1A 3TGCA 2M4LA 1SXUA 4YKMA 4AZMA 1G5WA 1GKAB 5AJBA 2Q2PA 4ODDA 4XFYA 3ZW0A 5D45A 1M6NA 1NJIQ 1LKEA 3P05A 3I56P 2AL0X 2AT3X 2CWOA 3C77X 3APUA 1NP4A 4O49A 1BSOA 5HZ8A 1SY1A 1EQDA 3FA8A 4KT5A 1LIFA 1ZNEA 2L68A 3DPHA 2NP1A 4QGXA 3HWEA 1DZJA 1E5PA 1AVGI 1FELA 4IAXA 1BSYA 1NGLA 2OVAA 5BVSA 2P9XA 1VQKP 2ZAGA 3D96A 4DQ3A 3TGAA 1QRJA 3D95A 3RZYA 4XRQA 3H4EA 1GT3A 2ASNX 2GTLN 3G1GA 1N0SA 5HZ9A 2LBAA 1HMRA 4I3CA 3VPJE 4ORUA 1W2BO 1BAJA 1I06A 3ELXA 4RUNA 4Y0QA 4EFGA 1X71A 1G85A 5HBSA 3BLGA 1HN2A 4YFRA 3STKA 3VG6A 1TOUA 2ALLX 1QQSA 1IW2A 3FEPA 1LIBA 4YFPA 3DTJA 4CSBA 1K30A 5BVTA 3FA7A 3FR2A 4LZUA 3CD6P 1CRBA 1EIIA 1IFCA 3B2KA 1X8PA 3ZUIA 1ZRYA 3O19A 1RO2A 3FLLA 4AZNA 1JBHA 2PEOA 2FR2A 2HLVA 4COCA 1ICNA 3D97A 3ZZVA 1SXYA 3WVMA 2QMIA 2KODA 3KFHA 5FFHA 3WJFA 1A8OA 4TKJA 4U9CA 1YWCA 2KTDA 1YWAA 1VQ7P 1S72P 1BSQA 2JYLA 1OPBA 3FW5A 3HOLA 3L4RA 3MVFA 1M90Q 2WQ9A 3NX2A 4O9SA 3WXQA 4FBOA 3JQOA 2X45A 4Y0RA 1CBIA 3VE1A 3I55P 1FDQA 2EIAA 1M74A 4XMHA 3BU1A 5FQ6E 3VG2A 2LKKA 3APVA 3APWA 2MO5A 4OS3A 4WFVA 4ORWA 2YG2A 1LF7A 1RNIA 1TOWA 1SY3A 2HYSA 1EXSA 5LJEA 1JJXA 1CJ5A 5LKFA 1ERXA 4XFZA 4KCAA 2M8PA 3MGEA 1GGLA 3G7XA 5EEEA 2PENA 1JJ2O 4O4UA 5D8JA 2XKLA 4IABA 2RA6A 1NP1A 3F8AA 3CBSA 3E2DA 3PQSA 3KFFA 2X46A 1KGLA 3RKGA 1YWDA 2P8GA 2PEJA 2Z4IA 2POAA 3CCSP 1LPJA 2BUOA 1DZKA 1DF3A 3BSZE 3I17A 1EOQA 2QA4P 1FTPA 1GT4A 2R56A 4ZH9A 4QGVA 4M6SA 1N8RQ 3DS0A 3NQKA 3I0AA 2JOZA 1ZNHA 2BLGA 1FE3A 1K8AQ 4ZHDA 2JO0A 1D1DA 4ZJ0A 3KFGA 2Q4NA 1K73Q 1EW3A 4M7MA 5DPQA 2W2BA 3HWGA 3OJYC 4TKBA 1DV9A 1KZXA 2OFRX 4XMEA 4YGHA 2BHVA 1BLRA 1GXAA 1FEMA 3PQUA 2E1MA 3G4SP 5HGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHV A;  3JQO A; 
#chains in the Genus database with same CATH topology
 2JU7 A;  4ORY A;  3UEW A;  7CEI A;  3WZP A;  3ZQ3 A;  1TW4 A;  4LKT A;  4OMX A;  4GET A;  3OW2 O;  4U0B A;  3P6F A;  2M8L A;  1RSU B;  4GNW A;  3RE5 A;  4I9R A;  5D4A A;  3O22 A;  4BBO A;  3Q20 A;  1KT3 A;  4TLJ A;  3RDS A;  5JR8 A;  2Y3E A;  1E00 A;  1SWF A;  4TQ2 A;  4IB9 A;  3JS1 A;  2DJG A;  1KC8 Q;  4NV8 A;  2LL8 A;  1ZND A;  3BU9 A;  2FT9 A;  1NDJ A;  1ML7 A;  3RSW A;  4ZHF A;  5AEO A;  5KP8 B;  3SLJ A;  1ZNG A;  3NAD A;  4GGZ A;  2N5I A;  1LID A;  4GE1 A;  1SXX A;  3CCM P;  1N9Y A;  4DCB A;  2MM3 A;  4IB6 A;  5KIC A;  2OYB O;  2QEX P;  1YIT P;  1S7D A;  4A1Y A;  2K0X A;  1I4U A;  4COT A;  3LHN A;  3WOV A;  5F2K A;  2FHL A;  2Z4H A;  5K67 A;  4GGR A;  2QO6 A;  2L4B A;  1BEB A;  5HGL A;  5IO6 A;  3UAQ A;  3ZUO A;  2ERH A;  5HZQ A;  2RTP B;  3PED A;  4BVM A;  5KP7 B;  4O4O A;  2FWV A;  1VWA B;  3CCL P;  5F6B A;  1FR2 A;  2KG6 A;  2N98 A;  1AVE A;  4NNT A;  3CKG A;  3ZW2 A;  5F1E A;  4BPG A;  1ZNV A;  4CDC A;  1Y0G A;  1YIJ P;  3DS4 A;  5HA1 A;  3B4Q A;  4TJZ A;  1SY0 A;  1EPB A;  3HOE A;  2KWL A;  1P6P A;  4GH7 A;  5L8I A;  4AZP A;  2KOQ A;  5F58 A;  1VWO B;  2FLJ A;  4IBA A;  4AZQ A;  5HCC C;  1UZ2 X;  1RST B;  3TF6 A;  2XT1 A;  4TNN A;  1G74 A;  4EXZ A;  4O3X B;  4MVK A;  4NLI A;  3G28 A;  1D2U A;  1Y9T A;  4U0C A;  2F09 A;  5HZ5 A;  2X56 A;  1SWO A;  5CYB A;  3G6E P;  1U18 A;  5CHK A;  1SLG B;  1NC9 A;  3ZI8 A;  1E0H A;  1ACD A;  1STS B;  4AW8 A;  4CPH A;  1VWJ B;  3GZM A;  3M1M A;  4K19 A;  