2Q2MA

Beta-lactoglobulin (native)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title An asymmetric dimer of beta-lactoglobulin in a low humidity crystal form-Structural changes that accompany partial dehydration and protein action.
pubmed doi rcsb
molecule tags Transport protein
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2q2mA00
1X8QA 1AELA 3BDRA 2FS6A 1RBPA 1KGLA 3O2YA 4KIIA 2YG2A 3IFBA 4ORYA 5AQ6A 3KFIA 1HMSA 4CK4A 3APUA 2MO5A 2XKLA 2G78A 1TOUA 1X8PA 2P8GA 3NADA 4MVKA 2A0AA 4ZH6A 1IFCA 2FWVA 1ML7A 2CBRA 1GKAB 5LJEA 5HWZA 1XKIA 3U0DA 2OFRX 1OEKA 5F1EA 5EPQA 2OVEA 2NNEA 1S7DA 2AT6X 4YDAA 3BX8A 1CBSA 4D6AA 2NNDA 1PM1X 2Q9SA 1GX8A 4ALBA 1EIOA 2MJIA 1X71A 1S2PA 4DQ3A 4Y0QA 3CQNA 1TW4A 2WWPA 3B2KA 1QFVA 1DV9A 5HTDA 5EDCA 1X8UA 4HPCA 5HZ6A 1L6MA 4YGHA 1JYDA 3CMPA 3Q6LA 2WEXA 4GNWA 3AKNA 3DSZA 3B2LA 1NP4A 5F7GA 1A2DA 2EU7X 4IMNA 4YFQA 1CJ5A 3CR6A 3EYCA 4LKTA 2GC9A 2RQ0A 1G74A 1YIVA 2LBAA 5EEEA 5H8TA 1I4UA 3STKA 3C77X 3HK1A 3FA6A 3GAQA 2AH7X 3U9PC 1SY1A 4IB8A 1EPAA 4YKOA 2FTBA 2RA6A 1X8OA 1EALA 1D2UA 4OMXA 5D4AA 1AB0A 1OBPA 2FRSA 3CWKA 3BX7A 1ZNGA 2O62A 3U03A 2ANSA 4BQUA 1DZJA 5EEDA 2MM3A 1ALBA 5HTEA 5EDBA 1AVGI 4BOEA 4WFUA 1I04A 1FDQA 3NQ9A 3VG4A 5CE4A 4AZPA 1DF3A 1DC9A 2GTFX 3WJFA 1FE3A 4HPDA 3P6EA 2HLVA 3BY0A 4MVLA 4IB6A 1YWAA 1S44A 1QABE 3T1DA 5LJCA 1FEMA 1Z24A 4RUNA 1GT3A 3G7XA 3P6CA 2A3FX 1BM5A 2L9CA 2FLJA 2HZRA 3P6GA 1I06A 4ORWA 2HNXA 3WJEA 4A60A 1B4MA 1MX7A 4Y0PA 4ZGUA 4N7DA 4YBUA 5FAZA 1GGLA 1ICMA 2A2GA 4ZH9A 1PMPA 3TGCA 1EXSA 3PEDA 2N93A 1U0XA 4LKPA 4NYQA 5IO6A 3PECA 1B56A 4IB7A 5K06A 5L8IA 1KZWA 3BS2A 5HCCC 4XMGA 4ORXA 1MDCA 1GXAA 1O1UA 2PY1A 5H9NA 3D96A 1SY2A 3BLGA 4ODDA 1LKEA 1LICA 4WBKA 2GJ5A 2W2BA 1T8VA 2OFMX 4OMWA 1JZUA 1HN2A 4YCEA 3WJDA 1ZNKA 3SAOA 3FLLA 3UEVA 4AYHA 5HZ8A 2ACPX 3D97A 5JR8A 1JYJA 2Q4NA 1QY2A 4AZMA 4ZHCA 5LKEA 4ORSA 1HBPA 3FEPA 1BJ7A 1SXWA 2L5PA 2WQ9A 3FA8A 4A8ZA 5H9KA 4Y0RA 5F58A 5DPQA 3FR4A 2AKQA 1HMRA 3PP6A 1A18A 4YCHA 4ORRA 1HMTA 4HPAA 4R0BA 4ZHFA 4YMYA 1ZNEA 1ICNA 5B29A 4YH0A 5HA0A 3KQ0A 4IAXA 1BSYA 3FIQA 2FR3A 1IW2A 1LNMA 3F9DA 1EPBA 4QGWA 5KIDA 4QAEA 2A2UA 1BRPA 4WFVA 1EQDA 4XMFA 1G5WA 5LJHA 1DZKA 1BSQA 1SA8A 3B2IA 1KT3A 4NNTA 4TKJA 2POAA 3PH5A 5D45A 3DTQA 2WR6A 2OZQA 1JJXA 3F8AA 1FENA 1BSOA 4AZRA 1T68X 4K19A 2E4JA 2WEWA 3EM0A 1GX9A 1LF7A 1E02A 1OEJA 2Q39A 3FW4A 4NLJA 5D48A 2KTDA 1VYGA 1NP1A 1EW3A 4QYNA 3TGBA 2AT8X 1FELA 4EXZA 3TF6A 1BBPA 5B27A 4ORUA 2R56A 3JSQA 1LIFA 1O8VA 2LKKA 2KT4B 4A1HA 4I9RA 4ZHDA 5IO7A 2NP1A 1T0VA 