2BHVA

Structure of comb10 of the com type iv secretion system of helicobacter pylori
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
211
structure length
191
Chain Sequence
b'NKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGVPLLLSTLTNGLLIGITSAFGDYLLMQLMRQSGMGINQVVNQILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPRENEVIAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMB10
publication title Structures of Two Core Subunits of the Bacterial Type Iv Secretion System, Virb8 from Brucella Suis and Comb10 from Helicobacter Pylori
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Bacterial protein
total genus 39
structure length 191
sequence length 211
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03743 TrbI Bacterial conjugation TrbI-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.160 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2bhvA02
2.40.128.260 Mainly Beta Beta Barrel Lipocalin Lipocalin 2bhvA01
3JQOA 2BHVA
chains in the Genus database with same CATH superfamily
3UEUA 1I06A 2ROQA 4PWVB 2XT1A 3CMPA 5F58A 1Z24A 4XMHA 2FAEA 4DQ3A 3AEHA 2ONTA 1MEPA 2Y3EA 5HWZA 4HPCA 1KL3A 4AZOA 4Z28A 5AEOA 3ZW0B 5B10O 4L1NA 1MK5A 4U8UO 2W2BA 5HZQA 1E0HA 1VWOB 3RDOA 3CQRA 3WJBA 5CYBA 1LIDA 3RY2A 3DS2A 1HQPA 1YJWP 3G28A 1DC9A 4NW4A 5HGOA 1YUPA 3PQUA 2WWPA 1X3OA 1BLRA 1SWPA 4D6AA 2WPTA 3CD6P 2F01A 2OY5O 3RDSA 2IZFB 4GJVA 5F2OA 3RDXA 2Z45A 4U0CA 2FHLA 2X56A 1SWOA 2MM3A 2KOPA 4EQAC 2AVAA 2X4MA 4GGZA 3DPHA 1SWKA 3MM0A 1Q81Q 5D4AA 2KG9A 5LJEA 4U0FA 2FHSC 3FW5A 1VQNP 2QO6A 3TZSA 1DF3A 4YCEA 3OD9A 3KQ0A 2RTJA 2JU8A 4I95A 1HXZA 4COPA 3HPEA 2LPKA 3HTYA 2JN3A 3WYQA 2GZJA 2HYSA 2QM9A 2GZEA 1YIVA 2OARA 4BX5A 4OS8A 2K23A 1BBPA 3I55P 1A43A 2X8SA 1QY2A 3F9DA 5EZ2A 3DS4A 3KFGA 4OS3A 3FDCA 4F37A 5B5FA 1KFFA 4O4SA 2RTOB 3SLOA 2CM9A 1SY1A 1CBQA 1IUQA 2KW2A 2ASNX 4ZGUA 5KP8B 1UYOX 3S26A 2JGPA 2XKLA 3EM0A 3EJEA 2QMIA 3U0DA 3CCSP 3P02A 1R0UA 3L4RA 5B2AO 1RLBE 1TOUA 3C76X 1KT7A 1RSTB 1LNMA 4IMNA 4IBAA 2KOSA 3RKGA 3WZPA 2EIAA 3T6LA 3WJCA 1TVQA 1GXAA 1VWPB 2AFEA 5HGNA 4GZVA 3EW2A 3RWXA 1DV9A 4TQ2A 5IXGA 3G0VA 4IB9A 4GRJA 3LTWA 1KC8Q 4D6BA 1Y9LA 1GX3A 1LIFA 1I9HA 1HQBA 2DM5A 3HWFA 3RDUA 1VWHB 3NBXX 2PEQA 2OVDA 4GGTA 4BX6B 4BPFA 3SZIA 2QOMA 5HCCC 4Z2VA 1K9MQ 3STKA 4ORWA 4NNSA 1JV4A 2CZUA 2PY8A 5LJKA 1IMQA 4MVKA 3NP1A 1Y52X 1PM1X 2CWOA 2R56A 1KLPA 2A0AA 2E1MA 1UZ2X 4KC8A 4ZGFA 2JYGA 1HY8A 3G26A 2NNQA 2OFBA 1GT1A 5JR8A 3BX8A 1QFVA 1HMSA 5F2BA 2OY8A 1E06A 2L9FA 3O2YA 4DCBA 2LKIA 3RG6C 1S44A 3VE2A 3BY0A 2AT6X 2G7BA 2OF8A 4Y59A 2BLGA 2CAMA 4QNIA 2PEMA 2LA7A 3CPWO 2N98A 2MF4A 3P6CA 1DV5A 1RXKA 2M5RA 2FGSA 2JO0A 1BSQA 2IZAA 2POAA 2IZGB 2FKJA 1JJ2O 2HNXA 3EMMA 2JB0A 2ALLX 3BU1A 2HZQA 4O9SA 4XFZA 1XCAA 1IMPA 4O3WA 5HA1A 2AMMX 4RUUA 4CPIA 3S60A 3HOEA 4UU2A 5CSEA 1N43A 3G4SP 4BGFA 3PECA 4IPYA 1EI5A 3CBSA 2RCQA 2OVAA 2BS5A 4XFYA 4BCSA 4NLJA 1KOIA 2Q2MA 4IZ6A 5IRAA 1SA8A 5B29A 4M7MA 3G7XA 1RSUB 2IZIA 3Q34A 4I3BA 1FR2A 1LKEA 3WOVA 4C5PA 2FR3A 2AH7X 4COCA 2L6EA 4U0BA 1VYGA 1SLGB 3RDQA 1HY2A 4QZUA 5EEDA 7CEIA 3GE2A 2Q9SA 4MEEA 2YG2A 2RTRB 1PBYA 3OE3A 1O1UA 4PH0A 2G78A 2L5PA 1JYDA 5LJGA 1VWLB 3U43A 4DNEA 4OMXA 4ARHA 2RTLA 3ZQ3A 3PK2A 1SWCA 1RNIA 2KTSA 2VLNA 2E4JA 1LDQA 3GAQA 4IAXA 5DG4A 1PBOA 5F6BA 1DZMA 1AVDA 5D47A 4EFGA 2IZCB 5C0NA 1ZNEA 1LFOA 2FS7A 1OBPA 3WZOA 1E00A 1VWQB 2HZRA 4A8ZA 2OTLP 1KXOA 2MHDA 3APWA 3CQNA 4CPEA 3FYFA 2MR7A 3EC5A 1FDQA 2M8NA 1GKAA 2RTIB 4BX7A 4ZH6A 1NC9A 1YWBA 2KTDA 2WR6A 2X45A 1Y0GA 4XMDA 3AUMO 4LQZA 1SWGA 1GM6A 4XMGA 2LKKA 1U18A 2QOSC 5FENA 1VQOP 2W2AA 3EW1A 4UU3A 5CZDB 2AKQA 5BYPA 1KZWA 2FQ2A 5H9LA 2K92A 4YGHA 2CGQA 2L4BA 3VHMA 1OEEA 3QKGA 2IZDB 4GR6A 1W4TA 4PSQA 1G7NA 2HMBA 2PEIA 4ALBA 2A3FX 1SRHA 1YP6A 1ML7A 1K3BA 4U8UN 5FQ7E 1KL5A 3O22A 1T0VA 5D45A 2GZFA 4Y0PA 4R0BA 2K0XA 1QABE 1OPBA 2ANSA 5HA0A 4MISA 4CPFA 1FENA 2FR2A 3SLTA 2Q4NA 2RTPB 1LCVA 4BOEA 3Q20A 3PEDA 2O62A 2Z4IA 2GDYA 2GTLM 2BT9A 3E3CA 4NEOA 2K62A 1FELA 4GK9A 3ZW1A 3B5IA 1VWIB 5LJHA 5EPQA 3CMEP 1L6MA 2L0QA 1I05A 2EFJA 1Y53X 1NP4A 1VWAB 1SXXA 1NGLA 1GXGA 2KG6A 2OL8O 3DS0A 5HTEA 3ZZVA 4FGIB 2X8TA 4MVIA 1YWDA 1YIJP 4YMYA 1YWAA 4EEJA 1X71A 4IRWA 1LCWA 2GYKA 3IFBA 3NPOA 3FIDA 1SWNA 2FRSA 2ZSCA 1SY0A 3AKNA 4JHQA 4O3ZA 1SWHA 2IZKA 4GE1A 4ZHCA 4GNYA 4BJ8A 1KL4A 5L8NA 4IAWA 5B3MO 2KOQA 1L0IA 1SWAA 4YGGA 2CBSA 4HFOA 4GETA 2W2FA 1S72P 4QYPA 1VHNA 3ELXA 4QZTA 1OSPO 3V8UA 2JMBA 3H47A 3DTQA 2EHTA 3ZW2A 2LFOA 2BC3A 2MO5A 2LBAA 2LOLA 4BVMA 4TKBA 4GKCA 4U9CA 2LMLA 1VQ6P 2G5LA 1RO0A 3B2KA 4LKTA 2CG5B 4R0MA 1LPJA 1G85A 2WSJA 2RTKA 4I3CA 1Q7YQ 3DTJA 1ZNHA 3P24A 2NNDA 4TJZA 1T8VA 1DF8A 3NQKA 4U3QA 3BU9A 1NQNA 3KFHA 4NV7A 5LKEA 4AZNA 3VHHA 4QNBA 1VWNB 2ACPX 1ZNDA 2EG5A 1M90Q 1QG5A 4IMOA 1OR5A 2XXMA 1N9YA 1SY2A 1E2TA 2Q39A 5AQ6A 3VU1A 3G71P 3VG5A 5IRUA 1SRIA 1ADLA 2Z4HA 4EXZA 1A18A 4QQ1A 4DG9A 3H3IA 3TGCA 3FMZA 1SWFA 1ZNVA 5H8TA 4NYRA 3PQSA 4O4XA 2Z46A 3APUA 4H2WC 2DJGA 1YI2P 1HMTA 5H9AA 4GJSA 2P9XA 4CDCA 2XZ0D 2WQ9A 2MD9A 1RAVA 4AZRA 1F80D 3WJFA 3EJBA 3E2DA 2AFDA 3G29A 2KODA 4XMEA 5EJDA 1YITP 1X8OA 5F1EA 4B55A 4BX6A 1EPBA 2GZIA 4QKOA 1A2DA 1IJ8A 2KWLA 2VSQA 3VGWA 3G21A 2AL0X 1KT4A 4JGLA 4Y0RA 5BVQA 