1BXI A;  2RTH B;  3FR5 A;  1CBR A;  1LIE A;  3EBW A;  4NP1 A;  2CNR A;  1QFT A;  1IIU A;  5HTE A;  2KOS A;  2LML A;  2RD7 C;  2ONT A;  2L6E A;  1UJZ A;  1VQ6 P;  2BC3 A;  2EHS A;  1VYO A;  2RTF B;  1GX3 A;  4I95 A;  1VWI B;  3CPW O;  3GAQ A;  5IO5 A;  1NQ4 A;  4IRW A;  3S26 A;  1U0X A;  1KZW A;  3G26 A;  3S5X A;  3FMZ A;  2DM5 A;  3SZH A;  4XMD A;  5HAE A;  2DJF A;  4OEL A;  4GDZ A;  1YWB A;  1VWG B;  1WBI A;  3H3I A;  4AZR A;  3HTY A;  4ALO A;  1RBP A;  2CM4 A;  2N5H A;  2RCT A;  5BS1 A;  2PEQ A;  2IZG B;  2VLP A;  4R0M A;  5HTD A;  2KR5 A;  3PP6 A;  2AT0 X;  2A5B A;  1O1V A;  3VRL C;  1N7Y A;  3CMP A;  1M1K Q;  2A0A A;  4I3B A;  2JMB A;  2NNE A;  1MUP A;  1OPA A;  2IZF B;  2K5X A;  5EDB A;  3AKM A;  4L3R A;  4MEE A;  4GJS A;  2DGY A;  3MX7 A;  3NQ3 A;  2IZK A;  1A2D A;  4XMF A;  2I5V O;  4BX6 B;  4U0A A;  1QY2 A;  1F80 D;  1IUQ A;  2CGQ A;  2EHT A;  1HY2 A;  4YDA A;  2AT6 X;  4ORR A;  3P02 A;  1BWY A;  4PWV B;  1KFF A;  4BPH A;  2OF8 A;  3NTE A;  4Y0P A;  5DG4 A;  4CPE A;  4U3Q A;  1OEK A;  1LEL A;  4LZV A;  4XFX A;  4BX6 A;  1SWP A;  3DS3 A;  1KL4 A;  2GTF X;  3HYB A;  1HMS A;  3NR3 A;  1GX9 A;  1ZMB A;  3H0D A;  1DFV A;  4YKM A;  1GKA B;  5AJB A;  4ODD A;  4XFY A;  3P05 A;  3I56 P;  2CWO A;  3FA8 A;  4KT5 A;  1ZNE A;  3DPH A;  2MY5 A;  2RTG B;  1AVG I;  1BSY A;  3D96 A;  1JMZ A;  4XRQ A;  3H4E A;  1HXZ A;  3VPJ E;  1BAJ A;  1JQP A;  1OR5 A;  4EFG A;  1X71 A;  5HBS A;  3BLG A;  4YFR A;  3STK A;  3VG6 A;  1TOU A;  3FID A;  2ALL X;  3FEP A;  1LIB A;  3DTJ A;  4CSB A;  1K30 A;  5BVT A;  3FA7 A;  4LZU A;  3B2K A;  1X8P A;  1ZRY A;  1RO2 A;  3QQ2 A;  2PEO A;  2FR2 A;  3WVM A;  2QMI A;  2KOD A;  1A8O A;  4U9C A;  2JYL A;  3MVF A;  2WQ9 A;  3WXQ A;  1CBI A;  1I78 A;  4OS3 A;  3APW A;  2L22 A;  5IRW A;  1OSP O;  2M8P A;  2C4I A;  3G7X A;  4IAB A;  2RA6 A;  3CBS A;  3E2D A;  3PQS A;  3RKG A;  2Z4I A;  1DF3 A;  1Z6M A;  3BSZ E;  3I17 A;  2R56 A;  1FTP A;  4QGV A;  1SRJ A;  2XZ0 D;  1ZNH A;  2BLG A;  1K8A Q;  4ZHD A;  1D1D A;  1SWN A;  3RY1 A;  4ZJ0 A;  3KFG A;  1K73 Q;  1EW3 A;  3OJY C;  4XME A;  1N43 A;  1BLR A;  3GZL A;  2A2U A;  3VE2 A;  2ZAI A;  2MVV A;  1DZM A;  1OBU A;  1X89 A;  2WQA E;  3CQR A;  4BQU A;  1B4M A;  2RTK A;  4ON1 A;  2GDW A;  4NYR A;  4WFU A;  1BM5 A;  2AT8 X;  2RTC B;  1VWH B;  3STM X;  3ZW1 B;  5HCD C;  2O62 A;  1SLE B;  1RXJ A;  2R73 A;  1W4T A;  4I6S A;  2EU7 X;  1RLB E;  2K94 A;  2IFB A;  2FR3 A;  3WJG A;  2GTL M;  2NNQ A;  4Y59 A;  2VDF A;  4Z2O A;  1VYF A;  4TKH A;  1T8V A;  4BX7 B;  3CWK A;  3PDF A;  5FQ7 E;  3AUM O;  5HZ6 A;  1OBP A;  4FGI B;  1E06 A;  4IMO A;  1IKJ A;  1FJ1 E;  3WYP A;  1L0I A;  1SWU A;  1DV5 A;  4KH8 A;  2NND A;  5KHP A;  3B2L A;  3UEX A;  3VHM A;  1KQW A;  3LV4 A;  4ZGU A;  1SRH A;  4QRL A;  3STN A;  1SWC A;  3SAO A;  3EJB A;  3IFB A;  1MDC A;  4UHP B;  2WPU A;  3HWF A;  3IA8 A;  1M6E X;  2BS6 A;  1VQO P;  3LTW A;  1DC9 A;  4ID2 A;  3SLT A;  2X34 A;  4YKO A;  5K06 A;  4I9S A;  1JIW I;  2KOO A;  5LJH A;  1D3S A;  2FVA A;  2QM9 A;  3Q34 A;  2IZA A;  1MVG A;  2OVS A;  4PXH B;  4FBR A;  4UU3 A;  3V8U A;  1VPR A;  4FQB B;  5EJD A;  3F6Z B;  2Z46 A;  1HQP A;  3BX8 A;  2ACO A;  2OAR A;  5LJB A;  