3K3LA 3D95A 4AZNA 1SXYA 2CZUA 4UU3A 4OS8A 4ES7A 3NP1A 4M7MA 1DFVA 3KZAA 2ACOA 2JOZA 3BRNA 2L68A 2L67A 2RD7C 4LZVA 3FELA 1QG5A 1VPRA 2AT0X 5KHPA 4OS0A 1ERXA 3ZUOA 4AZQA 1YUPA 2OVAA 2LB6A 3RSWA 3P6FA 5L8OA 4ZHHA 4Y0SA 4ZHGA 1KT6A 5F6ZA 2LBVA 1E06A 1DZPA 4HFOA 1HQPA 4YBPA 4IB9A 4TKHA 3NR3A 1ZRYA 1PEEA 3TZSA 5HA1A 4BVMA 4XMDA 1KOIA 3B2HA 3CBSA 1P6PA 1UREA 5BVTA 2HYSA 2RCQA 1I05A 2JU8A 3WBGA 2G7BA 2ALLX 4PSQA 3O19A 2LFOA 3WJGA 1ERBA 2W2AA 3KFHA 3S26A 4ZCBA 1IIUA 3HWGA 3NPOA 4UU2A 4XMEA 2WUTA 3RZYA 4QGXA 1ACDA 1LIDA 1QWDA 3FR5A 3WVMA 1OPBA 1BEBA 2AL0X 3KFGA 4I3CA 3ZQ3A 3NX2A 4QZUA 2R73A 1TOWA 1KQWA 1YP7A 3APWA 1A3YA 1YWBA 3FA9A 3BU9A 1QY0A 2AMMX 4YGZA 2FR2A 4ZR2A 4ARHA 4YDBA 4YKMA 1YWCA 5D8JA 4QYPA 3TGAA 1KZXA 1GM6A 2G79A 1G85A 1OBUA 5BVSA 3NQ3A 1U18A 3HWFA 5HZQA 3AKMA 3VG2A 5FENA 4GRJA 4EDEA 1BRQA 1LIBA 4NNSA 3C78X 1A57A 4TKBA 2FS7A 1X89A 5L8NA 3VG5A 2QM9A 3IA8A 2IFBA 4IBAA 5EZ2A 3HWDA 1GT5A 4YFPA 3FMZA 2QOSC 4I3BA 3WJCA 3PH6A 3FEKA 2X46A 3JS1A 1NGLA 4GE1A 4ZFXA 1EIIA 4GNYA 1SXXA 3KFFA 4HPBA 1FTPA 3L4RA 1ZNHA 2Q2MA 3VG6A 1JJJA 4QZTA 5H9LA 1KXOA 3QKGA 5HBSA 4GKCA 1U17A 2CZTA 1BWYA 2AT3X 5KICA 3UEUA 2WQAE 1YP6A 1XCAA 1BLRA 4NP1A 2XSTA 4M6SA 5HZ9A 4ALOA 1IKEA 1EUOA 1DZMA 4NLIA 3CBCA 2JU7A 4YGGA 4DQ4A 4ZJ0A 3STNA 3P6HA 1CRBA 3PPTA 2CBSA 4AW8A 3EMMA 5H9AA 3BU1A 1GKAA 3P6DA 2OVDA 2R74A 1GT4A 1TVQA 1CBQA 4D6BA 4OS3A 4EFGA 1OBQA 3O22A 2RCTA 1OEEA 2F73A 1B0OA 4A1YA 5LKFA 4IAWA 1ZNLA 3CQRA 4I3DA 3EBWA 2JN3A 1N0SA 1OPAA 4TLJA 4QGVA 4N7CA 1CBRA 4EEJA 1KT7A 4YFRA 4GH7A 3NX1A 1IKJA 2K23A 1JBHA 5HCEC 1GT1A 2DM5A 3FW5A 1QFTA 5HCDC 3WJBA 2QO5A 3HWEA 4O9SA 5LJGA 5D47A 4AZOA 1QY1A 5C0NA 3APXA 3UEXA 2A13A 1X8NA 3MVFA 2HMBA 3VG7A 1HBQA 1SY0A 3B2JA 5LJBA 1D3SA 3ZUIA 1KT4A 1VYFA 3MBTA 1SY3A 5HAEA 4IMOA 3VG3A 2BLGA 1G7NA 2QO6A 2QO4A 2AT5X 2HZQA 4TJZA 1ZNDA 5IO5A 2ASNX 4LZUA 2W2FA 1PBOA 1KQXA 4MVIA 4TQ2A 1LFOA 4I9SA 5FFHA 2NNQA 1IFBA 2CM4A 1MUPA 2CM9A 3C76X 3FR2A 1B8EA 3STMX 2K62A 1ADLA 5LJDA 1LIEA 4GETA 3WXQA 1RLBE 5HZ5A 1QQSA 1SXUA 1UZ2X 4XMHA 1KT5A 1R0UA 2Q2PA 3BSZE 1TXLA 4NYRA 5DG4A 3FA7A 1YWDA 5LJKA 3ELZA 5BVQA 2JU3A 3ELXA 3I17A 1AQBA 1CBIA 2X45A 1O1VA 3OJYC 3FENA 1LPJA 4TNNA 1E5PA 1MX8A 3I0AA 2WSJA 1JV4A 1E00A 3EBKA 4XMCA 3APVA 1MVGA 3UEWA 5F6BA 4RUUA 1H91A 2FT9A
chains in the Genus database with same CATH superfamily