2MF6A 2NP1A 1MUPA 3CE7A 4HPDA 2DGYA 5K68A 1X8NA 1EPAA 1JIWI 3Q6LA 3SZJA 1RO2A 1VQMP 2FTBA 4EKVA 4U46A 4INNA 3MX7A 1SXYA 1YJ9P 4IB8A 3VG6A 2C4IA 5FAZA 1OBUA 4ID2A 2FQ0A 3BDRA 2BSZA 3IA8A 3RG2A 2AVIA 1VQ9P 1DNYA 3HWGA 3NQ3A 1TW4A 2QO5A 1UNKA 1AVEA 2X2BA 5BS2A 2X55A 4U0DA 2MJIA 1A57A 1VYFA 4YFPA 4BPHA 3PH6A 1YJNP 5CHKA 5KIDA 3WZNA 3OW2O 5KICA 2UYWA 5BVSA 3O19A 4I6SA 1O1VA 3AKMA 4KIIA 1TXLA 1VWCB 2M8LA 5HV8A 4ZCBA 3SAOA 2IZHB 2HKDA 4BBOA 2JGSA 4Y0SA 4ZJ0A 3CMAP 3NX2A 1X89A 3FEKA 1LICA 2RTQB 4XMFA 1HQQA 1BRPA 1IKJA 4TKHA 3SLJA 1IFCA 3X00A 1D3SA 2BHVA 4O4UA 4CPHA 2GDXA 5HZ5A 1D1DA 4N7DA 2X46A 1NDJA 1IKEA 1RXHA 4AW8A 5IO6A 1VWJB 4QGVA 2CNRA 4AZPA 1VWGB 2N6YA 2AT0X 2LF4A 3TGBA 1Y55X 4K19A 2JU1A 3RE5A 1GT4A 2X34A 2JW1A 1N8RQ 1SWBA 4O3XB 1W2BO 1SWRA 1M6NA 2VFBA 1N4JA 2RTHB 2ZAGA 4TKJA 4EDEA 1Q86Q 4PH1A 5FQ6E 3APVA 1IFBA 1SMPI 4NV8A 2RTBB 2FWVA 4U0EA 1VWKB 3TF6A 1B0OA 2VLQA 3HYBA 5JD2A 2RD7C 4ML7B 3D9WA 1I78A 3CCMP 2G8CO 1GX8A 4ON1A 3STNA 4IB7A 1SWUA 1AF8A 3F8AA 4ZH9A 2N93A 2IZEB 2FHNX 2F09A 2GC9A 2BUOA 2JBGA 3VPJE 2PEKA 2L9CA 1JZUA 2DNWA 3DS3A 2JQ4A 1FTPA 3BSZE 2GH7A 2MVVA 1NBXA 2C1QA 3VE1A 2PEOA 3HK1A 3NX1A 1EIOA 2KGAA 3FA8A 1HMRA 1W6FA 1AQBA 2X8FA 4PJ2A 3VG2A 2VLOA 5HVCA 2FS6A 4ES7A 1JBHA 3HZQA 4ODDA 3CCLP 4DQ4A 1ACPA 2KR5A 2AF8A 3FEPA 1VQKP 3ZUIA 1GX9A 1JYJA 1SXWA 3SOTA 5HZ9A 1EQDA 1Q82Q 4I60A 3FIQA 2GJ5A 3MBTA 4XROA 4UHPB 2CZTA 3I56P 2FLJA 3STMX 5LKFA 1VQ4P 4YDAA 3LRYA 2MWHA 2FACA 4KH8A 2A8GA 3NTEA 3FR5A 4HPBA 3RBYA 1FEMA 1VWRB 3UEVA 1AVGI 2GTLO 4YBPA 1CRBA 2ACOA 1GKAB 2N5HA 1BEBA 2OY1O 5HZ6A 2M4LA 3D4RA 2IZBA 1VYOA 4HPAA 4ORSA 4NYQA 5KP7B 5F7GA 3NR3A 5LJDA 1EW3A 1LIEA 3GZLA 5K67A 3VHIA 3B2JA 1JQPA 4WBKA 2PEJA 3CKFA 4ZR2A 1EIAA 2BS6A 1MX7A 1VWFB 1Y9TA 2WPUA 1X8QA 1STPA 1KD1Q 4YKOA 2K5XA 1EUOA 4WYMA 1SWQA 4IABA 4KC7A 3WXQA 3EYCA 5CE4A 3LV4A 3NADA 4BQUA 1ICMA 1QRJA 1SRGA 5K06A 1K24A 4LZVA 1SWEA 2OYBO 2FADA 1JMZA 1AYIA 3P6EA 1CBRA 5HGLA 1EOQA 4HWMA 1GXHA 1U17A 1FJ1E 2QNWA 2KG8A 1QY0A 4CV7A 3VG3A 5H9KA 4AYHA 3GKLC 3FELA 2PY1A 3G6EP 3B2HA 1YHQP 1N9MA 2IZLB 2FKGA 2IZJA 2OVSA 4YKMA 2OL6O 2OZQA 3WBGA 1OEJA 4YBUA 4WFUA 1B4MA 1JMXA 4Z27A 3GJNA 3WJGA 3ZW0A 3FR4A 2GZGA 1SLDB 2G79A 2A2UA 2L67A 1VQ5P 3KVNA 3FA6A 1N7YA 3PPTA 1BSOA 3D97A 1MX8A 1X8PA 4H2XC 5JPAA 1S2PA 2PI3O 4FBRA 3JSQA 5HGMA 2WUTA 1CBIA 2RCTA 4GDZA 4WFVA 1SXUA 1QQSA 4Z6JA 2K2QA 4O4OA 2AT8X 1I04A 3B2LA 3WVMA 4KCAA 1IW2A 1QVGO 1LCZA 3VG7A 3DSZA 3CCRP 3CKGA 3CXCO 3CCQP 3QQ2A 1MZ8A 3T2XA 2A2GA 5IO7A 2PENA 3NY7B 4QYNA 2QA4P 4TLJA 4O49A 1VWBB 1ZRYA 2MY5A 4LZUA 2K0DX 4YDBA 2RTDB 4PXHB 1VQPP 1GT3A 4OS0A 1YP7A 2I5ZO 1M1KQ 4GUZA 1SY3A 1AB0A 1VQLP 4FBOA 1GGLA 1KT6A 2QEXP 4O3YA 2RN4A 2EU7X 1ZNLA 3I17A 2HLVA 4I3DA 1MVGA 2JU7A 4GR2A 2L68A 2XZ1C 2Y32A 5EDCA 1BAJA 1B56A 1UJZA 1E6JP 4U8UM 2WQAE 2LIUA 4CDEA 3RE6A 4ZHGA 3WBHA 3NQ9A 5L8IA 1NQ4A 5AJCA 2NO8A 5B5GA 2KW1A 1K30A 4GGRA 3C77X 1FE3A 4IB6A 2WEWA 1CEIA 4ORUA 1JJUA 3BRNA 4MVEA 1BXIA 1G5WA 3RDMA 2QCBA 2QO4A 1RBPA 5L3YA 4BX5B 1NP1A 3FA9A 1T8KA 3MVFA 1SWDA 1LUQA 2RTGB 3CR6A 3RY1A 2RTNB 4ORXA 3EBKA 4A60A 5HZ8A 2Y3FA 3VG4A 2L22A 1CBSA 2JOZA 4A1YA 5HBSA 1VWDB 4NLIA 5F2NA 1TOWA 1KQWA 2KGEA 3CCEP 3WJDA 2CM4A 2FVFA 3N91A 2VFCA 2MR8A 1NJIQ 3T2WA 4COTA 5EW5E 2R73A 5L8OA 3FR2A 4I9SA 3HWEA 4M6SA 2RA6A 4YFRA 4A1HA 4ZHDA 3FENA 1VKUA 2LB6A 2KGCA 1KQXA 1LELA 3CC2P 4NNTA 1GT5A 2A13A 1OBQA 1BRQA 4OELA 2JAZA 2A5BA 2X32A 4GD9A 1BWYA 4KT5A 1QVFO 3H4EA 3JS1A 4GU8A 3PH5A 1WUBA 2AT5X 2K94A 3S5XA 2KOOA 5HTDA 3RSWA 4H2YC 3P6FA 2OFRX 5FFHA 4QGXA 1EMVA 2FVAA 1GPJA 5DPQA 4YFQA 2RTMA 3CWKA 1QWDA 4FBVA 3CC4P 1A8OA 4Z2PA 3I0AA 3RZYA 2WEXA 5H9NA 2N5IA 1JJJA 3GZMA 2FT9A 1L0HA 4NP1A 1VQ8P 1HXLA 2Q2PA 2JU3A 4CDDA 2N6ZA 3CC7P 3ZWEA 1S7DA 1LIBA 4QRLA 2LL8A 1VWMB 2GTFX 3S5VA 5KP6B 3D96A 4ZHHA 4LKPA 5IRWA 2C1SA 4Y5DA 5B11O 5B27A 3LMOA 1SLEB 4L3RA 4QAEA 4BPGA 3C78X 2N50A 1STSB 3BX7A 2OY7A 2KGDA 2KORA 2ZAIA 3CCUP 1BM5A 3K3LA 1UREA 1OEKA 1M6EX 4OEMA 2PNGA 1AELA 5BVTA 1SWTA 1AUMA 5EEEA 1KQSO 3F6ZB 2K0YA 2VLPA 4ORYA 2OL7A 3WZQA 3APXA 4Z2OA 2IFBA 5I4TG 3CCJP 4CPHB 1IIUA 2RTAA 3B4QA 1U0XA 4CSBA 3EJDA 2RTFB 5DCKA 1ACDA 2F73A 2Z44A 1T68X 4XRQA 2AF5A 4ORRA 3DS1A 1KT5A 1ZNGA 2GTLN 1I4UA 4YH0A 3KFFA 1HBQA 4XFXA 1SRFA 1PMPA 4CA3A 4OKAA 3WYPA 5AJBA 3T1DA 1XKIA 3ELZA 1G74A 5BS1A 5EDBA 4JNJA 2RQ0A 1DZJA 3OJYC 1Z6MA 3KFIA 5LJBA 2LBVA 4HKGA 1SLFB 1MDCA 4QGWA 2OVEA 3CBCA 2VDFA 1ALBA 1SREA 2K93A 1E5PA 1DFVA 3WJEA 1O8VA 3P6GA 2GDWA 1DZKA 4Y0QA 2AT3X 2NNEA 3ZUOA 2EHSA 4JO6A 3UEWA 1CJ5A 1K8AQ 3HOLA 3LHNA 1SRJA 1BJ7A 4YCHA 3PDFA 4AZQA 1OPAA 3G1GA 4U0AA 1P6PA 3D95A 3P05A 2KD2A 3OBLA 2R74A 1ICNA 2A5CA 3T6FA 1STRB 4GDAA 5D8JA 3FLLA 1UYNX 4MVLA 2JU2A 3UAQA 4ZFXA 1A3YA 3U03A 2OTJP 1VWEB 2FVEA 1M74A 1D2UA 2RTEB 3JQOA 4AZMA 1NQMA 1EXSA 4YVBA 1MM9A 1MOYA 4BX7B 3KZAA 1KGLA 4GNWA 5D48A 1KZXA 4CDFA 2XSTA 1ERXA 2XV6A 2LIWA 1H91A 2RTCB 1WBIA 1BSYA 2CBRA 3BS2A 3TGAA 1SWSA 1QFTA 3G1IA 5F6ZA 1LDOA 1SWJA 2P8GA 1X8UA 4MIRA 4TNNA 1HN2A 1EALA 3P6DA 1ERBA 4OMWA 2I5VO 2FQ1A 3BLGA 1ZMBA 3VRLC 1RXJA 1LF7A 2OFAA 1QY1A 4WHIA 2OF9A 1B8EA 3CCVP 3B2IA 5KHPA 5FQ8E 2KT4B 3HWDA 4XMCA 1PTSA 2CQ8A 4ZHFA 5LJCA 4GH7A 2M8PA 1KT3A 3PP6A 1E02A 1PEEA 3MG5A 4M0IA 4RUNA 3M1MA 3U9PC 2UZ2A 3UEXA 4MRTC 4ALOA 2JYLA 3DS5A 1N0SA 1K73Q 4I9RA 3FW4A 2MVUA 1YWCA 1VPRA 4YGZA 1JJXA 5IO5A 3ZW1B 3SZHA 4FQBB 3MGEA 1ZNKA 5HCDC 1VQ7P 5HCEC 1SWLA 3P6HA 3H0DA 5HAEA 1W5RA 2LTEA 4N7CA 2YMSA 2DJFA 3ZI8A 1HBPA 1EIIA 1DZPA 3EBWA 5F2KA 2OFMX 2ERHA 4CK4A 3FA7A