4YBP A;  4JHQ A;  1YHQ P;  1LNM A;  3FEN A;  1JJU A;  1SWR A;  1EIO A;  1YJN P;  1EI5 A;  1K9M Q;  3P6D A;  1QAB E;  1UYN X;  2IZL B;  2M8N A;  4O3Z A;  1EIA A;  5K68 A;  1RXK A;  2A2G A;  1YP6 A;  1BRP A;  1GT1 A;  1ALB A;  5B29 A;  2AT5 X;  3MBT A;  1SXW A;  1CBQ A;  4FBV A;  2IZC B;  1Z24 A;  3KVN A;  2LBV A;  2MD9 A;  1KQS O;  2IZD B;  4HPC A;  3WZO A;  4LQZ A;  4EEJ A;  3RDQ A;  3VHH A;  3G29 A;  4CDD A;  4COP A;  4U0E A;  2JU2 A;  2OY7 A;  2CZT A;  4MVL A;  3RDO A;  1QVF O;  3FDC A;  2A13 A;  5LJK A;  1VQL P;  2X8S A;  1VWC B;  2QO5 A;  2Z44 A;  1Q7Y Q;  5HGO A;  4O3Y A;  4YGZ A;  4H2W C;  4GR2 A;  1VWN B;  3RBY A;  1OBQ A;  1MEP A;  1LUQ A;  3OE3 A;  5EED A;  4GGT A;  2OVD A;  4ZGF A;  5LJC A;  2OTJ P;  2PY8 A;  1Q82 Q;  3P6H A;  5L8N A;  2JW1 A;  4UU2 A;  2CAM A;  1S44 A;  3WBH A;  5EDC A;  2HNX A;  3AKN A;  2N50 A;  2RTQ B;  3TZS A;  1NBX A;  2JAZ A;  4WBK A;  5BVQ A;  4JO6 A;  5HA0 A;  1RAV A;  1LFO A;  1GPJ A;  2EFJ A;  3CME P;  3EJD A;  4HFO A;  1VQN P;  3TGB A;  2RTD B;  4QZU A;  1G7N A;  5AQ6 A;  2W2F A;  4EDE A;  2AFE A;  4QNB A;  4A60 A;  2MF4 A;  4RUU A;  1SRE A;  1VHN A;  2LIW A;  3CR6 A;  4YMY A;  4AYH A;  4YCH A;  3CCU P;  4YDB A;  2AF8 A;  3SOT A;  3K3L A;  3HPE A;  1H91 A;  3O2Y A;  3KFI A;  3PEC A;  2IZH B;  2G8C O;  4EKV A;  4R0B A;  1BRQ A;  3RG6 C;  4ALB A;  3RG2 A;  2PEK A;  4ORX A;  3G71 P;  2OL8 O;  1VWB B;  2GTL O;  3WYQ A;  4ZR2 A;  2QOM A;  4Z2V A;  1STR B;  4MIS A;  4PJ2 A;  1BBP A;  1QY1 A;  3TGC A;  4AZM A;  4CA3 A;  1LKE A;  5IXG A;  2AL0 X;  4O49 A;  1LIF A;  2NP1 A;  2FQ1 A;  1FEL A;  2P9X A;  1VQK P;  2ZAG A;  3RZY A;  2LKI A;  1GT3 A;  2ASN X;  2GTL N;  4NEO A;  4I3C A;  3T2W A;  4ORU A;  4Y0Q A;  2L0Q A;  1QQS A;  1IW2 A;  1UNK A;  1EII A;  1ACP A;  1CRB A;  1IFC A;  3O19 A;  1VWE B;  4COC A;  5B5F A;  1S72 P;  1BSQ A;  2CG5 B;  3L4R A;  3HOL A;  3NX2 A;  4O9S A;  4FBO A;  3JQO A;  2RTN B;  2AF5 A;  3VE1 A;  3SLO A;  2RTJ A;  2MO5 A;  4I60 A;  1LF7 A;  1SY3 A;  2HYS A;  5LJE A;  1JJX A;  1ERX A;  4XFZ A;  2GZI A;  3MGE A;  1JJ2 O;  2OL6 O;  5D8J A;  2XKL A;  1NP1 A;  2X46 A;  2POA A;  2LIU A;  2BUO A;  2DNW A;  3SZI A;  2QA4 P;  1DF8 A;  3DS0 A;  2K93 A;  3NQK A;  3I0A A;  2JO0 A;  2Q4N A;  5DPQ A;  4M7M A;  1VWD B;  4TKB A;  4YGH A;  1GXA A;  1FEM A;  3PQU A;  2GH7 A;  4NNS A;  1VQP P;  1SWH A;  2KT4 B;  4D6A A;  2QO4 A;  2OTL P;  5B11 O;  3MG5 A;  3BRN A;  2PI3 O;  3BY0 A;  3P24 A;  1VWQ B;  2ANS A;  1SWJ A;  2F01 A;  1ERB A;  3T6F A;  4D6B A;  3NX1 A;  3CC2 P;  2VFB A;  4GZV A;  3DS2 A;  4CDF A;  1AEL A;  2CM9 A;  1AQB A;  2AFD A;  4DG9 A;  1QG5 A;  3G0V A;  1NQN A;  4IB7 A;  5FAZ A;  1B56 A;  1JYD A;  2KGC A;  4OS8 A;  3CC4 P;  5HGN A;  4YCE A;  2MWH A;  2FKJ A;  4I3D A;  2ROQ A;  1T8K A;  3U0D A;  5HCE C;  3RWX A;  1SA8 A;  1N4J A;  1O1U A;  3DS1 A;  1ICM A;  3WJC A;  1VWK B;  2WSJ A;  4QYP A;  4H2X C;  4CDE A;  2X55 A;  4IMN A;  4BX7 A;  4DQ4 A;  3T2X A;  2XXM A;  1JYJ A;  5CZD B;  4MVI A;  5CE4 A;  3FR4 A;  2RTR B;  3B2I A;  1T68 X;  3WJD A;  2MR7 A;  4CPH B;  3B2J A;  1L6M A;  3F9D A;  4NW4 A;  4ZHG A;  3OD9 A;  3UEU A;  2Q9S A;  1X8U A;  4BJ8 A;  1KOI A;  3KZA A;  2XST A;  1MM9 A;  