2OL8O 1X8QA 1AELA 3BDRA 2FS6A 1RBPA 1KGLA 2X8FA 3O2YA 4KIIA 2YG2A 3IFBA 4ORYA 1FJ1E 5AQ6A 3KFIA 4O49A 1HMSA 5IXGA 4CK4A 3APUA 2JGSA 2MO5A 2XKLA 3Q34A 1Y53X 2G78A 1TOUA 1X8PA 2P8GA 2RTOB 3NADA 4MVKA 2A0AA 4ZH6A 1IFCA 2FWVA 1ML7A 1VWEB 2CBRA 1GKAB 2WPUA 5LJEA 1STPA 4KT5A 5HWZA 1XKIA 4Z27A 3U0DA 4PJ2A 2OFRX 3E3CA 2RTRB 1OEKA 4FBVA 5F1EA 1NDJA 2A5BA 1Y0GA 5EPQA 3VGWA 4C5PA 2OVEA 2NNEA 3RY2A 1S7DA 2AT6X 4YDAA 3BX8A 1CBSA 2F09A 3RDUA 4D6AA 2NNDA 1SRIA 1PM1X 3LTWA 4U8UM 2Q9SA 1GX8A 4KC8A 4BX6B 4ALBA 1EIOA 2MJIA 2RTBB 1X71A 1MM9A 1S2PA 4DQ3A 2BSZA 4Y0QA 3CQNA 4CV7A 1TW4A 2WWPA 3B2KA 1KL3A 1N9YA 1QFVA 1DV9A 5HTDA 1LUQA 2CAMA 1G5WA 5EDCA 1X8UA 4COTA 4EQAC 4HPCA 3NQKA 4U46A 1L6MA 5HZ6A 4YGHA 1JYDA 3CMPA 4GGZA 3Q6LA 1SWRA 2WEXA 1MK5A 2ZAGA 3AKNA 3DSZA 4GNWA 3B2LA 4ID2A 1NP4A 1NQNA 5F7GA 1A2DA 2EU7X 4IMNA 3HPEA 4YFQA 1CJ5A 3CR6A 3EYCA 4LKTA 4Z2VA 2GC9A 4FBRA 2RQ0A 3HOEA 4Y5DA 1G74A 2A5CA 4O4OA 1YIVA 2LBAA 2OL7A 5EEEA 1I4UA 5H8TA 3STKA 3VHHA 3C77X 3HK1A 2FGSA 2X55A 3FA6A 3GAQA 3OE3A 2AH7X 3U9PC 1SY1A 4IB8A 3LHNA 1EPAA 4YKOA 2FTBA 3RDOA 3ZZVA 4CDDA 4KH8A 2RA6A 1X8OA 1EALA 3X00A 5FQ8E 1D2UA 4OMXA 5D4AA 3D9WA 1AB0A 2JMBA 1OBPA 2FRSA 3P02A 3ZW2A 3CWKA 2Y3EA 3BX7A 1SRJA 1ZNGA 2OVSA 2ZSCA 4Z2OA 1VYOA 4GD9A 2F01A 2O62A 5IRUA 3U03A 2ANSA 4BQUA 1DZJA 1K3BA 2VFBA 2BT9A 1SLDB 4NW4A 5EEDA 2MM3A 5AEOA 1ALBA 5HTEA 5EDBA 1AVGI 3FDCA 1UYOX 4WFUA 4BOEA 1I04A 1FDQA 3NQ9A 3VG4A 5CE4A 2BHVA 4AZPA 1DF3A 1NQMA 1DC9A 1SWTA 2GTFX 4Z28A 3WJFA 1IJ8A 5B3MO 2GTLN 1FE3A 4HPDA 4BX7A 3WYPA 1Y9TA 3EW1A 2Z4HA 3AEHA 3P6EA 2HLVA 3BY0A 4MVLA 3WZPA 4IB6A 1STSB 1YWAA 1S44A 3SLTA 1QABE 2C1QA 3T1DA 5LJCA 1K24A 1FEMA 4K19A 2BS6A 1Z24A 4I60A 4RUNA 1SWPA 1GT3A 3G7XA 2LA7A 1SWQA 3P6CA 2A3FX 1BM5A 1SRGA 2A8GA 2L9CA 2FLJA 2HZRA 3P6GA 1I06A 2OY8A 2HNXA 4ORWA 3WJEA 1RSTB 1MX7A 4Y0PA 2AF5A 4Z2PA 4ZGUA 4N7DA 1B4MA 4YBUA 5FAZA 1GGLA 1ICMA 1UYNX 3RBYA 1VWPB 2A2GA 4ML7B 5IRWA 2RTLA 4ZH9A 1PMPA 4CPIA 3TGCA 3ZI8A 1E2TA 1EXSA 3PEDA 1SWSA 1U0XA 2N93A 4LKPA 4NYQA 5IO6A 4I95A 1NBXA 1KL5A 3PECA 2IZHB 1B56A 1SMPI 4O3ZA 4DNEA 1SWDA 4IB7A 5K06A 5L3YA 5L8IA 2FKJA 1KZWA 3BS2A 5HCCC 4XMGA 4ORXA 3S5VA 1MDCA 1GXAA 1O1UA 1RXKA 1SWCA 2PY1A 5H9NA 3D96A 1SY2A 1KL4A 3BLGA 1LCZA 1VWNB 4ODDA 3SOTA 1LKEA 1LICA 1AVDA 4WBKA 2GJ5A 2W2BA 1T8VA 2OFMX 4OMWA 2IZEB 2IZCB 4O3XB 1JZUA 4QNIA 1AVEA 1HN2A 2RTGB 2QMIA 2RTQB 4YCEA 3WJDA 5B11O 2X8SA 1ZNKA 4U8UO 3SAOA 3FLLA 2PI3O 1SRFA 3T6LA 3UEVA 4AYHA 5HZ8A 2ACPX 2C4IA 3D97A 4GDAA 5JR8A 1JYJA 2Q4NA 3NBXX 1QY2A 4AZMA 4ZHCA 3HOLA 5LKEA 4ORSA 2QOMA 4OKAA 2IZKA 1HBPA 5CYBA 1SWHA 3FEPA 1BJ7A 1N7YA 1SXWA 2L5PA 2WQ9A 3FA8A 5K68A 4OEMA 5H9KA 4A8ZA 1VWGB 4BJ8A 4Y0RA 5F58A 3WZNA 5DPQA 3FR4A 4HWMA 1JIWI 4GJVA 2AKQA 