chains in the Genus database with same CATH topology
2WR6A 3UEUA 1I06A 2CM4A 2X45A 4XMDA 2XT1A 1YWBA 3CMPA 1D1DA 4N7DA 2X46A 3N91A 5F58A 1Z24A 1IKEA 1NJIQ 4LQZA 4XMHA 4AW8A 4DQ3A 2ONTA 4COTA 5HWZA 1GM6A 2R73A 4HPCA 5IO6A 5L8OA 3FR2A 4I9SA 4XMGA 2LKKA 3HWEA 4M6SA 4AZOA 1U18A 2RA6A 5AEOA 3ZW0B 4QGVA 4A1HA 4YFRA 4L1NA 4ZHDA 2QOSC 4U8UO 5HZQA 1VQOP 2W2BA 4AZPA 5FENA 3FENA 2W2AA 2LB6A 1KQXA 4UU3A 2AT0X 3CC2P 3CQRA 3WJBA 5BYPA 2AKQA 4NNTA 2LF4A 3TGBA 5CYBA 1KZWA 5H9LA 1LIDA 4K19A 1GT5A 4YGHA 2A13A 3DS2A 1HQPA 1OBQA 1YJWP 3G28A 1GT4A 1DC9A 4NW4A 1OEEA 5HGOA 1YUPA 1BRQA 2JW1A 3QKGA 3PQUA 2WWPA 1BWYA 1N8RQ 4GR6A 4KT5A 1BLRA 1QVFO 4O3XB 1W2BO 4PSQA 1M6NA 1G7NA 2HMBA 3H4EA 2PEIA 2ZAGA 4TKJA 4D6AA 4EDEA 1Q86Q 3JS1A 4GU8A 4ALBA 2A3FX 4PH1A 3PH5A 3CD6P 2AT5X 5FQ6E 1YP6A 1ML7A 3S5XA 3APVA 1IFBA 1SMPI 4U8UN 5F2OA 3FA7A 2Z45A 4U0CA 5FQ7E 5HTDA 2FWVA 3O22A 4U0EA 3RSWA 1T0VA 3P6FA 2OFRX 3TF6A 2MM3A 5FFHA 1B0OA 5D45A 4Y0PA 4QGXA 4R0BA 3HYBA 4EQAC 1QABE 2RD7C 1OPBA 4ML7B 2ANSA 4YFQA 5DPQA 5HA0A 3CWKA 4MISA 3CCMP 1FENA 1QWDA 4FBVA 2FR2A 3CC4P 3DPHA 1A8OA 1GX8A 2Q4NA 1Q81Q 4BOEA 3Q20A 4ON1A 3PEDA 4IB7A 5D4AA 3STNA 2O62A 2Z4IA 3I0AA 4U0FA 3RZYA 5LJEA 2GTLM 3F8AA 4ZH9A 2N93A 2BT9A 2WEXA 3E3CA 3FW5A 1VQNP 2K62A 2QO6A 1FELA 2F09A 4GK9A 5H9NA 2GC9A 3TZSA 3ZW1A 1DF3A 1JJJA 2BUOA 3B5IA 4YCEA 3OD9A 5LJHA 3KQ0A 5EPQA 2FT9A 3VPJE 3CMEP 1L6MA 2JU8A 1I05A 1VQ8P 4I95A 4NP1A 2PEKA 2L9CA 4COPA 2EFJA 2Q2PA 2JU3A 1JZUA 1NP4A 3HTYA 2JN3A 3CC7P 3ZWEA 1SXXA 3DS3A 1NGLA 1S7DA 2HYSA 2QM9A 1LIBA 1FTPA 1YIVA 3BSZE 2OARA 4OS8A 2PEOA 3VE1A 4QRLA 2K23A 1BBPA 3I55P 3DS0A 1A43A 2X8SA 3HK1A 3NX1A 1EIOA 5HTEA 2GTFX 1QY2A 2X8TA 3F9DA 1YWDA 4FGIB 4MVIA 5EZ2A 3ZZVA 3DS4A 3D96A 1YIJP 3S5VA 3FA8A 3KFGA 4OS3A 1HMRA 4ZHHA 4YMYA 4LKPA 1YWAA 4EEJA 1AQBA 2X8FA 4PJ2A 5B27A 3VG2A 2FS6A 1X71A 4ES7A 4O4SA 3HZQA 4ODDA 1JBHA 2CM9A 4L3RA 1SY1A 3IFBA 4QAEA 1CBQA 1IUQA 3C78X 3NPOA 3CCLP 4DQ4A 2ASNX 3FEPA 3BX7A 4ZGUA 3S26A 1VQKP 3ZUIA 5HZ5A 1GX9A 1JYJA 1SXWA 3SOTA 5HZ9A 2XKLA 1EQDA 1Q82Q 3EM0A 2FRSA 2QMIA 3U0DA 3CCSP 3P02A 3FIQA 1R0UA 1SY0A 2ZAIA 3L4RA 3CCUP 1RLBE 2GJ5A 3MBTA 1TOUA 1BM5A 4XROA 3C76X 1KT7A 3AKNA 3K3LA 4O3ZA 1UREA 1OEKA 2CZTA 1M6EX 3I56P 1LNMA 2FLJA 4GE1A 4IMNA 4IBAA 5LKFA 3STMX 4ZHCA 4GNYA 1VQ4P 1AELA 5BVTA 4YDAA 1AUMA 3LRYA 2MWHA 4KH8A 5EEEA 3RKGA 3NTEA 3FR5A 4HPBA 2EIAA 3RBYA 3WJCA 1FEMA 1KQSO 1TVQA 4IAWA 1GXAA 5L8NA 3UEVA 3F6ZB 1AVGI 5HGNA 2GTLO 4GZVA 3RWXA 4ORYA 4YGGA 4YBPA 2CBSA 1DV9A 1CRBA 2ACOA 4HFOA 4TQ2A 4GETA 3G0VA 3APXA 1GKAB 4IB9A 2IFBA 4GRJA 5I4TG 1S72P 3CCJP 1BEBA 2W2FA 4QYPA 1KC8Q 3ELXA 1IIUA 4D6BA 4CSBA 1U0XA 1Y9LA 5HZ6A 5DCKA 2M4LA 3D4RA 4QZTA 3V8UA 1LIFA 1ACDA 2F73A 2DM5A 3HWFA 2JMBA 4ORSA 2Z44A 3H47A 3DTQA 4HPAA 3ZW2A 4NYQA 1T68X 2LFOA 4XRQA 5F7GA 2MO5A 3NR3A 3NBXX 2LBAA 2PEQA 4ORRA 5LJDA 1EW3A 1LIEA 4BVMA 3DS1A 4TKBA 1KT5A 2OVDA 1ZNGA 3B2JA 4GKCA 4WBKA 4U9CA 2PEJA 2GTLN 4ZR2A 5HCCC 1VQ6P 1EIAA 1I4UA 2BS6A 1K9MQ 4YH0A 3KFFA 1MX7A 1HBQA 4XFXA 3STKA 1RO0A 1Y9TA 4ORWA 3B2KA 4NNSA 4LKTA 1X8QA 1PMPA 1JV4A 1KD1Q 2CZUA 4YKOA 2PY8A 5LJKA 1EUOA 1LPJA 4WYMA 1G85A 4IABA 4KC7A 5AJBA 3WXQA 3T1DA 1XKIA 3ELZA 2WSJA 1G74A 3EYCA 5CE4A 4MVKA 3NP1A 3LV4A 4I3CA 1Q7YQ 3NADA 3DTJA 1ZNHA 1PM1X 3P24A 5BS1A 2CWOA 2NNDA 2R56A 4TJZA 5EDBA 1ICMA 1T8VA 1QRJA 3NQKA 4U3QA 4BQUA 2A0AA 2RQ0A 1DZJA 2E1MA 3BU9A 5K06A 1UZ2X 3KFHA 4LZVA 4KC8A 3OJYC 3KFIA 4ZGFA 2JYGA 4AZNA 5LKEA 2LBVA 5LJBA 3P6EA 3G26A 2NNQA 4QNBA 1MDCA 1CBRA 5HGLA 1ZNDA 2ACPX 2EG5A 4QGWA 1M90Q 1EOQA 1GT1A 5JR8A 2OVEA 4HWMA 3BX8A 3CBCA 1QFVA 1HMSA 1QG5A 4IMOA 1ALBA 1U17A 2XXMA 1E5PA 1E06A 1SY2A 2Q39A 1DFVA 5AQ6A 3O2YA 3G71P 3VG5A 3VU1A 3WJEA 1QY0A 3RG6C 1S44A 1ADLA 2Z4HA 1O8VA 1A18A 4EXZA 4CV7A 3VE2A 3P6GA 4QQ1A 3VG3A 5H9KA 3BY0A 2AT6X 1DZKA 4Y0QA 3H3IA 4AYHA 2G7BA 2AT3X 3TGCA 2NNEA 3FMZA 3FELA 2PY1A 3ZUOA 3G6EP 3UEWA 3B2HA 5H8TA 4NYRA 1YHQP 3PQSA 1CJ5A 4O4XA 1K8AQ 3HOLA 2Z46A 3APUA 3LHNA 2OVSA 1BJ7A 2OFMX 2BLGA 1YI2P 4YCHA 1HMTA 4YKMA 4AZQA 1OPAA 3G1GA 2OZQA 4QNIA 2PEMA 2LA7A 5H9AA 3WBGA 1OEJA 4YBUA 3CPWO 4WFUA 4U0AA 1P6PA 4CK4A 3D95A 3P05A 1B4MA 2KD2A 3P6CA 3OBLA 2R74A 2P9XA 1ICNA 2WQ9A 5D8JA 3FLLA 3WJGA 3ZW0A 3FR4A 4MVLA 2G79A 2A2UA 2JO0A 4AZRA 2L67A 3UAQA 1BSQA 1VQ5P 4ZFXA 2POAA 3FA6A 1A3YA 3U03A 3WJFA 1JJ2O 2OTJP 3E2DA 2HNXA 3PPTA 1BSOA 3D97A 3EMMA 1MX8A 1M74A 1X8PA 2ALLX 1D2UA 3BU1A 2HZQA 5JPAA 1S2PA 4XFZA 1XCAA 3JQOA 4O9SA 4AZMA 1EXSA 3G29A 2KODA 4O3WA 4XMEA 3KZAA 5HA1A 1KGLA 2AMMX 4FBRA 4GNWA 1YITP 3JSQA 4RUUA 5D48A 1X8OA 5F1EA 1KZXA 5HGMA 2WUTA 1CBIA 2XSTA 1ERXA 1EPBA 2XV6A 2RCTA 3HOEA 4GDZA 4WFVA 3S60A 1A2DA 1SXUA 1QQSA 4UU2A 3G21A 3G4SP 2AL0X 1H91A 1KT4A 4O4OA 4JGLA 4Y0RA 1BSYA 3PECA 5BVQA 2AT8X 2CBRA 4IPYA 1EI5A 1I04A 2RCQA 3B2LA 3BS2A 3CBSA 3WVMA 2OVAA 4KCAA 1IW2A 2NP1A 1QVGO 1MUPA 3TGAA 4HPDA 3VG7A 2BS5A 4XFYA 2DGYA 3G1IA 1QFTA 3DSZA 4NLJA 1KOIA 5F6ZA 1X8NA 1EPAA 1JIWI 3CCRP 