1JZU A;  1PBO A;  2Q39 A;  5B3M O;  4O4X A;  2AMM X;  1DZP A;  2MJI A;  1VWL B;  4H2Y C;  3P6C A;  3PH5 A;  2Q2M A;  4M0I A;  2CBS A;  2L9C A;  1SRI A;  4KC7 A;  5IO7 A;  2OY8 A;  3RE6 A;  1SWE A;  1KT7 A;  5HV8 A;  1VWF B;  3FA6 A;  2VLQ A;  5IRU A;  4Z28 A;  2JU8 A;  3WBG A;  4IAW A;  1SWD A;  2RTE B;  1EUO A;  3ZW0 B;  3U43 A;  2F73 A;  4WYM A;  4YFQ A;  1ADL A;  1KT4 A;  2E4J A;  2BT9 A;  1VQM P;  5C0N A;  3B2H A;  4C5P A;  2G79 A;  1B8E A;  5F2N A;  2PY1 A;  5B27 A;  1IFB A;  5AJC A;  3FIQ A;  3KQ0 A;  3NPO A;  2XV6 A;  4QGW A;  1SY2 A;  4QQ1 A;  4CK4 A;  4NV7 A;  3BDR A;  2L9F A;  5D48 A;  1RXH A;  2OF9 A;  3BX7 A;  1AVD A;  4HPD A;  1KL3 A;  2YMS A;  2FQ2 A;  2L5P A;  3CCQ P;  3RDU A;  2QCB A;  3VG5 A;  1QWD A;  3CQN A;  3FW4 A;  2WPT A;  2K92 A;  3T1D A;  1A18 A;  2IZE B;  2K62 A;  2FRS A;  4MRT C;  4A1H A;  1Y52 X;  1CBS A;  2FAC A;  3NP1 A;  2AH7 X;  2KW1 A;  3HK1 A;  2CZU A;  2G5L A;  4Z27 A;  3SZJ A;  3U9P C;  1I05 A;  1YUP A;  3D4R A;  1VWP B;  5BS2 A;  1MK5 A;  2FS6 A;  3CCJ P;  3CC7 P;  2ACP X;  1EPA A;  5BYP A;  4ZH6 A;  3FA9 A;  5FEN A;  2KGA A;  1Q86 Q;  2RCQ A;  1A43 A;  2C1S A;  3DSZ A;  3OBL A;  1WUB A;  5KP6 B;  2X8F A;  1QFV A;  4GDA A;  2HZR A;  1LCZ A;  2OFA A;  1KT6 A;  3WZQ A;  5D47 A;  1PBY A;  1KT5 A;  2UZ2 A;  5LKE A;  4JNJ A;  3APX A;  4HPB A;  3CBC A;  2G7B A;  2MVU A;  1E6J P;  4GR6 A;  2MF6 A;  4XMC A;  3ZW1 A;  3VU1 A;  4U8U N;  1VQ9 P;  2GDX A;  1JJJ A;  2BS5 A;  2FS7 A;  2QOS C;  2JB0 A;  2K0Y A;  4QNI A;  3QKG A;  2QNW A;  1GM6 A;  2JGS A;  5L3Y A;  4HPA A;  2RTA A;  3BS2 A;  2KTS A;  2FQ0 A;  5EPQ A;  4BOE A;  4QAE A;  2KW2 A;  5F6Z A;  1QVG O;  3G1I A;  2VLO A;  4KII A;  4KC8 A;  5LJD A;  3VG7 A;  4OEM A;  4IB8 A;  4U0D A;  4JGL A;  2KD2 A;  1O8V A;  1HY8 A;  3VGW A;  4CPI A;  1X3O A;  1LCV A;  4ZHH A;  5CSE A;  1SXU A;  2IZI A;  2Q2P A;  4GD9 A;  3GJN A;  2K0D X;  2JQ4 A;  1GXG A;  2LTE A;  2HKD A;  3APU A;  1NP4 A;  1SY1 A;  1EQD A;  1AF8 A;  4QGX A;  1DZJ A;  1E5P A;  4IAX A;  1NGL A;  4Y5D A;  3TGA A;  1QRJ A;  1SWG A;  5HZ9 A;  1I06 A;  2MR8 A;  1HN2 A;  3RDX A;  3T6L A;  1KLP A;  3FLL A;  4AZN A;  1SRF A;  2OY1 O;  2JBG A;  3D97 A;  3ZZV A;  2A5C A;  3KFH A;  1YWC A;  2KTD A;  1YWA A;  1VQ7 P;  1OPB A;  2FKG A;  3FW5 A;  1SLD B;  1M90 Q;  1FDQ A;  4XMH A;  3BU1 A;  1SWS A;  3VG2 A;  4WFV A;  1AYI A;  4ORW A;  2FHS C;  5EEE A;  2PEN A;  3KFF A;  5B2A O;  1YWD A;  2P8G A;  3CCS P;  4GUZ A;  1EOQ A;  4ZH9 A;  1SWK A;  4M6S A;  1N8R Q;  2JOZ A;  1FE3 A;  1KZX A;  1HXL A;  2RTB B;  4QKO A;  1Y55 X;  5HGM A;  3S60 A;  3PK2 A;  4CV7 A;  4BX5 A;  4BPF A;  4A8Z A;  3PPT A;  2OZQ A;  5H8T A;  2JGP A;  3NY7 B;  1VQ5 P;  2NO8 A;  4YGG A;  2EG5 A;  1SWA A;  2RTL A;  5F7G A;  4MIR A;  2AVI A;  2WEW A;  3FYF A;  3HWD A;  5F2B A;  5H9L A;  2JN3 A;  2GC9 A;  2WEX A;  2GZJ A;  1XKI A;  1KL5 A;  3Q6L A;  3PH6 A;  3EBK A;  1AB0 A;  3EC5 A;  1XCA A;  1TVQ A;  3U03 A;  4BX5 B;  4NYQ A;  1RO0 A;  3CXC O;  4LKP A;  3P6E A;  2OL7 A;  1E02 A;  2N93 A;  4OMW A;  1HBQ A;  4OS0 A;  3X00 A;  3G4S P;  4U8U M;  4HKG A;  4BCS A;  1I04 A;  4ES7 A;  3C76 X;  1GT5 A;  2FVF A;  1EAL A;  3FEK A;  1JMX A;  1SRG A;  1A57 A;  