1HMRA 1W4TA 2IZDB 5AJCA 1SWUA 1A18A 3PP6A 1LELA 4ORRA 4YCHA 1LCVA 1SWAA 1HMTA 4HPAA 4R0BA 4ZHFA 4YMYA 3N91A 1ZNEA 1ICNA 5B29A 4YH0A 5HA0A 3KQ0A 4IAXA 3P24A 1BSYA 2RTAA 2FR3A 1IW2A 1LNMA 3F9DA 1EPBA 3FIQA 4QGWA 5KIDA 4QAEA 3RE5A 4I6SA 1VWQB 2A2UA 1JJUA 3CKGA 1BRPA 4WFVA 1EQDA 2UZ2A 2RTMA 4XMFA 5CSEA 2MWHA 3ZW0A 1RSUB 4BX5A 3MX7A 1DZKA 1PTSA 1BSQA 5LJHA 1SA8A 3B2IA 1KT3A 1NC9A 4NNTA 4TKJA 2POAA 3PH5A 1VWMB 5D45A 2BC3A 3DTQA 2WR6A 4MEEA 4FQBB 4LQZA 1SREA 4U8UN 5BYPA 2OZQA 1N43A 1JJXA 3F8AA 1FENA 1BSOA 4AZRA 3ZW1B 1JMXA 1T68X 3EW2A 2E4JA 2WEWA 3EM0A 1GX9A 1LF7A 1E02A 1HQQA 1OEJA 2Q39A 3FW4A 4GUZA 4GGTA 2KTDA 4NLJA 5D48A 5FQ7E 2X34A 1VYGA 1NP1A 1EW3A 3OD9A 4QYNA 3TGBA 2AT8X 1FELA 2UYWA 4L1NA 3TF6A 4EXZA 1BBPA 3FYFA 5B27A 4ORUA 1HXLA 2R56A 3JSQA 1LIFA 1O8VA 3AUMO 3T2XA 2OYBO 2LKKA 2KT4B 4A1HA 4I9RA 1VWAB 4ZHDA 5IO7A 2NP1A 1PBYA 1T0VA 3PK2A 3K3LA 2I5VO 3D95A 4CDFA 4AZNA 4BGFA 1SXYA 3ZW1A 2VDFA 2CZUA 4UU3A 4ON1A 4OS8A 3NP1A 4M7MA 1DFVA 3KZAA 2ACOA 5FQ6E 4BX7B 1SWKA 1VWBB 2JOZA 2YMSA 3BRNA 2L68A 2L67A 2RD7C 4LZVA 3FELA 1QG5A 1VPRA 2AT0X 3JQOA 5KHPA 4OS0A 2BS5A 2DJGA 1ERXA 3ZUOA 4AZQA 1YUPA 2OVAA 3MG5A 1SWJA 2LB6A 1Y52X 3RSWA 3P6FA 5L8OA 4ZHHA 4Y0SA 4ZHGA 2X32A 1KT6A 4JNJA 3MM0A 5F6ZA 2LBVA 2RTIB 4O3YA 1E06A 1DZPA 1VWHB 3KVNA 3SZIA 4HFOA 1HQPA 2IZBA 4CDEA 2RTKA 4IB9A 4YBPA 4TKHA 3NR3A 1ZRYA 1PEEA 3TZSA 2DJFA 2KTSA 2OL6O 1VWCB 3OBLA 5HA1A 1JQPA 1SWEA 4BVMA 1MEPA 3SZJA 1W5RA 1KOIA 4XMDA 1VWFB 3B2HA 3CBSA 1P6PA 2GTLM 1UREA 5BVTA 2HYSA 3PQUA 1I05A 2RCQA 2JU8A 3WBGA 2G7BA 1SWOA 2ALLX 4PSQA 3T6FA 3O19A 4MVEA 2LFOA 3RDQA 1ERBA 2W2AA 3KFHA 2G5LA 1W6FA 3WJGA 1I9HA 3S26A 4GJSA 1IIUA 3HWGA 3NPOA 4GZVA 4UU2A 2WUTA 4XMEA 4ZCBA 4QGXA 1ACDA 3RZYA 1LIDA 1SRHA 1QWDA 4CPHB 5B10O 3FR5A 3VU1A 3WVMA 4BBOA 1OPBA 1BEBA 2AL0X 2FKGA 3KFGA 4I3CA 4JO6A 3NX2A 3ZQ3A 3ZWEA 1SLFB 1VWDB 2RTJA 4QZUA 2R73A 2OY7A 5F2BA 1TOWA 3S5XA 1KQWA 1YP7A 2IZGB 3APWA 1A3YA 1YWBA 3FA9A 3BU9A 4IABA 1QY0A 2HKDA 2AMMX 2RTDB 4O4UA 4YGZA 2FR2A 2ZAIA 4ZR2A 4FGIB 4MISA 4ARHA 4O4SA 4YDBA 4CPHA 4ZGFA 4YKMA 1YWCA 5D8JA 4QYPA 3TGAA 1KZXA 1GM6A 2G79A 4CSBA 1G85A 1OBUA 4U3QA 5BVSA 3NQ3A 1U18A 3HWFA 5B2AO 2AVIA 3AKMA 5HZQA 4GRJA 3VG2A 4EDEA 5FENA 1BRQA 1LIBA 1LCWA 2KD2A 1RXHA 3C78X 3QQ2A 4NNSA 3VE2A 3ZW0B 4TKBA 2FS7A 4BX5B 1X89A 1A57A 5L8NA 2I5ZO 5IRAA 3VG5A 2IZLB 2QM9A 3IA8A 4YVBA 2IFBA 4IBAA 5EZ2A 3HWDA 3EC5A 1N4JA 3H3IA 1GT5A 4Y59A 4YFPA 3FMZA 2QOSC 4I3BA 3WJCA 3PH6A 3FEKA 2X46A 3JS1A 1SWLA 3PDFA 1NGLA 4GK9A 4GE1A 5JD2A 4ZFXA 4GDZA 1EIIA 