2P8GA 3CXCO 1X8UA 2Q2MA 3CCQP 1RO2A 3Q6LA 1SA8A 4MIRA 4TNNA 5B29A 1VQMP 2FTBA 4M7MA 2A2GA 3G7XA 5IO7A 2PENA 4INNA 4QYNA 2QA4P 1HN2A 4I3BA 1EALA 4TLJA 3MX7A 1SXYA 3P6DA 1LKEA 4O49A 1ZRYA 1YJ9P 4LZUA 3WOVA 4YDBA 1ERBA 2FR3A 4IB8A 4OMWA 3VG6A 5FAZA 1OBUA 3VRLC 1ZMBA 3BLGA 4ID2A 1VQPP 1GT3A 1LF7A 4OS0A 1QY1A 3BDRA 2AH7X 3IA8A 4COCA 1YP7A 4WHIA 1B8EA 2L6EA 1M1KQ 4U0BA 1VYGA 3CCVP 1SY3A 1AB0A 1VQLP 1VQ9P 1GGLA 4FBOA 4QZUA 1KT6A 3B2IA 5EEDA 5KHPA 5FQ8E 2KT4B 3GE2A 2QEXP 3HWGA 2Q9SA 4O3YA 2RN4A 2EU7X 3NQ3A 1TW4A 3HWDA 4XMCA 2YG2A 1ZNLA 3I17A 2QO5A 3OE3A 2HLVA 1O1UA 4I3DA 1MVGA 2JU7A 4GR2A 2L68A 4PH0A 4ZHFA 2G78A 2L5PA 1JYDA 5LJCA 5LJGA 4GH7A 5BS2A 5EDCA 1BAJA 2M8PA 4U0DA 1B56A 1KT3A 2MJIA 3PP6A 1E6JP 1A57A 4U8UM 1VYFA 4OMXA 1E02A 2WQAE 1PEEA 4YFPA 4ARHA 3PH6A 3ZQ3A 1YJNP 4M0IA 5KIDA 4RUNA 3OW2O 3M1MA 3U9PC 3UEXA 4ALOA 1RNIA 4ZHGA 5KICA 2JYLA 2KTSA 3DS5A 2E4JA 3WBHA 1N0SA 5BVSA 3NQ9A 1K73Q 4I9RA 5L8IA 3GAQA 4IAXA 3FW4A 1YWCA 1VPRA 3O19A 4I6SA 4YGZA 5AJCA 5DG4A 1JJXA 5IO5A 1PBOA 5F6BA 1O1VA 2KW1A 1K30A 3ZW1B 1DZMA 3AKMA 4KIIA 5D47A 3C77X 4EFGA 1FE3A 4FQBB 4IB6A 2WEWA 1ZNEA 5C0NA 3MGEA 1LFOA 1TXLA 1ZNKA 2FS7A 5HCDC 1OBPA 4ORUA 3BRNA 2M8LA 1VQ7P 1E00A 4MVEA 5HCEC 2HZRA 4ZCBA 1G5WA 3SAOA 3P6HA 2QO4A 2OTLP 3H0DA 1KXOA 4A8ZA 4Y0SA 5HAEA 1RBPA 2MHDA 4ZJ0A 1NP1A 3FA9A 3APWA 3CQNA 3CMAP 3MVFA 3NX2A 3FYFA 3CR6A 4N7CA 2YMSA 1X89A 3FEKA 1LICA 4XMFA 4ORXA 3EBKA 3ZI8A 4A60A 5HZ8A 1BRPA 3VG4A 1FDQA 2M8NA 1HBPA 1IKJA 4TKHA 1CBSA 1GKAA 1EIIA 1IFCA 1D3SA 2JOZA 1DZPA 4A1YA 2BHVA 4O4UA 3EBWA 5HBSA 4NLIA 4ZH6A 5F2NA 5F2KA 1TOWA 1KQWA 3CCEP 3WJDA 2KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQO A;  2BHV A; 
#chains in the Genus database with same CATH topology
 3UEU A;  1I06 A;  2ROQ A;  4PWV B;  2XT1 A;  3CMP A;  5F58 A;  1Z24 A;  4XMH A;  2FAE A;  4DQ3 A;  3AEH A;  2ONT A;  1MEP A;  2Y3E A;  5HWZ A;  4HPC A;  1KL3 A;  4AZO A;  4Z28 A;  5AEO A;  3ZW0 B;  5B10 O;  4L1N A;  1MK5 A;  4U8U O;  2W2B A;  5HZQ A;  1E0H A;  1VWO B;  3RDO A;  3CQR A;  3WJB A;  5CYB A;  1LID A;  3RY2 A;  3DS2 A;  1HQP A;  1YJW P;  3G28 A;  1DC9 A;  4NW4 A;  5HGO A;  1YUP A;  3PQU A;  2WWP A;  1X3O A;  1BLR A;  1SWP A;  4D6A A;  2WPT A;  3CD6 P;  2F01 A;  2OY5 O;  3RDS A;  2IZF B;  4GJV A;  5F2O A;  3RDX A;  2Z45 A;  4U0C A;  2FHL A;  2X56 A;  1SWO A;  2MM3 A;  2KOP A;  4EQA C;  2AVA A;  2X4M A;  4GGZ A;  3DPH A;  1SWK A;  3MM0 A;  1Q81 Q;  5D4A A;  2KG9 A;  5LJE A;  4U0F A;  2FHS C;  3FW5 A;  1VQN P;  2QO6 A;  3TZS A;  1DF3 A;  4YCE A;  3OD9 A;  3KQ0 A;  2RTJ A;  2JU8 A;  4I95 A;  1HXZ A;  4COP A;  3HPE A;  2LPK A;  3HTY A;  2JN3 A;  3WYQ A;  2GZJ A;  2HYS A;  2QM9 A;  2GZE A;  1YIV A;  2OAR A;  4BX5 A;  4OS8 A;  2K23 A;  1BBP A;  3I55 P;  1A43 A;  2X8S A;  1QY2 A;  3F9D A;  5EZ2 A;  3DS4 A;  3KFG A;  4OS3 A;  3FDC A;  4F37 A;  5B5F A;  1KFF A;  4O4S A;  2RTO B;  3SLO A;  2CM9 A;  1SY1 A;  1CBQ A;  1IUQ A;  2KW2 A;  2ASN X;  4ZGU A;  5KP8 B;  1UYO X;  3S26 A;  2JGP A;  2XKL A;  3EM0 A;  3EJE A;  2QMI A;  3U0D A;  3CCS P;  3P02 A;  1R0U A;  3L4R A;  5B2A O;  1RLB E;  1TOU A;  3C76 X;  1KT7 A;  1RST B;  1LNM A;  4IMN A;  4IBA A;  2KOS A;  3RKG A;  3WZP A;  2EIA A;  3T6L A;  3WJC A;  1TVQ A;  1GXA A;  1VWP B;  2AFE A;  5HGN A;  4GZV A;  3EW2 A;  3RWX A;  1DV9 A;  4TQ2 A;  5IXG A;  3G0V A;  4IB9 A;  4GRJ A;  3LTW A;  1KC8 Q;  4D6B A;  1Y9L A;  1GX3 A;  1LIF A;  1I9H A;  1HQB A;  2DM5 A;  3HWF A;  3RDU A;  1VWH B;  3NBX X;  2PEQ A;  2OVD A;  4GGT A;  4BX6 B;  4BPF A;  3SZI A;  2QOM A;  5HCC C;  4Z2V A;  1K9M Q;  3STK A;  4ORW A;  4NNS A;  1JV4 A;  2CZU A;  2PY8 A;  5LJK A;  1IMQ A;  4MVK A;  3NP1 A;  1Y52 X;  1PM1 X;  2CWO A;  2R56 A;  1KLP A;  2A0A A;  2E1M A;  1UZ2 X;  4KC8 A;  4ZGF A;  2JYG A;  1HY8 A;  3G26 A;  2NNQ A;  2OFB A;  1GT1 A;  5JR8 A;  3BX8 A;  1QFV A;  1HMS A;  5F2B A;  2OY8 A;  1E06 A;  2L9F A;  3O2Y A;  4DCB A;  2LKI A;  3RG6 C;  1S44 A;  3VE2 A;  3BY0 A;  2AT6 X;  2G7B A;  2OF8 A;  4Y59 A;  2BLG A;  2CAM A;  4QNI A;  2PEM A;  2LA7 A;  3CPW O;  2N98 A;  2MF4 A;  3P6C A;  1DV5 A;  1RXK A;  2M5R A;  2FGS A;  2JO0 A;  1BSQ A;  2IZA A;  2POA A;  2IZG B;  2FKJ A;  1JJ2 O;  2HNX A;  3EMM A;  2JB0 A;  2ALL X;  3BU1 A;  2HZQ A;  4O9S A;  4XFZ A;  1XCA A;  1IMP A;  4O3W A;  5HA1 A;  2AMM X;  4RUU A;  4CPI A;  3S60 A;  3HOE A;  4UU2 A;  5CSE A;  1N43 A;  3G4S P;  4BGF A;  3PEC A;  4IPY A;  1EI5 A;  3CBS A;  2RCQ A;  2OVA A;  2BS5 A;  4XFY A;  4BCS A;  4NLJ A;  1KOI A;  2Q2M A;  4IZ6 A;  5IRA A;  1SA8 A;  5B29 A;  4M7M A;  3G7X A;  1RSU B;  2IZI A;  3Q34 A;  4I3B A;  1FR2 A;  1LKE A;  3WOV A;  4C5P A;  2FR3 A;  2AH7 X;  4COC A;  2L6E A;  4U0B A;  1VYG A;  1SLG B;  3RDQ A;  1HY2 A;  4QZU A;  5EED A;  7CEI A;  3GE2 A;  2Q9S A;  4MEE A;  2YG2 A;  2RTR B;  1PBY A;  3OE3 A;  1O1U A;  4PH0 A;  2G78 A;  2L5P A;  1JYD A;  5LJG A;  1VWL B;  3U43 A;  4DNE A;  4OMX A;  4ARH A;  2RTL A;  3ZQ3 A;  3PK2 A;  1SWC A;  1RNI A;  2KTS A;  2VLN A;  2E4J A;  1LDQ A;  3GAQ A;  4IAX A;  5DG4 A;  1PBO A;  5F6B A;  1DZM A;  1AVD A;  5D47 A;  4EFG A;  2IZC B;  5C0N A;  1ZNE A;  1LFO A;  2FS7 A;  1OBP A;  3WZO A;  1E00 A;  