1LIC A;  3HZQ A;  2VSQ A;  2MHD A;  3S5V A;  4GU8 A;  3WZN A;  3FEL A;  1S2P A;  1Y9L A;  3B5I A;  2KG8 A;  1VQ8 P;  4Z2P A;  1YJW P;  2KGE A;  1SLF B;  2AKQ A;  4N7C A;  1AUM A;  3JSQ A;  1PEE A;  4GRJ A;  1IKE A;  2RTI B;  1K3B A;  2JU3 A;  4L1N A;  4XMG A;  1GXH A;  2K2Q A;  2HZQ A;  4YH0 A;  1HMT A;  4PH0 A;  2RN4 A;  3VG4 A;  2FGS A;  2RQ0 A;  1GX8 A;  1DNY A;  1BJ7 A;  1YP7 A;  2PNG A;  1EMV A;  1UYO X;  1ZNK A;  1OEJ A;  4YBU A;  3CCE P;  2CQ8 A;  3CCR P;  1MOY A;  4GJV A;  1VWM B;  2LF4 A;  2OFM X;  5H9N A;  2WR6 A;  3EM0 A;  4ORS A;  1PMP A;  4U46 A;  5LJG A;  4GKC A;  2FVE A;  1PM1 X;  4ZFX A;  4YVB A;  5F2O A;  1Y53 X;  5H9A A;  1VQ4 P;  4QZT A;  1QY0 A;  3LRY A;  4N7D A;  2FTB A;  3CE7 A;  4INN A;  5FQ8 E;  3CCV P;  5KID A;  1L0H A;  3UEV A;  5EZ2 A;  3WJB A;  2LB6 A;  3WJE A;  3P6G A;  1N9M A;  1X8Q A;  4ML7 B;  4DNE A;  3G21 A;  3EW2 A;  4GNY A;  2LPK A;  4BGF A;  1R0U A;  3DS5 A;  5L8O A;  4HWM A;  5B5G A;  3EYC A;  2N6Y A;  1YI2 P;  4ARH A;  2Y32 A;  1KD1 Q;  4O4S A;  4Y0S A;  2FAE A;  2AVA A;  5H9K A;  1MZ8 A;  4PH1 A;  4F37 A;  2LOL A;  3EJE A;  2XZ1 C;  2KGD A;  2LFO A;  3NBX X;  4CPF A;  5JD2 A;  2C1Q A;  5I4T G;  1CEI A;  4ZCB A;  2W2A A;  2GJ5 A;  2PEM A;  1IJ8 A;  5JPA A;  2FHN X;  2G78 A;  2UYW A;  1FEN A;  1HBP A;  1X8O A;  3DTQ A;  3GE2 A;  5HWZ A;  2FAD A;  3EMM A;  2OY5 O;  3C78 X;  1STP A;  1U17 A;  2I5Z O;  5EW5 E;  3E3C A;  2GZF A;  1YIV A;  2WWP A;  4Z6J A;  3AEH A;  2GYK A;  1OEE A;  2BSZ A;  2IZB A;  2HMB A;  4QYN A;  4AZO A;  5DCK A;  1TXL A;  3EW1 A;  2LA7 A;  2KOR A;  2JYG A;  2CBR A;  1I9H A;  4EQA C;  1X8N A;  2PEI A;  2GZE A;  2R74 A;  1Q81 Q;  1JV4 A;  4O3W A;  2A3F X;  1YJ9 P;  2L67 A;  4B55 A;  2K23 A;  4ZHC A;  4NLJ A;  1MX8 A;  5IRA A;  3CMA P;  2WUT A;  4GK9 A;  3N91 A;  3D9W A;  4XRO A;  3VG3 A;  4PSQ A;  1ZNL A;  1IMQ A;  1SWQ A;  4U0F A;  2OVE A;  2IZJ A;  2X8T A;  4OKA A;  2ZSC A;  1VKU A;  2KG9 A;  2GDY A;  1KXO A;  1KQX A;  1VYG A;  2RTM A;  1VWR B;  3ZWE A;  1URE A;  2VFC A;  2A8G A;  1GKA A;  3ELZ A;  3H47 A;  1B0O A;  2RTO B;  1MX7 A;  1T0V A;  2OFB A;  4MVE A;  1SMP I;  3RDM A;  4IPY A;  4U8U O;  3CKF A;  2Z45 A;  1LDO A;  4WHI A;  1PTS A;  3NQ9 A;  1A3Y A;  1E2T A;  5B10 O;  2M4L A;  1G5W A;  3ZW0 A;  5D45 A;  2JU1 A;  1M6N A;  1NJI Q;  2AT3 X;  2VLN A;  3C77 X;  1BSO A;  5HZ8 A;  2L68 A;  4IZ6 A;  3HWE A;  2OVA A;  5BVS A;  4DQ3 A;  3D95 A;  1NQM A;  3G1G A;  1N0S A;  2LBA A;  1HMR A;  1IMP A;  1W2B O;  3ELX A;  2Y3F A;  4RUN A;  1G85 A;  2GZG A;  4YFP A;  2X32 A;  3FR2 A;  1HQB A;  3CD6 P;  3VHI A;  3ZUI A;  1SWL A;  1W6F A;  1JBH A;  1ICN A;  1SXY A;  3LMO A;  5FFH A;  1K24 A;  3WJF A;  4TKJ A;  3MM0 A;  1LDQ A;  1LCW A;  2X45 A;  4Y0R A;  3I55 P;  2EIA A;  1M74 A;  5FQ6 E;  2X2B A;  2LKK A;  3APV A;  2YG2 A;  1RNI A;  1W5R A;  1TOW A;  1EXS A;  1CJ5 A;  5LKF A;  2KOP A;  4KCA A;  1GGL A;  4O4U A;  3F8A A;  1KGL A;  3GKL C;  2PEJ A;  2N6Z A;  1LPJ A;  1DZK A;  2M5R A;  1GT4 A;  5HVC A;  1HQQ A;  2X4M A;  1SWT A;  2W2B A;  3HWG A;  1SWB A;  1DV9 A;  3RY2 A;  2OFR X;  2BHV A;  2E1M A;  2HLV A; 
#chains in the Genus database with same CATH homology