4GNYA 1SXXA 3RKGA 3KFFA 4HPBA 1FTPA 2OF8A 2OFAA 3L4RA 1ZNHA 2Q2MA 3VG6A 1JJJA 4QZTA 5H9LA 1KXOA 3QKGA 5HBSA 4GKCA 1U17A 2CZTA 3VPJE 1BWYA 1LDQA 4IRWA 2AT3X 5KICA 3UEUA 2WQAE 1YP6A 1HY2A 1RXJA 1VWJB 1XCAA 1BLRA 4NP1A 2XSTA 4M6SA 5HZ9A 1LDOA 4ALOA 1IKEA 1EUOA 1DZMA 2FHNX 4NLIA 4WHIA 3CBCA 1VWLB 2JU7A 4YGGA 4B55A 2MF6A 3STNA 2OY1O 4DQ4A 4ZJ0A 3P6HA 3PQSA 1CRBA 3PPTA 2CBSA 2IZAA 2X4MA 4AW8A 3EMMA 5H9AA 2Y3FA 3BU1A 1GKAA 3P6DA 3SLOA 2OVDA 2R74A 1GT4A 1SWNA 1SWBA 1TVQA 3VHMA 3FIDA 1WUBA 1CBQA 4D6BA 4O3WA 4OS3A 4EFGA 1OBQA 3O22A 2RCTA 1OEEA 3RDSA 2F73A 1VWOB 1B0OA 4A1YA 4NV8A 5LKFA 4OELA 1N9MA 4IAWA 1ZNLA 1I78A 3CQRA 4I3DA 3GE2A 3EBWA 2GH7A 4MIRA 2JN3A 5AJBA 3HTYA 1N0SA 1OPAA 3LV4A 4TLJA 1OSPO 4QGVA 4N7CA 1CBRA 3S60A 4FBOA 4EEJA 3D4RA 1KT7A 4YFRA 2FHLA 4GH7A 2OY5O 3NX1A 3VE1A 1IKJA 1STRB 4BX6A 4QQ1A 4KC7A 2K23A 1JBHA 2GTLO 5HCEC 1GT1A 2DM5A 3FW5A 1QFTA 2X56A 4JGLA 5K67A 5HCDC 3UAQA 3WJBA 2QO5A 3HWEA 4O9SA 5LJGA 2IZFB 5D47A 3SLJA 4KCAA 3RE6A 4AZOA 1QY1A 3RDMA 3APXA 3UEXA 2A13A 1X8NA 4NV7A 5C0NA 3T2WA 1MOYA 3MVFA 4JHQA 1VWKB 3WZQA 1EI5A 2KW1A 2X8TA 2HMBA 3VG7A 1Y9LA 1HBQA 2OF9A 2IZIA 1SY0A 4CDCA 3B2JA 5B5FA 5LJBA 2RTCB 1D3SA 3CKFA 3ZUIA 1KT4A 1VYFA 1SWGA 3MBTA 1WBIA 1SY3A 4A60A 1SLEB 2QCBA 2JW1A 1HXZA 5HAEA 4IMOA 3VG3A 3WYQA 2BLGA 1G7NA 2QO6A 2QO4A 2RTFB 2AT5X 2HZQA 4TJZA 1Y55X 1ZNDA 5IO5A 2ASNX 4LZUA 2W2FA 2VFCA 1PBOA 1KQXA 4MVIA 4TQ2A 4DCBA 1LFOA 4I9SA 4GU8A 5FFHA 2NNQA 1IFBA 2C1SA 2CM4A 1MUPA 5CHKA 2CM9A 1VWIB 2Y32A 3C76X 3FR2A 1B8EA 3F6ZB 3STMX 1RAVA 2K62A 2RTNB 1ADLA 5LJDA 1GX3A 1LIEA 3SZHA 4GGRA 2M4LA 3RDXA 4GETA 3WXQA 3WZOA 1RLBE 4BCSA 5HZ5A 1QQSA 1SXUA 2RTHB 3VHIA 1UZ2X 2G8CO 3RWXA 4XMHA 4INNA 1KT5A 2RTPB 1R0UA 1DF8A 4CPEA 2Q2PA 4CPFA 3BSZE 1TXLA 4NYRA 3V8UA 5DG4A 2MHDA 4L3RA 3FA7A 1YWDA 5LJKA 3ELZA 5BVQA 2JU3A 3ELXA 3I17A 4QRLA 5B5GA 1AQBA 1CBIA 2X45A 4ES7A 1O1VA 3OJYC 3FENA 1LPJA 4TNNA 1E5PA 1MX8A 2OFBA 3RY1A 3I0AA 1KFFA 1JV4A 1VWRB 2IZJA 2WSJA 1E00A 3EBKA 4XMCA 3APVA 1MVGA 4Z6JA 3UEWA 5F6BA 4RUUA 2Z4IA 1H91A 4U9CA 3WOVA 1JMZA 1SLGB 2FT9A 2RN4A 1SWFA 2RTEB 4EKVA 4O4XA
chains in the Genus database with same CATH topology