1VWQ B;  2HZR A;  4A8Z A;  2OTL P;  1KXO A;  2MHD A;  3APW A;  3CQN A;  4CPE A;  3FYF A;  2MR7 A;  3EC5 A;  1FDQ A;  2M8N A;  1GKA A;  2RTI B;  4BX7 A;  4ZH6 A;  1NC9 A;  1YWB A;  2KTD A;  2WR6 A;  2X45 A;  1Y0G A;  4XMD A;  3AUM O;  4LQZ A;  1SWG A;  1GM6 A;  4XMG A;  2LKK A;  1U18 A;  2QOS C;  5FEN A;  1VQO P;  2W2A A;  3EW1 A;  4UU3 A;  5CZD B;  2AKQ A;  5BYP A;  1KZW A;  2FQ2 A;  5H9L A;  2K92 A;  4YGH A;  2CGQ A;  2L4B A;  3VHM A;  1OEE A;  3QKG A;  2IZD B;  4GR6 A;  1W4T A;  4PSQ A;  1G7N A;  2HMB A;  2PEI A;  4ALB A;  2A3F X;  1SRH A;  1YP6 A;  1ML7 A;  1K3B A;  4U8U N;  5FQ7 E;  1KL5 A;  3O22 A;  1T0V A;  5D45 A;  2GZF A;  4Y0P A;  4R0B A;  2K0X A;  1QAB E;  1OPB A;  2ANS A;  5HA0 A;  4MIS A;  4CPF A;  1FEN A;  2FR2 A;  3SLT A;  2Q4N A;  2RTP B;  1LCV A;  4BOE A;  3Q20 A;  3PED A;  2O62 A;  2Z4I A;  2GDY A;  2GTL M;  2BT9 A;  3E3C A;  4NEO A;  2K62 A;  1FEL A;  4GK9 A;  3ZW1 A;  3B5I A;  1VWI B;  5LJH A;  5EPQ A;  3CME P;  1L6M A;  2L0Q A;  1I05 A;  2EFJ A;  1Y53 X;  1NP4 A;  1VWA B;  1SXX A;  1NGL A;  1GXG A;  2KG6 A;  2OL8 O;  3DS0 A;  5HTE A;  3ZZV A;  4FGI B;  2X8T A;  4MVI A;  1YWD A;  1YIJ P;  4YMY A;  1YWA A;  4EEJ A;  1X71 A;  4IRW A;  1LCW A;  2GYK A;  3IFB A;  3NPO A;  3FID A;  1SWN A;  2FRS A;  2ZSC A;  1SY0 A;  3AKN A;  4JHQ A;  4O3Z A;  1SWH A;  2IZK A;  4GE1 A;  4ZHC A;  4GNY A;  4BJ8 A;  1KL4 A;  5L8N A;  4IAW A;  5B3M O;  2KOQ A;  1L0I A;  1SWA A;  4YGG A;  2CBS A;  4HFO A;  4GET A;  2W2F A;  1S72 P;  4QYP A;  1VHN A;  3ELX A;  4QZT A;  1OSP O;  3V8U A;  2JMB A;  3H47 A;  3DTQ A;  2EHT A;  3ZW2 A;  2LFO A;  2BC3 A;  2MO5 A;  2LBA A;  2LOL A;  4BVM A;  4TKB A;  4GKC A;  4U9C A;  2LML A;  1VQ6 P;  2G5L A;  1RO0 A;  3B2K A;  4LKT A;  2CG5 B;  4R0M A;  1LPJ A;  1G85 A;  2WSJ A;  2RTK A;  4I3C A;  1Q7Y Q;  3DTJ A;  1ZNH A;  3P24 A;  2NND A;  4TJZ A;  1T8V A;  1DF8 A;  3NQK A;  4U3Q A;  3BU9 A;  1NQN A;  3KFH A;  4NV7 A;  5LKE A;  4AZN A;  3VHH A;  4QNB A;  1VWN B;  2ACP X;  1ZND A;  2EG5 A;  1M90 Q;  1QG5 A;  4IMO A;  1OR5 A;  2XXM A;  1N9Y A;  1SY2 A;  1E2T A;  2Q39 A;  5AQ6 A;  3VU1 A;  3G71 P;  3VG5 A;  5IRU A;  1SRI A;  1ADL A;  2Z4H A;  4EXZ A;  1A18 A;  4QQ1 A;  4DG9 A;  3H3I A;  3TGC A;  3FMZ A;  1SWF A;  1ZNV A;  5H8T A;  4NYR A;  3PQS A;  4O4X A;  2Z46 A;  3APU A;  4H2W C;  2DJG A;  1YI2 P;  1HMT A;  5H9A A;  4GJS A;  2P9X A;  4CDC A;  2XZ0 D;  2WQ9 A;  2MD9 A;  1RAV A;  4AZR A;  1F80 D;  3WJF A;  3EJB A;  3E2D A;  2AFD A;  3G29 A;  2KOD A;  4XME A;  5EJD A;  1YIT P;  1X8O A;  5F1E A;  4B55 A;  4BX6 A;  1EPB A;  2GZI A;  4QKO A;  1A2D A;  1IJ8 A;  2KWL A;  2VSQ A;  3VGW A;  3G21 A;  2AL0 X;  1KT4 A;  4JGL A;  4Y0R A;  5BVQ A;  2MF6 A;  2NP1 A;  1MUP A;  3CE7 A;  4HPD A;  2DGY A;  5K68 A;  1X8N A;  1EPA A;  1JIW I;  3Q6L A;  3SZJ A;  1RO2 A;  1VQM P;  2FTB A;  4EKV A;  4U46 A;  4INN A;  3MX7 A;  1SXY A;  1YJ9 P;  4IB8 A;  3VG6 A;  2C4I A;  5FAZ A;  1OBU A;  4ID2 A;  2FQ0 A;  3BDR A;  2BSZ A;  3IA8 A;  3RG2 A;  2AVI A;  1VQ9 P;  1DNY A;  3HWG A;  3NQ3 A;  1TW4 A;  2QO5 A;  1UNK A;  1AVE A;  2X2B A;  5BS2 A;  2X55 A;  4U0D A;  2MJI A;  1A57 A;  1VYF A;  4YFP A;  4BPH A;  3PH6 A;  1YJN P;  5CHK A;  5KID A;  3WZN A;  3OW2 O;  5KIC A;  2UYW A;  5BVS A;  3O19 A;  4I6S A;  1O1V A;  3AKM A;  4KII A;  1TXL A;  1VWC B;  2M8L A;  5HV8 A;  4ZCB A;  3SAO A;  2IZH B;  2HKD A;  4BBO A;  2JGS A;  4Y0S A;  4ZJ0 A;  3CMA P;  3NX2 A;  1X89 A;  3FEK A;  1LIC A;  2RTQ B;  4XMF A;  1HQQ A;  1BRP A;  1IKJ A;  4TKH A;  3SLJ A;  1IFC A;  3X00 A;  1D3S A;  2BHV A;  4O4U A;  4CPH A;  2GDX A;  5HZ5 A;  1D1D A;  4N7D A;  2X46 A;  1NDJ A;  1IKE A;  1RXH A;  4AW8 A;  5IO6 A;  1VWJ B;  4QGV A;  2CNR A;  4AZP A;  1VWG B;  2N6Y A;  2AT0 X;  2LF4 A;  3TGB A;  1Y55 X;  4K19 A;  2JU1 A;  3RE5 A;  1GT4 A;  2X34 A;  2JW1 A;  1N8R Q;  1SWB A;  4O3X B;  1W2B O;  1SWR A;  1M6N A;  2VFB A;  1N4J A;  2RTH B;  2ZAG A;  4TKJ A;  4EDE A;  1Q86 Q;  4PH1 A;  5FQ6 E;  3APV A;  1IFB A;  1SMP I;  4NV8 A;  2RTB B;  2FWV A;  4U0E A;  1VWK B;  3TF6 A;  1B0O A;  2VLQ A;  3HYB A;  5JD2 A;  2RD7 C;  4ML7 B;  3D9W A;  1I78 A;  3CCM P;  2G8C O;  1GX8 A;  4ON1 A;  3STN A;  4IB7 A;  1SWU A;  1AF8 A;  3F8A A;  4ZH9 A;  2N93 A;  2IZE B;  2FHN X;  2F09 A;  2GC9 A;  2BUO A;  2JBG A;  3VPJ E;  2PEK A;  2L9C A;  1JZU A;  2DNW A;  3DS3 A;  2JQ4 A;  1FTP A;  3BSZ E;  2GH7 A;  2MVV A;  1NBX A;  2C1Q A;  3VE1 A;  2PEO A;  3HK1 A;  3NX1 A;  1EIO A;  2KGA A;  3FA8 A;  1HMR A;  1W6F A;  1AQB A;  2X8F A;  4PJ2 A;  3VG2 A;  2VLO A;  5HVC A;  2FS6 A;  4ES7 A;  1JBH A;  3HZQ A;  4ODD A;  3CCL P;  4DQ4 A;  1ACP A;  2KR5 A;  2AF8 A;  3FEP A;  1VQK P;  3ZUI A;  1GX9 A;  1JYJ A;  1SXW A;  3SOT A;  5HZ9 A;  1EQD A;  1Q82 Q;  4I60 A;  3FIQ A;  2GJ5 A;  3MBT A;  4XRO A;  4UHP B;  2CZT A;  3I56 P;  2FLJ A;  3STM X;  5LKF A;  1VQ4 P;  4YDA A;  3LRY A;  2MWH A;  2FAC A;  4KH8 A;  2A8G A;  3NTE A;  3FR5 A;  4HPB A;  3RBY A;  1FEM A;  1VWR B;  3UEV A;  1AVG I;  2GTL O;  4YBP A;  1CRB A;  2ACO A;  1GKA B;  2N5H A;  1BEB A;  2OY1 O;  5HZ6 A;  2M4L A;  3D4R A;  2IZB A;  1VYO A;  4HPA A;  4ORS A;  4NYQ A;  5KP7 B;  