 2A2U A;  3S60 A;  2JU7 A;  4NNS A;  4ORY A;  3VE2 A;  4CV7 A;  3UEW A;  1VQP P;  2KT4 B;  4D6A A;  4A8Z A;  3PPT A;  2ZAI A;  2OZQ A;  2QO4 A;  1DZM A;  5H8T A;  1OBU A;  3ZQ3 A;  2OTL P;  1TW4 A;  1X89 A;  4YGG A;  1VQ5 P;  2WQA E;  3BRN A;  2EG5 A;  4LKT A;  4OMX A;  3CQR A;  4GET A;  4BQU A;  1B4M A;  3BY0 A;  3OW2 O;  4U0B A;  4ON1 A;  5F7G A;  4MIR A;  2WEW A;  3P6F A;  2M8L A;  4GNW A;  3P24 A;  4NYR A;  3FYF A;  2ANS A;  3HWD A;  5H9L A;  4I9R A;  2JN3 A;  4WFU A;  1BM5 A;  1ERB A;  2GC9 A;  2WEX A;  5D4A A;  1XKI A;  2AT8 X;  3O22 A;  3Q6L A;  3PH6 A;  3Q20 A;  1AB0 A;  1KT3 A;  3EBK A;  4TLJ A;  4D6B A;  5JR8 A;  3STM X;  3ZW1 B;  1XCA A;  3NX1 A;  1TVQ A;  5HCD C;  3CC2 P;  3U03 A;  4GZV A;  1E00 A;  3DS2 A;  2O62 A;  1AEL A;  4TQ2 A;  4NYQ A;  2CM9 A;  4IB9 A;  1RO0 A;  3JS1 A;  1AQB A;  2R73 A;  3CXC O;  4I6S A;  2EU7 X;  4LKP A;  3P6E A;  1KC8 Q;  1RLB E;  1QG5 A;  1E02 A;  1ZND A;  3G0V A;  2FR3 A;  2FT9 A;  2IFB A;  2N93 A;  3BU9 A;  4OMW A;  2GTL M;  2NNQ A;  3WJG A;  4IB7 A;  5FAZ A;  1ML7 A;  1HBQ A;  4OS0 A;  3RSW A;  1B56 A;  1VYF A;  4ZHF A;  1JYD A;  5AEO A;  4TKH A;  1T8V A;  4OS8 A;  3CC4 P;  5HGN A;  4U8U M;  4YCE A;  2MWH A;  3CWK A;  4I3D A;  5FQ7 E;  1ZNG A;  1I04 A;  4ES7 A;  3NAD A;  3C76 X;  1GT5 A;  1LID A;  5HZ6 A;  1OBP A;  4GE1 A;  4FGI B;  1E06 A;  3CCM P;  1SXX A;  4IMO A;  1IKJ A;  2MM3 A;  1EAL A;  4IB6 A;  5KIC A;  3FEK A;  4KH8 A;  2NND A;  2QEX P;  5KHP A;  3U0D A;  3B2L A;  3UEX A;  5HCE C;  1YIT P;  1S7D A;  4A1Y A;  3RWX A;  1KQW A;  1I4U A;  1SA8 A;  1A57 A;  1LIC A;  4COT A;  1O1U A;  3DS1 A;  1ICM A;  3WJC A;  3LV4 A;  3LHN A;  3HZQ A;  2WSJ A;  4QYP A;  5F2K A;  3WOV A;  4ZGU A;  2Z4H A;  2MHD A;  4IMN A;  4DQ4 A;  2QO6 A;  4QRL A;  3S5V A;  3STN A;  1BEB A;  4GU8 A;  5HGL A;  5IO6 A;  3UAQ A;  2XXM A;  3FEL A;  1JYJ A;  1S2P A;  3SAO A;  1Y9L A;  3IFB A;  1MDC A;  3ZUO A;  3B5I A;  4MVI A;  5HZQ A;  1VQ8 P;  5CE4 A;  3FR4 A;  3B2I A;  3PED A;  4BVM A;  1YJW P;  1T68 X;  3WJD A;  3HWF A;  3IA8 A;  3B2J A;  1M6E X;  1L6M A;  4O4O A;  2FWV A;  2AKQ A;  4N7C A;  3CCL P;  1AUM A;  2BS6 A;  3F9D A;  3JSQ A;  1PEE A;  1VQO P;  1IKE A;  4GRJ A;  4NW4 A;  5F6B A;  4ZHG A;  1DC9 A;  4ID2 A;  3OD9 A;  3UEU A;  2JU3 A;  4L1N A;  2Q9S A;  1X8U A;  4XMG A;  2HZQ A;  4YH0 A;  1HMT A;  1KOI A;  4NNT A;  4PH0 A;  2RN4 A;  3KZA A;  4YKO A;  3ZW2 A;  3VG4 A;  2RQ0 A;  5K06 A;  2XST A;  1JZU A;  1GX8 A;  5F1E A;  1PBO A;  2Q39 A;  4I9S A;  4O4X A;  1BJ7 A;  1YP7 A;  2AMM X;  1YIJ P;  1DZP A;  3DS4 A;  1JIW I;  1ZNK A;  2MJI A;  5HA1 A;  1OEJ A;  4TJZ A;  4YBU A;  3P6C A;  5LJH A;  1SY0 A;  1D3S A;  1EPB A;  2QM9 A;  3PH5 A;  3CCE P;  1MVG A;  3CCR P;  3HOE A;  2Q2M A;  2OVS A;  4FBR A;  4UU3 A;  4M0I A;  1P6P A;  2CBS A;  3V8U A;  2LF4 A;  2L9C A;  4GH7 A;  4KC7 A;  5IO7 A;  1VPR A;  2OFM X;  5L8I A;  4FQB B;  3F6Z B;  2Z46 A;  1HQP A;  1KT7 A;  3BX8 A;  5H9N A;  4AZP A;  2WR6 A;  5F58 A;  3EM0 A;  3FA6 A;  2ACO A;  2OAR A;  2FLJ A;  4ORS A;  1PMP A;  4IBA A;  3WBG A;  2JU8 A;  4AZQ A;  5HCC C;  5LJB A;  4IAW A;  4YBP A;  1EUO A;  1UZ2 X;  3TF6 A;  3ZW0 B;  1YHQ P;  2XT1 A;  4GKC A;  1LNM A;  2F73 A;  4TNN A;  3FEN A;  5LJG A;  1PM1 