1X8QA 1AELA 3BDRA 2FS6A 1RBPA 1KGLA 2X8FA 3O2YA 4KIIA 2YG2A 3IFBA 4ORYA 5AQ6A 3KFIA 4O49A 1HMSA 4CK4A 3APUA 2MO5A 2XKLA 2G78A 1TOUA 1X8PA 2P8GA 3NADA 4MVKA 2A0AA 4ZH6A 1IFCA 2FWVA 1ML7A 2CBRA 1GKAB 5LJEA 4KT5A 5HWZA 1XKIA 3U0DA 4PJ2A 2OFRX 3E3CA 1OEKA 4FBVA 5F1EA 5EPQA 2OVEA 2NNEA 1S7DA 2AT6X 4YDAA 3BX8A 1CBSA 2F09A 4D6AA 2NNDA 1PM1X 4U8UM 2Q9SA 1GX8A 4KC8A 4ALBA 1EIOA 2MJIA 1X71A 1S2PA 4DQ3A 4Y0QA 3CQNA 4CV7A 1TW4A 2WWPA 3B2KA 1QFVA 1DV9A 5HTDA 5EDCA 1X8UA 4COTA 4EQAC 4HPCA 3NQKA 5HZ6A 1L6MA 4YGHA 1JYDA 3CMPA 3Q6LA 2WEXA 2ZAGA 3AKNA 3DSZA 4GNWA 3B2LA 4ID2A 1NP4A 5F7GA 1A2DA 2EU7X 4IMNA 4YFQA 1CJ5A 3CR6A 3EYCA 4LKTA 2GC9A 4FBRA 2RQ0A 3HOEA 1G74A 4O4OA 1YIVA 2LBAA 5EEEA 5H8TA 1I4UA 3STKA 3C77X 3HK1A 3FA6A 3GAQA 3OE3A 2AH7X 3U9PC 1SY1A 4IB8A 3LHNA 1EPAA 4YKOA 2FTBA 3ZZVA 4KH8A 2RA6A 1X8OA 1EALA 5FQ8E 1D2UA 4OMXA 5D4AA 3ZW2A 1AB0A 2JMBA 1OBPA 2FRSA 3P02A 3CWKA 3BX7A 1ZNGA 2OVSA 2O62A 3U03A 2ANSA 4BQUA 1DZJA 2BT9A 4NW4A 5EEDA 2MM3A 5AEOA 1ALBA 5HTEA 5EDBA 1AVGI 4BOEA 4WFUA 1I04A 1FDQA 3NQ9A 3VG4A 5CE4A 2BHVA 4AZPA 1DF3A 1DC9A 2GTFX 3WJFA 2GTLN 1FE3A 4HPDA 1Y9TA 2Z4HA 3P6EA 2HLVA 3BY0A 4MVLA 4IB6A 1YWAA 1S44A 1QABE 3T1DA 5LJCA 1FEMA 2BS6A 1Z24A 4RUNA 1GT3A 3G7XA 2LA7A 3P6CA 2A3FX 1BM5A 2L9CA 2FLJA 2HZRA 3P6GA 1I06A 4ORWA 2HNXA 3WJEA 4A60A 1B4MA 1MX7A 4Y0PA 4ZGUA 4N7DA 4YBUA 5FAZA 1GGLA 1ICMA 3RBYA 2A2GA 4ML7B 4ZH9A 1PMPA 3TGCA 3ZI8A 1EXSA 3PEDA 2N93A 1U0XA 4LKPA 4NYQA 5IO6A 4I95A 3PECA 1B56A 1SMPI 4O3ZA 4IB7A 5K06A 5L8IA 1KZWA 3BS2A 5HCCC 4XMGA 4ORXA 3S5VA 1MDCA 1GXAA 1O1UA 2PY1A 5H9NA 3D96A 1SY2A 3BLGA 4ODDA 3SOTA 1LKEA 1LICA 4WBKA 2GJ5A 2W2BA 1T8VA 2OFMX 4OMWA 4O3XB 1JZUA 4QNIA 1HN2A 4YCEA 2QMIA 3WJDA 2X8SA 1ZNKA 4U8UO 3SAOA 3FLLA 3UEVA 4AYHA 5HZ8A 2ACPX 3D97A 5JR8A 1JYJA 2Q4NA 3NBXX 1QY2A 4AZMA 4ZHCA 3HOLA 5LKEA 4ORSA 1HBPA 5CYBA 3FEPA 1BJ7A 1SXWA 2L5PA 2WQ9A 3FA8A 4A8ZA 5H9KA 4Y0RA 5F58A 5DPQA 3FR4A 4HWMA 1JIWI 2AKQA 1HMRA 5AJCA 3PP6A 1A18A 4YCHA 4ORRA 1HMTA 4HPAA 4R0BA 4ZHFA 4YMYA 3N91A 1ZNEA 1ICNA 5B29A 4YH0A 5HA0A 3KQ0A 4IAXA 3P24A 1BSYA 3FIQA 2FR3A 1IW2A 1LNMA 3F9DA 1EPBA 4QGWA 5KIDA 4QAEA 4I6SA 2A2UA 1BRPA 4WFVA 1EQDA 4XMFA 3ZW0A 1G5WA 2MWHA 5LJHA 3MX7A 1DZKA 1BSQA 1SA8A 3B2IA 1KT3A 4NNTA 4TKJA 2POAA 3PH5A 5D45A 3DTQA 2WR6A 4FQBB 4LQZA 4U8UN 5BYPA 2OZQA 1JJXA 3F8AA 1FENA 1BSOA 4AZRA 3ZW1B 1T68X 4K19A 2E4JA 2WEWA 3EM0A 1GX9A 1LF7A 1E02A 1OEJA 2Q39A 3FW4A 4NLJA 5D48A 2KTDA 5FQ7E 1VYGA 1NP1A 1EW3A 3OD9A 4QYNA 3TGBA 2AT8X 1FELA 4L1NA 3TF6A 4EXZA 1BBPA 3FYFA 5B27A 4ORUA 2R56A 3JSQA 1LIFA 1O8VA 2LKKA 2KT4B 4A1HA 4I9RA 4ZHDA 5IO7A 2NP1A 1T0VA 3K3LA 3D95A 4AZNA 1SXYA 3ZW1A 2CZUA 4UU3A 4ON1A 4OS8A 3NP1A 4M7MA 1DFVA 3KZAA 2ACOA 5FQ6E 4ES7A 2JOZA 2YMSA 3BRNA 2L68A 2L67A 2RD7C 4LZVA 3FELA 1QG5A 1VPRA 2AT0X 3JQOA 5KHPA 4OS0A 2BS5A 1ERXA 3ZUOA 4AZQA 1YUPA 2OVAA 2LB6A 3RSWA 3P6FA 5L8OA 4ZHHA 4Y0SA 4ZHGA 1KT6A 5F6ZA 2LBVA 4O3YA 1E06A 1DZPA 