5F7G A;  3NR3 A;  5LJD A;  1EW3 A;  1LIE A;  3GZL A;  5K67 A;  3VHI A;  3B2J A;  1JQP A;  4WBK A;  2PEJ A;  3CKF A;  4ZR2 A;  1EIA A;  2BS6 A;  1MX7 A;  1VWF B;  1Y9T A;  2WPU A;  1X8Q A;  1STP A;  1KD1 Q;  4YKO A;  2K5X A;  1EUO A;  4WYM A;  1SWQ A;  4IAB A;  4KC7 A;  3WXQ A;  3EYC A;  5CE4 A;  3LV4 A;  3NAD A;  4BQU A;  1ICM A;  1QRJ A;  1SRG A;  5K06 A;  1K24 A;  4LZV A;  1SWE A;  2OYB O;  2FAD A;  1JMZ A;  1AYI A;  3P6E A;  1CBR A;  5HGL A;  1EOQ A;  4HWM A;  1GXH A;  1U17 A;  1FJ1 E;  2QNW A;  2KG8 A;  1QY0 A;  4CV7 A;  3VG3 A;  5H9K A;  4AYH A;  3GKL C;  3FEL A;  2PY1 A;  3G6E P;  3B2H A;  1YHQ P;  1N9M A;  2IZL B;  2FKG A;  2IZJ A;  2OVS A;  4YKM A;  2OL6 O;  2OZQ A;  3WBG A;  1OEJ A;  4YBU A;  4WFU A;  1B4M A;  1JMX A;  4Z27 A;  3GJN A;  3WJG A;  3ZW0 A;  3FR4 A;  2GZG A;  1SLD B;  2G79 A;  2A2U A;  2L67 A;  1VQ5 P;  3KVN A;  3FA6 A;  1N7Y A;  3PPT A;  1BSO A;  3D97 A;  1MX8 A;  1X8P A;  4H2X C;  5JPA A;  1S2P A;  2PI3 O;  4FBR A;  3JSQ A;  5HGM A;  2WUT A;  1CBI A;  2RCT A;  4GDZ A;  4WFV A;  1SXU A;  1QQS A;  4Z6J A;  2K2Q A;  4O4O A;  2AT8 X;  1I04 A;  3B2L A;  3WVM A;  4KCA A;  1IW2 A;  1QVG O;  1LCZ A;  3VG7 A;  3DSZ A;  3CCR P;  3CKG A;  3CXC O;  3CCQ P;  3QQ2 A;  1MZ8 A;  3T2X A;  2A2G A;  5IO7 A;  2PEN A;  3NY7 B;  4QYN A;  2QA4 P;  4TLJ A;  4O49 A;  1VWB B;  1ZRY A;  2MY5 A;  4LZU A;  2K0D X;  4YDB A;  2RTD B;  4PXH B;  1VQP P;  1GT3 A;  4OS0 A;  1YP7 A;  2I5Z O;  1M1K Q;  4GUZ A;  1SY3 A;  1AB0 A;  1VQL P;  4FBO A;  1GGL A;  1KT6 A;  2QEX P;  4O3Y A;  2RN4 A;  2EU7 X;  1ZNL A;  3I17 A;  2HLV A;  4I3D A;  1MVG A;  2JU7 A;  4GR2 A;  2L68 A;  2XZ1 C;  2Y32 A;  5EDC A;  1BAJ A;  1B56 A;  1UJZ A;  1E6J P;  4U8U M;  2WQA E;  2LIU A;  4CDE A;  3RE6 A;  4ZHG A;  3WBH A;  3NQ9 A;  5L8I A;  1NQ4 A;  5AJC A;  2NO8 A;  5B5G A;  2KW1 A;  1K30 A;  4GGR A;  3C77 X;  1FE3 A;  4IB6 A;  2WEW A;  1CEI A;  4ORU A;  1JJU A;  3BRN A;  4MVE A;  1BXI A;  1G5W A;  3RDM A;  2QCB A;  2QO4 A;  1RBP A;  5L3Y A;  4BX5 B;  1NP1 A;  3FA9 A;  1T8K A;  3MVF A;  1SWD A;  1LUQ A;  2RTG B;  3CR6 A;  3RY1 A;  2RTN B;  4ORX A;  3EBK A;  4A60 A;  5HZ8 A;  2Y3F A;  3VG4 A;  2L22 A;  1CBS A;  2JOZ A;  4A1Y A;  5HBS A;  1VWD B;  4NLI A;  5F2N A;  1TOW A;  1KQW A;  2KGE A;  3CCE P;  3WJD A;  2CM4 A;  2FVF A;  3N91 A;  2VFC A;  2MR8 A;  1NJI Q;  3T2W A;  4COT A;  5EW5 E;  2R73 A;  5L8O A;  3FR2 A;  4I9S A;  3HWE A;  4M6S A;  2RA6 A;  4YFR A;  4A1H A;  4ZHD A;  3FEN A;  1VKU A;  2LB6 A;  2KGC A;  1KQX A;  1LEL A;  3CC2 P;  4NNT A;  1GT5 A;  2A13 A;  1OBQ A;  1BRQ A;  4OEL A;  2JAZ A;  2A5B A;  2X32 A;  4GD9 A;  1BWY A;  4KT5 A;  1QVF O;  3H4E A;  3JS1 A;  4GU8 A;  3PH5 A;  1WUB A;  2AT5 X;  2K94 A;  3S5X A;  2KOO A;  5HTD A;  3RSW A;  4H2Y C;  3P6F A;  2OFR X;  5FFH A;  4QGX A;  1EMV A;  2FVA A;  1GPJ A;  5DPQ A;  4YFQ A;  2RTM A;  3CWK A;  1QWD A;  4FBV A;  3CC4 P;  1A8O A;  4Z2P A;  3I0A A;  3RZY A;  2WEX A;  5H9N A;  2N5I A;  1JJJ A;  3GZM A;  2FT9 A;  1L0H A;  4NP1 A;  1VQ8 P;  1HXL A;  2Q2P A;  2JU3 A;  4CDD A;  2N6Z A;  3CC7 P;  3ZWE A;  1S7D A;  1LIB A;  4QRL A;  2LL8 A;  1VWM B;  2GTF X;  3S5V A;  5KP6 B;  3D96 A;  4ZHH A;  4LKP A;  5IRW A;  2C1S A;  4Y5D A;  5B11 O;  5B27 A;  3LMO A;  1SLE B;  4L3R A;  4QAE A;  4BPG A;  3C78 X;  2N50 A;  1STS B;  3BX7 A;  2OY7 A;  2KGD A;  2KOR A;  2ZAI A;  3CCU P;  1BM5 A;  3K3L A;  1URE A;  1OEK A;  1M6E X;  4OEM A;  2PNG A;  1AEL A;  5BVT A;  1SWT A;  1AUM A;  5EEE A;  1KQS O;  3F6Z B;  2K0Y A;  2VLP A;  4ORY A;  2OL7 A;  3WZQ A;  3APX A;  4Z2O A;  2IFB A;  5I4T G;  3CCJ P;  4CPH B;  1IIU A;  2RTA A;  3B4Q A;  1U0X A;  4CSB A;  3EJD A;  2RTF B;  5DCK A;  1ACD A;  2F73 A;  2Z44 A;  1T68 X;  4XRQ A;  2AF5 A;  4ORR A;  3DS1 A;  1KT5 A;  1ZNG A;  2GTL N;  1I4U A;  4YH0 A;  3KFF A;  1HBQ A;  4XFX A;  1SRF A;  1PMP A;  4CA3 A;  4OKA A;  3WYP A;  5AJB A;  3T1D A;  1XKI A;  3ELZ A;  1G74 A;  5BS1 A;  5EDB A;  4JNJ A;  2RQ0 A;  1DZJ A;  3OJY C;  1Z6M A;  3KFI A;  5LJB A;  2LBV A;  4HKG A;  1SLF B;  1MDC A;  4QGW A;  2OVE A;  3CBC A;  2VDF A;  1ALB A;  1SRE A;  2K93 A;  1E5P A;  1DFV A;  3WJE A;  1O8V A;  3P6G A;  2GDW A;  1DZK A;  4Y0Q A;  2AT3 X;  2NNE A;  3ZUO A;  2EHS A;  4JO6 A;  3UEW A;  1CJ5 A;  1K8A Q;  3HOL A;  3LHN A;  1SRJ A;  1BJ7 A;  4YCH A;  3PDF A;  4AZQ A;  1OPA A;  3G1G A;  4U0A A;  1P6P A;  3D95 A;  3P05 A;  2KD2 A;  3OBL A;  2R74 A;  1ICN A;  2A5C A;  3T6F A;  1STR B;  4GDA A;  5D8J A;  3FLL A;  1UYN X;  4MVL A;  2JU2 A;  3UAQ A;  4ZFX A;  1A3Y A;  3U03 A;  2OTJ P;  1VWE B;  2FVE A;  1M74 A;  1D2U A;  2RTE B;  3JQO A;  4AZM A;  1NQM A;  1EXS A;  4YVB A;  1MM9 A;  1MOY A;  4BX7 B;  3KZA A;  1KGL A;  4GNW A;  5D48 A;  1KZX A;  4CDF A;  2XST A;  1ERX A;  2XV6 A;  2LIW A;  1H91 A;  2RTC B;  1WBI A;  1BSY A;  2CBR A;  3BS2 A;  3TGA A;  1SWS A;  1QFT A;  3G1I A;  5F6Z A;  1LDO A;  1SWJ A;  2P8G A;  1X8U A;  4MIR A;  4TNN A;  1HN2 A;  1EAL A;  3P6D A;  1ERB A;  4OMW A;  2I5V O;  2FQ1 A;  3BLG A;  1ZMB A;  3VRL C;  1RXJ A;  1LF7 A;  2OFA A;  1QY1 A;  4WHI A;  2OF9 A;  1B8E A;  3CCV P;  3B2I A;  5KHP A;  5FQ8 E;  2KT4 B;  3HWD A;  4XMC A;  1PTS A;  2CQ8 A;  4ZHF A;  5LJC A;  4GH7 A;  2M8P A;  1KT3 A;  3PP6 A;  1E02 A;  1PEE A;  3MG5 A;  4M0I A;  4RUN A;  3M1M A;  3U9P C;  2UZ2 A;  3UEX A;  4MRT C;  4ALO A;  2JYL A;  3DS5 A;  1N0S A;  1K73 Q;  4I9R A;  3FW4 A;  2MVU A;  1YWC A;  1VPR A;  4YGZ A;  1JJX A;  5IO5 A;  3ZW1 B;  3SZH A;  4FQB B;  3MGE A;  1ZNK A;  5HCD C;  1VQ7 P;  5HCE C;  1SWL A;  3P6H A;  3H0D A;  5HAE A;  1W5R A;  2LTE A;  4N7C A;  2YMS A;  2DJF A;  3ZI8 A;  1HBP A;  1EII A;  1DZP A;  3EBW A;  5F2K A;  2OFM X;  2ERH A;  4CK4 A;  3FA7 A; 