X;  4WYM A;  4ZFX A;  1G74 A;  4YFQ A;  4EXZ A;  4O3X B;  1ADL A;  1KT4 A;  2E4J A;  1EIO A;  1YJN P;  1VQM P;  1K9M Q;  1EI5 A;  2BT9 A;  3B2H A;  4MVK A;  5C0N A;  5F2O A;  4NLI A;  3G28 A;  2G79 A;  1VQ4 P;  1D2U A;  1QAB E;  1Y9T A;  4U0C A;  3P6D A;  5H9A A;  4QZT A;  1B8E A;  2M8N A;  1QY0 A;  2F09 A;  5HZ5 A;  3LRY A;  4N7D A;  2FTB A;  5F2N A;  2PY1 A;  4O3Z A;  5CYB A;  1EIA A;  3G6E P;  1U18 A;  4INN A;  3CCV P;  5FQ8 E;  5B27 A;  1IFB A;  2A2G A;  5KID A;  1YP6 A;  1BRP A;  5AJC A;  3UEV A;  5EZ2 A;  3WJB A;  1GT1 A;  2LB6 A;  3ZI8 A;  3FIQ A;  1ALB A;  3KQ0 A;  3NPO A;  3WJE A;  5B29 A;  3P6G A;  1ACD A;  2XV6 A;  4AW8 A;  4QGW A;  2AT5 X;  1SY2 A;  3MBT A;  1X8Q A;  1SXW A;  1CBQ A;  4FBV A;  3M1M A;  4ML7 B;  4K19 A;  4QQ1 A;  3G21 A;  4CK4 A;  4GNY A;  3BDR A;  1Z24 A;  5D48 A;  3FR5 A;  1CBR A;  1R0U A;  3DS5 A;  1LIE A;  5L8O A;  2LBV A;  3EBW A;  1KQS O;  4HWM A;  4NP1 A;  3EYC A;  1QFT A;  1IIU A;  5HTE A;  1YI2 P;  4ARH A;  4HPC A;  4LQZ A;  4EEJ A;  1KD1 Q;  4O4S A;  4Y0S A;  3G29 A;  3BX7 A;  4COP A;  5H9K A;  4U0E A;  2CZT A;  4HPD A;  4MVL A;  2YMS A;  4PH1 A;  2RD7 C;  2L5P A;  3CCQ P;  1QVF O;  2A13 A;  5LJK A;  2ONT A;  3VG5 A;  2L6E A;  1VQL P;  2X8S A;  1QWD A;  1VQ6 P;  2LFO A;  3CQN A;  3FW4 A;  2QO5 A;  3NBX X;  3T1D A;  1A18 A;  5I4T G;  2K62 A;  2Z44 A;  2FRS A;  1Q7Y Q;  5HGO A;  4I95 A;  4O3Y A;  2W2A A;  4ZCB A;  4A1H A;  2GJ5 A;  2PEM A;  3CPW O;  1CBS A;  4YGZ A;  4GR2 A;  5JPA A;  2G78 A;  3GAQ A;  1FEN A;  1OBQ A;  3NP1 A;  2AH7 X;  3RBY A;  5IO5 A;  1HBP A;  1X8O A;  2KW1 A;  3S26 A;  1U0X A;  3DTQ A;  3GE2 A;  5HWZ A;  3G26 A;  3HK1 A;  3OE3 A;  5EED A;  1KZW A;  2CZU A;  3EMM A;  3C78 X;  3S5X A;  3FMZ A;  2DM5 A;  4XMD A;  2OVD A;  4ZGF A;  3U9P C;  1I05 A;  1YUP A;  3D4R A;  5HAE A;  5LJC A;  2OTJ P;  2PY8 A;  1Q82 Q;  5BS2 A;  1U17 A;  3P6H A;  2FS6 A;  5L8N A;  3E3C A;  2JW1 A;  4GDZ A;  1YWB A;  3CCJ P;  4UU2 A;  1S44 A;  3H3I A;  4AZR A;  1YIV A;  3WBH A;  2WWP A;  3HTY A;  5EDC A;  4ALO A;  3CC7 P;  2HNX A;  3AKN A;  2ACP X;  1OEE A;  1RBP A;  2CM4 A;  1EPA A;  5BYP A;  2RCT A;  5BS1 A;  2HMB A;  2PEQ A;  4ZH6 A;  4QYN A;  3FA9 A;  3TZS A;  5FEN A;  4AZO A;  5DCK A;  1TXL A;  2LA7 A;  5HTD A;  2JYG A;  2CBR A;  3PP6 A;  4EQA C;  2AT0 X;  1Q86 Q;  2RCQ A;  1X8N A;  1A43 A;  2PEI A;  2R74 A;  4WBK A;  1Q81 Q;  3DSZ A;  3OBL A;  5BVQ A;  5HA0 A;  1JV4 A;  4O3W A;  1O1V A;  2A3F X;  3VRL C;  1QFV A;  1LFO A;  2X8F A;  1YJ9 P;  2L67 A;  2HZR A;  3CMP A;  2K23 A;  1M1K Q;  2A0A A;  4I3B A;  2JMB A;  4ZHC A;  4NLJ A;  1MX8 A;  2EFJ A;  3CMA P;  3CME P;  1KT6 A;  2WUT A;  2NNE A;  4GK9 A;  3N91 A;  1MUP A;  1OPA A;  4HFO A;  4XRO A;  1VQN P;  3VG3 A;  4PSQ A;  5D47 A;  3TGB A;  4QZU A;  1KT5 A;  1ZNL A;  5LKE A;  5EDB A;  3APX A;  1G7N A;  4HPB A;  3AKM A;  3CBC A;  2G7B A;  5AQ6 A;  4L3R A;  1E6J P;  4GR6 A;  2W2F A;  4XMC A;  3ZW1 A;  3VU1 A;  2DGY A;  3MX7 A;  4U8U N;  4EDE A;  3NQ3 A;  1VQ9 P;  1A2D A;  4QNB A;  4XMF A;  1JJJ A;  2BS5 A;  4A60 A;  4RUU A;  2FS7 A;  4U0F A;  4U0A A;  1QY2 A;  2OVE A;  2QOS C;  3CR6 A;  4YMY A;  4QNI A;  2X8T A;  4AYH A;  3QKG A;  4YCH A;  3CCU P;  4YDB A;  1IUQ A;  1GM6 A;  3SOT A;  1KXO A;  1KQX A;  3K3L A;  1H91 A;  1VYG A;  3O2Y A;  4HPA A;  2AT6 X;  4YDA A;  4ORR A;  3ZWE A;  3BS2 A;  3P02 A;  3KFI A;  1URE A;  1BWY A;  3PEC A;  2KTS A;  1GKA A;  4R0B A;  1BRQ A;  3H47 A;  3ELZ A;  3RG6 C;  4ALB A;  4Y0P A;  3NTE A;  1B0O A;  5EPQ A;  4BOE A;  4QAE A;  5DG4 A;  1MX7 A;  1T0V A;  4MVE A;  1SMP I;  5F6Z A;  4U3Q A;  1OEK A;  1QVG O;  4IPY A;  4LZV A;  4U8U O;  2Z45 A;  3G1I A;  4KII A;  4KC8 A;  2PEK A;  4XFX A;  4ORX A;  3G71 P;  5LJD A;  3VG7 A;  4WHI A;  3DS3 A;  2GTL O;  2GTF X;  3HYB A;  4ZR2 A;  4IB8 A;  4U0D A;  1HMS A;  3NR3 A;  4JGL A;  3NQ9 A;  4MIS A;  1GX9 A;  1O8V A;  1A3Y A;  2KD2 A;  4PJ2 A;  1ZMB A;  3H0D A;  1DFV A;  4ZHH A;  1BBP A;  1QY1 A;  3TGC A;  2M4L A;  1SXU A;  4YKM A;  4AZM A;  1G5W A;  1GKA B;  5AJB A;  2Q2P A;  4ODD A;  4XFY A;  3ZW0 A;  5D45 A;  1M6N A;  1NJI Q;  1LKE A;  3P05 A;  3I56 P;  2AL0 X;  2AT3 X;  2CWO A;  3C77 X;  3APU A;  1NP4 A;  4O49 A;  1BSO A;  5HZ8 A;  1SY1 A;  1EQD A;  3FA8 A;  4KT5 A;  1LIF A;  1ZNE A;  2L68 A;  3DPH A;  2NP1 A;  4QGX A;  3HWE A;  1DZJ A;  1E5P A;  1AVG I;  1FEL A;  4IAX A;  1BSY A;  1NGL A;  2OVA A;  5BVS A;  2P9X A;  1VQK P;  2ZAG A;  3D96 A;  4DQ3 A;  3TGA A;  1QRJ A;  3D95 A;  3RZY A;  4XRQ A;  3H4E A;  1GT3 A;  2ASN X;  2GTL N;  3G1G A;  1N0S A;  5HZ9 A;  2LBA A;  1HMR A;  4I3C A;  3VPJ E;  4ORU A;  1W2B O;  1BAJ A;  1I06 A;  3ELX A;  4RUN A;  4Y0Q A;  4EFG A;  1X71 A;  1G85 A;  5HBS A;  3BLG A;  1HN2 A;  4YFR A;  3STK A;  3VG6 A;  1TOU A;  2ALL X;  1QQS A;  1IW2 A;  3FEP A;  1LIB A;  4YFP A;  3DTJ A;  4CSB A;  1K30 A;  5BVT A;  3FA7 A;  3FR2 A;  4LZU A;  3CD6 P;  1CRB A;  1EII A;  1IFC A;  3B2K A;  1X8P A;  3ZUI A;  1ZRY A;  3O19 A;  1RO2 A;  3FLL A;  4AZN A;  1JBH A;  2PEO A;  2FR2 A;  2HLV A;  4COC A;  1ICN A;  3D97 A;  3ZZV A;  1SXY A;  3WVM A;  2QMI A;  2KOD A;  3KFH A;  5FFH A;  3WJF A;  1A8O A;  4TKJ A;  4U9C A;  1YWC A;  2KTD A;  1YWA A;  1VQ7 P;  1S72 P;  1BSQ A;  2JYL A;  1OPB A;  3FW5 A;  3HOL A;  3L4R A;  3MVF A;  1M90 Q;  2WQ9 A;  3NX2 A;  4O9S A;  3WXQ A;  4FBO A;  3JQO A;  2X45 A;  4Y0R A;  1CBI A;  3VE1 A;  3I55 P;  1FDQ A;  2EIA A;  1M74 A;  4XMH A;  3BU1 A;  5FQ6 E;  3VG2 A;  2LKK A;  3APV A;  3APW A;  2MO5 A;  4OS3 A;  4WFV A;  4ORW A;  2YG2 A;  1LF7 A;  1RNI A;  1TOW A;  1SY3 A;  2HYS A;  1EXS A;  5LJE A;  1JJX A;  1CJ5 A;  5LKF A;  1ERX A;  4XFZ A;  4KCA A;  2M8P A;  3MGE A;  1GGL A;  3G7X A;  5EEE A;  2PEN A;  1JJ2 O;  4O4U A;  5D8J A;  2XKL A;  4IAB A;  2RA6 A;  1NP1 A;  3F8A A;  3CBS A;  3E2D A;  3PQS A;  3KFF A;  2X46 A;  1KGL A;  3RKG A;  1YWD A;  2P8G A;  2PEJ A;  2Z4I A;  2POA A;  3CCS P;  1LPJ A;  2BUO A;  1DZK A;  1DF3 A;  3BSZ E;  3I17 A;  1EOQ A;  2QA4 P;  1FTP A;  1GT4 A;  2R56 A;  4ZH9 A;  4QGV A;  4M6S A;  1N8R Q;  3DS0 A;  3NQK A;  3I0A A;  2JOZ A;  1ZNH A;  2BLG A;  1FE3 A;  1K8A Q;  4ZHD A;  2JO0 A;  1D1D A;  4ZJ0 A;  3KFG A;  2Q4N A;  1K73 Q;  1EW3 A;  4M7M A;  5DPQ A;  2W2B A;  3HWG A;  3OJY C;  4TKB A;  1DV9 A;  1KZX A;  2OFR X;  4XME A;  4YGH A;  2BHV A;  1BLR A;  1GXA A;  1FEM A;  3PQU A;  2E1M A;  3G4S P;  5HGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...