4HFOA 1HQPA 4YBPA 4IB9A 4TKHA 3NR3A 1ZRYA 1PEEA 3TZSA 2KTSA 3OBLA 5HA1A 4BVMA 4XMDA 1KOIA 3B2HA 3CBSA 1P6PA 2GTLM 1UREA 5BVTA 2HYSA 3PQUA 1I05A 2RCQA 2JU8A 3WBGA 2G7BA 2ALLX 4PSQA 3O19A 4MVEA 2LFOA 3WJGA 1ERBA 2W2AA 3KFHA 3S26A 4ZCBA 1IIUA 3HWGA 3NPOA 4GZVA 4UU2A 2WUTA 4XMEA 3RZYA 4QGXA 1ACDA 1LIDA 1QWDA 3VU1A 3FR5A 3WVMA 1OPBA 1BEBA 2AL0X 3KFGA 3ZWEA 4I3CA 3ZQ3A 3NX2A 4QZUA 2R73A 1TOWA 3S5XA 1KQWA 1YP7A 3APWA 1A3YA 1YWBA 3FA9A 3BU9A 4IABA 1QY0A 4O4UA 2AMMX 4YGZA 2FR2A 2ZAIA 4ZR2A 4FGIB 4MISA 4ARHA 4O4SA 4YDBA 4ZGFA 4YKMA 1YWCA 5D8JA 4QYPA 3TGAA 1KZXA 1GM6A 2G79A 1G85A 1OBUA 4U3QA 5BVSA 3NQ3A 1U18A 3HWFA 5HZQA 3AKMA 3VG2A 5FENA 4GRJA 4EDEA 1BRQA 1LIBA 2KD2A 4NNSA 3C78X 3VE2A 3ZW0B 4TKBA 1A57A 2FS7A 1X89A 5L8NA 3VG5A 2QM9A 3IA8A 2IFBA 4IBAA 5EZ2A 3HWDA 3H3IA 1GT5A 4YFPA 3FMZA 2QOSC 4I3BA 3WJCA 3PH6A 3FEKA 2X46A 3JS1A 4GK9A 1NGLA 4GE1A 4ZFXA 4GDZA 1EIIA 4GNYA 1SXXA 3RKGA 3KFFA 4HPBA 1FTPA 3L4RA 1ZNHA 2Q2MA 3VG6A 1JJJA 4QZTA 5H9LA 1KXOA 3QKGA 5HBSA 4GKCA 1U17A 2CZTA 3VPJE 1BWYA 2AT3X 5KICA 3UEUA 2WQAE 1YP6A 1XCAA 1BLRA 4NP1A 2XSTA 4M6SA 5HZ9A 4ALOA 1IKEA 1EUOA 1DZMA 4NLIA 4WHIA 4CSBA 3CBCA 2JU7A 4YGGA 4DQ4A 4ZJ0A 3STNA 3P6HA 3PQSA 1CRBA 3PPTA 2CBSA 4AW8A 3EMMA 5H9AA 3BU1A 1GKAA 3P6DA 2OVDA 2R74A 1GT4A 1TVQA 1CBQA 4D6BA 4O3WA 4OS3A 4EFGA 1OBQA 3O22A 2RCTA 1OEEA 2F73A 1B0OA 4A1YA 5LKFA 4IAWA 1ZNLA 3CQRA 4I3DA 3GE2A 3EBWA 4MIRA 2JN3A 5AJBA 3HTYA 1N0SA 1OPAA 3LV4A 4TLJA 4QGVA 4N7CA 1CBRA 3S60A 4FBOA 4EEJA 3D4RA 1KT7A 4YFRA 4GH7A 3NX1A 3VE1A 1IKJA 4QQ1A 4KC7A 2K23A 1JBHA 2GTLO 5HCEC 1GT1A 2DM5A 3FW5A 1QFTA 4JGLA 5HCDC 3UAQA 3WJBA 2QO5A 3HWEA 4O9SA 5LJGA 5D47A 4KCAA 4AZOA 1QY1A 5C0NA 3APXA 3UEXA 2A13A 1X8NA 3MVFA 1EI5A 2KW1A 2X8TA 2HMBA 3VG7A 1Y9LA 1HBQA 1SY0A 3B2JA 5LJBA 1D3SA 3ZUIA 1KT4A 1VYFA 3MBTA 1SY3A 5HAEA 2JW1A 4IMOA 3VG3A 2BLGA 1G7NA 2QO6A 2QO4A 2AT5X 2HZQA 4TJZA 1ZNDA 5IO5A 2ASNX 4LZUA 2W2FA 1PBOA 1KQXA 4MVIA 4TQ2A 1LFOA 4I9SA 4GU8A 5FFHA 2NNQA 1IFBA 2CM4A 1MUPA 2CM9A 3C76X 3FR2A 1B8EA 3F6ZB 3STMX 2K62A 1ADLA 5LJDA 1LIEA 2M4LA 4GETA 3WXQA 1RLBE 5HZ5A 1QQSA 1SXUA 1UZ2X 3RWXA 4XMHA 4INNA 1KT5A 1R0UA 2Q2PA 3BSZE 1TXLA 4NYRA 3V8UA 5DG4A 2MHDA 4L3RA 3FA7A 1YWDA 5LJKA 3ELZA 5BVQA 2JU3A 3ELXA 3I17A 4QRLA 1AQBA 1CBIA 2X45A 1O1VA 3OJYC 3FENA 1LPJA 4TNNA 1E5PA 1MX8A 3I0AA 2WSJA 1JV4A 1E00A 3EBKA 4XMCA 3APVA 1MVGA 3UEWA 5F6BA 4RUUA 2Z4IA 1H91A 4U9CA 3WOVA 2FT9A 2RN4A 4O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Q A;  1AEL A;  3BDR A;  2FS6 A;  1RBP A;  1KGL A;  3O2Y A;  