#chains in the Genus database with same CATH homology
 2WR6 A;  3UEU A;  1I06 A;  2CM4 A;  2X45 A;  4XMD A;  2XT1 A;  1YWB A;  3CMP A;  1D1D A;  4N7D A;  2X46 A;  3N91 A;  5F58 A;  1Z24 A;  1IKE A;  1NJI Q;  4LQZ A;  4XMH A;  4AW8 A;  4DQ3 A;  2ONT A;  4COT A;  5HWZ A;  1GM6 A;  2R73 A;  4HPC A;  5IO6 A;  5L8O A;  3FR2 A;  4I9S A;  4XMG A;  2LKK A;  3HWE A;  4M6S A;  4AZO A;  1U18 A;  2RA6 A;  5AEO A;  3ZW0 B;  4QGV A;  4A1H A;  4YFR A;  4L1N A;  4ZHD A;  2QOS C;  4U8U O;  5HZQ A;  1VQO P;  2W2B A;  4AZP A;  5FEN A;  3FEN A;  2W2A A;  2LB6 A;  1KQX A;  4UU3 A;  2AT0 X;  3CC2 P;  3CQR A;  3WJB A;  5BYP A;  2AKQ A;  4NNT A;  2LF4 A;  3TGB A;  5CYB A;  1KZW A;  5H9L A;  1LID A;  4K19 A;  1GT5 A;  4YGH A;  2A13 A;  3DS2 A;  1HQP A;  1OBQ A;  1YJW P;  3G28 A;  1GT4 A;  1DC9 A;  4NW4 A;  1OEE A;  5HGO A;  1YUP A;  1BRQ A;  2JW1 A;  3QKG A;  3PQU A;  2WWP A;  1BWY A;  1N8R Q;  4GR6 A;  4KT5 A;  1BLR A;  1QVF O;  4O3X B;  1W2B O;  4PSQ A;  1M6N A;  1G7N A;  2HMB A;  3H4E A;  2PEI A;  2ZAG A;  4TKJ A;  4D6A A;  4EDE A;  1Q86 Q;  3JS1 A;  4GU8 A;  4ALB A;  2A3F X;  4PH1 A;  3PH5 A;  3CD6 P;  2AT5 X;  5FQ6 E;  1YP6 A;  1ML7 A;  3S5X A;  3APV A;  1IFB A;  1SMP I;  4U8U N;  5F2O A;  3FA7 A;  2Z45 A;  4U0C A;  5FQ7 E;  5HTD A;  2FWV A;  3O22 A;  4U0E A;  3RSW A;  1T0V A;  3P6F A;  2OFR X;  3TF6 A;  2MM3 A;  5FFH A;  1B0O A;  5D45 A;  4Y0P A;  4QGX A;  4R0B A;  3HYB A;  4EQA C;  1QAB E;  2RD7 C;  1OPB A;  4ML7 B;  2ANS A;  4YFQ A;  5DPQ A;  5HA0 A;  3CWK A;  4MIS A;  3CCM P;  1FEN A;  1QWD A;  4FBV A;  2FR2 A;  3CC4 P;  3DPH A;  1A8O A;  1GX8 A;  2Q4N A;  1Q81 Q;  4BOE A;  3Q20 A;  4ON1 A;  3PED A;  4IB7 A;  5D4A A;  3STN A;  2O62 A;  2Z4I A;  3I0A A;  4U0F A;  3RZY A;  5LJE A;  2GTL M;  3F8A A;  4ZH9 A;  2N93 A;  2BT9 A;  2WEX A;  3E3C A;  3FW5 A;  1VQN P;  2K62 A;  2QO6 A;  1FEL A;  2F09 A;  4GK9 A;  5H9N A;  2GC9 A;  3TZS A;  3ZW1 A;  1DF3 A;  1JJJ A;  2BUO A;  3B5I A;  4YCE A;  3OD9 A;  5LJH A;  3KQ0 A;  5EPQ A;  2FT9 A;  3VPJ E;  3CME P;  1L6M A;  2JU8 A;  1I05 A;  1VQ8 P;  4I95 A;  4NP1 A;  2PEK A;  2L9C A;  4COP A;  2EFJ A;  2Q2P A;  2JU3 A;  1JZU A;  1NP4 A;  3HTY A;  2JN3 A;  3CC7 P;  3ZWE A;  1SXX A;  3DS3 A;  1NGL A;  1S7D A;  2HYS A;  2QM9 A;  1LIB A;  1FTP A;  1YIV A;  3BSZ E;  2OAR A;  4OS8 A;  2PEO A;  3VE1 A;  4QRL A;  2K23 A;  1BBP A;  3I55 P;  3DS0 A;  1A43 A;  2X8S A;  3HK1 A;  3NX1 A;  1EIO A;  5HTE A;  2GTF X;  1QY2 A;  2X8T A;  3F9D A;  1YWD A;  4FGI B;  4MVI A;  5EZ2 A;  3ZZV A;  3DS4 A;  3D96 A;  1YIJ P;  3S5V A;  3FA8 A;  3KFG A;  4OS3 A;  1HMR A;  4ZHH A;  4YMY A;  4LKP A;  1YWA A;  4EEJ A;  1AQB A;  2X8F A;  4PJ2 A;  5B27 A;  3VG2 A;  2FS6 A;  1X71 A;  4ES7 A;  4O4S A;  3HZQ A;  4ODD A;  1JBH A;  2CM9 A;  4L3R A;  1SY1 A;  3IFB A;  4QAE A;  1CBQ A;  1IUQ A;  3C78 X;  3NPO A;  3CCL P;  4DQ4 A;  2ASN X;  3FEP A;  3BX7 A;  4ZGU A;  3S26 A;  1VQK P;  3ZUI A;  5HZ5 A;  1GX9 A;  1JYJ A;  1SXW A;  3SOT A;  5HZ9 A;  2XKL A;  1EQD A;  1Q82 Q;  3EM0 A;  2FRS A;  2QMI A;  3U0D A;  3CCS P;  3P02 A;  3FIQ A;  1R0U A;  1SY0 A;  2ZAI A;  3L4R A;  3CCU P;  1RLB E;  2GJ5 A;  3MBT A;  1TOU A;  1BM5 A;  4XRO A;  3C76 X;  1KT7 A;  3AKN A;  3K3L A;  4O3Z A;  1URE A;  1OEK A;  2CZT A;  1M6E X;  3I56 P;  1LNM A;  2FLJ A;  4GE1 A;  4IMN A;  4IBA A;  5LKF A;  3STM X;  4ZHC A;  4GNY A;  1VQ4 P;  1AEL A;  5BVT A;  4YDA A;  1AUM A;  3LRY A;  2MWH A;  4KH8 A;  5EEE A;  3RKG A;  3NTE A;  3FR5 A;  4HPB A;  2EIA A;  3RBY A;  3WJC A;  1FEM A;  1KQS O;  1TVQ A;  4IAW A;  1GXA A;  5L8N A;  3UEV A;  3F6Z B;  1AVG I;  5HGN A;  2GTL O;  4GZV A;  3RWX A;  4ORY A;  4YGG A;  4YBP A;  2CBS A;  1DV9 A;  1CRB A;  2ACO A;  4HFO A;  4TQ2 A;  4GET A;  3G0V A;  3APX A;  1GKA B;  4IB9 A;  2IFB A;  4GRJ A;  5I4T G;  1S72 P;  3CCJ P;  1BEB A;  2W2F A;  4QYP A;  1KC8 Q;  3ELX A;  1IIU A;  4D6B A;  4CSB A;  1U0X A;  1Y9L A;  5HZ6 A;  5DCK A;  2M4L A;  3D4R A;  4QZT A;  3V8U A;  1LIF A;  1ACD A;  2F73 A;  2DM5 A;  3HWF A;  2JMB A;  4ORS A;  2Z44 A;  3H47 A;  3DTQ A;  4HPA A;  3ZW2 A;  4NYQ A;  1T68 X;  2LFO A;  4XRQ A;  5F7G A;  2MO5 A;  3NR3 A;  3NBX X;  2LBA A;  2PEQ A;  4ORR A;  5LJD A;  1EW3 A;  1LIE A;  4BVM A;  3DS1 A;  4TKB A;  1KT5 A;  2OVD A;  1ZNG A;  3B2J A;  4GKC A;  4WBK A;  4U9C A;  2PEJ A;  2GTL N;  4ZR2 A;  5HCC C;  1VQ6 P;  1EIA A;  1I4U A;  2BS6 A;  1K9M Q;  4YH0 A;  3KFF A;  1MX7 A;  1HBQ A;  4XFX A;  3STK A;  1RO0 A;  1Y9T A;  4ORW A;  3B2K A;  4NNS A;  4LKT A;  1X8Q A;  1PMP A;  1JV4 A;  1KD1 Q;  2CZU A;  4YKO A;  2PY8 A;  5LJK A;  1EUO A;  1LPJ A;  4WYM A;  1G85 A;  4IAB A;  4KC7 A;  5AJB A;  3WXQ A;  3T1D A;  1XKI A;  3ELZ A;  2WSJ A;  1G74 A;  3EYC A;  5CE4 A;  4MVK A;  3NP1 A;  3LV4 A;  4I3C A;  1Q7Y Q;  3NAD A;  3DTJ A;  1ZNH A;  1PM1 X;  3P24 A;  5BS1 A;  2CWO A;  2NND A;  2R56 A;  4TJZ A;  5EDB A;  1ICM A;  1T8V A;  1QRJ A;  3NQK A;  4U3Q A;  4BQU A;  2A0A A;  2RQ0 A;  1DZJ A;  2E1M A;  3BU9 A;  5K06 A;  1UZ2 X;  3KFH A;  4LZV A;  4KC8 A;  3OJY C;  3KFI A;  4ZGF A;  2JYG A;  4AZN A;  5LKE A;  2LBV A;  5LJB A;  3P6E A;  3G26 A;  2NNQ A;  4QNB A;  1MDC A;  1CBR A;  5HGL A;  1ZND A;  2ACP X;  2EG5 A;  4QGW A;  1M90 Q;  1EOQ A;  1GT1 A;  5JR8 A;  2OVE A;  4HWM A;  3BX8 A;  3CBC A;  1QFV A;  1HMS A;  1QG5 A;  4IMO A;  1ALB A;  1U17 A;  2XXM A;  1E5P A;  1E06 A;  1SY2 A;  2Q39 A;  1DFV A;  5AQ6 A;  3O2Y A;  3G71 P;  3VG5 A;  3VU1 A;  3WJE A;  1QY0 A;  3RG6 C;  1S44 A;  1ADL A;  2Z4H A;  1O8V A;  1A18 A;  4EXZ A;  4CV7 A;  3VE2 A;  3P6G A;  4QQ1 A;  3VG3 A;  5H9K A;  3BY0 A;  2AT6 X;  1DZK A;  4Y0Q A;  3H3I A;  4AYH A;  2G7B A;  2AT3 X;  3TGC A;  2NNE A;  3FMZ A;  3FEL A;  2PY1 A;  3ZUO A;  3G6E P;  3UEW A;  3B2H A;  5H8T A;  4NYR A;  1YHQ P;  3PQS A;  1CJ5 A;  4O4X A;  1K8A Q;  3HOL A;  2Z46 A;  3APU A;  3LHN A;  2OVS A;  1BJ7 A;  2OFM X;  2BLG A;  1YI2 P;  4YCH A;  1HMT A;  4YKM A;  4AZQ A;  1OPA A;  3G1G A;  2OZQ A;  4QNI A;  2PEM A;  2LA7 A;  5H9A A;  3WBG A;  1OEJ A;  4YBU A;  3CPW O;  4WFU A;  4U0A A;  1P6P A;  4CK4 A;  3D95 A;  3P05 A;  1B4M A;  2KD2 A;  3P6C A;  3OBL A;  2R74 A;  2P9X A;  1ICN A;  2WQ9 A;  5D8J A;  3FLL A;  3WJG A;  3ZW0 A;  3FR4 A;  4MVL A;  2G79 A;  2A2U A;  2JO0 A;  4AZR A;  2L67 A;  3UAQ A;  1BSQ A;  1VQ5 P;  4ZFX A;  2POA A;  3FA6 A;  1A3Y A;  3U03 A;  3WJF A;  1JJ2 O;  2OTJ P;  3E2D A;  2HNX A;  3PPT A;  1BSO A;  3D97 A;  3EMM A;  1MX8 A;  1M74 A;  1X8P A;  2ALL X;  1D2U A;  3BU1 A;  2HZQ A;  5JPA A;  1S2P A;  4XFZ A;  1XCA A;  3JQO A;  4O9S A;  4AZM A;  1EXS A;  3G29 A;  2KOD A;  4O3W A;  4XME A;  3KZA A;  5HA1 A;  1KGL A;  2AMM X;  4FBR A;  4GNW A;  1YIT P;  3JSQ A;  4RUU A;  5D48 A;  1X8O A;  5F1E A;  1KZX A;  5HGM A;  2WUT A;  1CBI A;  2XST A;  1ERX A;  1EPB A;  2XV6 A;  2RCT A;  3HOE A;  4GDZ A;  4WFV A;  3S60 A;  1A2D A;  1SXU A;  1QQS A;  4UU2 A;  3G21 A;  3G4S P;  2AL0 X;  1H91 A;  1KT4 A;  4O4O A;  4JGL A;  4Y0R A;  1BSY A;  3PEC A;  5BVQ A;  2AT8 X;  2CBR A;  4IPY A;  1EI5 A;  1I04 A;  2RCQ A;  3B2L A;  3BS2 A;  3CBS A;  3WVM A;  2OVA A;  4KCA A;  1IW2 A;  2NP1 A;  1QVG O;  1MUP A;  3TGA A;  4HPD A;  3VG7 A;  2BS5 A;  4XFY A;  2DGY A;  3G1I A;  1QFT A;  3DSZ A;  4NLJ A;  1KOI A;  5F6Z A;  1X8N A;  1EPA A;  1JIW I;  3CCR P;  2P8G A;  3CXC O;  1X8U A;  2Q2M A;  3CCQ P;  1RO2 A;  3Q6L A;  1SA8 A;  4MIR A;  4TNN A;  5B29 A;  1VQM P;  2FTB A;  4M7M A;  2A2G A;  3G7X A;  5IO7 A;  2PEN A;  4INN A;  4QYN A;  2QA4 P;  1HN2 A;  4I3B A;  1EAL A;  4TLJ A;  3MX7 A;  1SXY A;  3P6D A;  1LKE A;  4O49 A;  1ZRY A;  1YJ9 P;  4LZU A;  3WOV A;  4YDB A;  1ERB A;  2FR3 A;  4IB8 A;  4OMW A;  3VG6 A;  5FAZ A;  1OBU A;  3VRL C;  1ZMB A;  3BLG A;  4ID2 A;  1VQP P;  1GT3 A;  1LF7 A;  4OS0 A;  1QY1 A;  3BDR A;  2AH7 X;  3IA8 A;  4COC A;  1YP7 A;  4WHI A;  1B8E A;  2L6E A;  1M1K Q;  4U0B A;  1VYG A;  3CCV P;  1SY3 A;  1AB0 A;  1VQL P;  1VQ9 P;  1GGL A;  4FBO A;  4QZU A;  1KT6 A;  3B2I A;  5EED A;  5KHP A;  5FQ8 E;  2KT4 B;  3GE2 A;  2QEX P;  3HWG A;  2Q9S A;  4O3Y A;  2RN4 A;  2EU7 X;  3NQ3 A;  1TW4 A;  3HWD A;  4XMC A;  2YG2 A;  1ZNL A;  3I17 A;  2QO5 A;  3OE3 A;  2HLV A;  1O1U A;  4I3D A;  1MVG A;  2JU7 A;  4GR2 A;  2L68 A;  4PH0 A;  4ZHF A;  2G78 A;  2L5P A;  1JYD A;  5LJC A;  5LJG A;  4GH7 A;  5BS2 A;  5EDC A;  1BAJ A;  2M8P A;  4U0D A;  1B56 A;  1KT3 A;  2MJI A;  3PP6 A;  1E6J P;  1A57 A;  4U8U M;  1VYF A;  4OMX A;  1E02 A;  2WQA E;  1PEE A;  4YFP A;  4ARH A;  3PH6 A;  3ZQ3 A;  1YJN P;  4M0I A;  5KID A;  4RUN A;  3OW2 O;  3M1M A;  3U9P C;  3UEX A;  4ALO A;  1RNI A;  4ZHG A;  5KIC A;  2JYL A;  2KTS A;  3DS5 A;  2E4J A;  3WBH A;  1N0S A;  5BVS A;  3NQ9 A;  1K73 Q;  4I9R A;  5L8I A;  3GAQ A;  4IAX A;  3FW4 A;  1YWC A;  1VPR A;  3O19 A;  4I6S A;  4YGZ A;  5AJC A;  5DG4 A;  1JJX A;  5IO5 A;  1PBO A;  5F6B A;  1O1V A;  2KW1 A;  1K30 A;  3ZW1 B;  1DZM A;  3AKM A;  4KII A;  5D47 A;  3C77 X;  4EFG A;  1FE3 A;  4FQB B;  4IB6 A;  2WEW A;  1ZNE A;  5C0N A;  3MGE A;  1LFO A;  1TXL A;  1ZNK A;  2FS7 A;  5HCD C;  1OBP A;  4ORU A;  3BRN A;  2M8L A;  1VQ7 P;  1E00 A;  4MVE A;  5HCE C;  2HZR A;  4ZCB A;  1G5W A;  3SAO A;  3P6H A;  2QO4 A;  2OTL P;  3H0D A;  1KXO A;  4A8Z A;  4Y0S A;  5HAE A;  1RBP A;  2MHD A;  4ZJ0 A;  1NP1 A;  3FA9 A;  3APW A;  3CQN A;  3CMA P;  3MVF A;  3NX2 A;  3FYF A;  3CR6 A;  4N7C A;  2YMS A;  1X89 A;  3FEK A;  1LIC A;  4XMF A;  4ORX A;  3EBK A;  3ZI8 A;  4A60 A;  5HZ8 A;  1BRP A;  3VG4 A;  1FDQ A;  2M8N A;  1HBP A;  1IKJ A;  4TKH A;  1CBS A;  1GKA A;  1EII A;  1IFC A;  1D3S A;  2JOZ A;  1DZP A;  4A1Y A;  2BHV A;  4O4U A;  3EBW A;  5HBS A;  4NLI A;  4ZH6 A;  5F2N A;  5F2K A;  1TOW A;  1KQW A;  3CCE P;  3WJD A;  2KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...