4KII A;  2YG2 A;  3IFB A;  4ORY A;  5AQ6 A;  3KFI A;  1HMS A;  4CK4 A;  3APU A;  2MO5 A;  2XKL A;  2G78 A;  1TOU A;  1X8P A;  2P8G A;  3NAD A;  4MVK A;  2A0A A;  4ZH6 A;  1IFC A;  2FWV A;  1ML7 A;  2CBR A;  1GKA B;  5LJE A;  5HWZ A;  1XKI A;  3U0D A;  2OFR X;  1OEK A;  5F1E A;  5EPQ A;  2OVE A;  2NNE A;  1S7D A;  2AT6 X;  4YDA A;  3BX8 A;  1CBS A;  4D6A A;  2NND A;  1PM1 X;  2Q9S A;  1GX8 A;  4ALB A;  1EIO A;  2MJI A;  1X71 A;  1S2P A;  4DQ3 A;  4Y0Q A;  3CQN A;  1TW4 A;  2WWP A;  3B2K A;  1QFV A;  1DV9 A;  5HTD A;  5EDC A;  1X8U A;  4HPC A;  5HZ6 A;  1L6M A;  4YGH A;  1JYD A;  3CMP A;  3Q6L A;  2WEX A;  4GNW A;  3AKN A;  3DSZ A;  3B2L A;  1NP4 A;  5F7G A;  1A2D A;  2EU7 X;  4IMN A;  4YFQ A;  1CJ5 A;  3CR6 A;  3EYC A;  4LKT A;  2GC9 A;  2RQ0 A;  1G74 A;  1YIV A;  2LBA A;  5EEE A;  5H8T A;  1I4U A;  3STK A;  3C77 X;  3HK1 A;  3FA6 A;  3GAQ A;  2AH7 X;  3U9P C;  1SY1 A;  4IB8 A;  1EPA A;  4YKO A;  2FTB A;  2RA6 A;  1X8O A;  1EAL A;  1D2U A;  4OMX A;  5D4A A;  1AB0 A;  1OBP A;  2FRS A;  3CWK A;  3BX7 A;  1ZNG A;  2O62 A;  3U03 A;  2ANS A;  4BQU A;  1DZJ A;  5EED A;  2MM3 A;  1ALB A;  5HTE A;  5EDB A;  1AVG I;  4BOE A;  4WFU A;  1I04 A;  1FDQ A;  3NQ9 A;  3VG4 A;  5CE4 A;  4AZP A;  1DF3 A;  1DC9 A;  2GTF X;  3WJF A;  1FE3 A;  4HPD A;  3P6E A;  2HLV A;  3BY0 A;  4MVL A;  4IB6 A;  1YWA A;  1S44 A;  1QAB E;  3T1D A;  5LJC A;  1FEM A;  1Z24 A;  4RUN A;  1GT3 A;  3G7X A;  3P6C A;  2A3F X;  1BM5 A;  2L9C A;  2FLJ A;  2HZR A;  3P6G A;  1I06 A;  4ORW A;  2HNX A;  3WJE A;  4A60 A;  1B4M A;  1MX7 A;  4Y0P A;  4ZGU A;  4N7D A;  4YBU A;  5FAZ A;  1GGL A;  1ICM A;  2A2G A;  4ZH9 A;  1PMP A;  3TGC A;  1EXS A;  3PED A;  2N93 A;  1U0X A;  4LKP A;  4NYQ A;  5IO6 A;  3PEC A;  1B56 A;  4IB7 A;  5K06 A;  5L8I A;  1KZW A;  3BS2 A;  5HCC C;  4XMG A;  4ORX A;  1MDC A;  1GXA A;  1O1U A;  2PY1 A;  5H9N A;  3D96 A;  1SY2 A;  3BLG A;  4ODD A;  1LKE A;  1LIC A;  4WBK A;  2GJ5 A;  2W2B A;  1T8V A;  2OFM X;  4OMW A;  1JZU A;  1HN2 A;  4YCE A;  3WJD A;  1ZNK A;  3SAO A;  3FLL A;  3UEV A;  4AYH A;  5HZ8 A;  2ACP X;  3D97 A;  5JR8 A;  1JYJ A;  2Q4N A;  1QY2 A;  4AZM A;  4ZHC A;  5LKE A;  4ORS A;  1HBP A;  3FEP A;  1BJ7 A;  1SXW A;  2L5P A;  2WQ9 A;  3FA8 A;  4A8Z A;  5H9K A;  4Y0R A;  5F58 A;  5DPQ A;  3FR4 A;  2AKQ A;  1HMR A;  3PP6 A;  1A18 A;  4YCH A;  4ORR A;  1HMT A;  4HPA A;  4R0B A;  4ZHF A;  4YMY A;  1ZNE A;  1ICN A;  5B29 A;  4YH0 A;  5HA0 A;  3KQ0 A;  4IAX A;  1BSY A;  3FIQ A;  2FR3 A;  1IW2 A;  1LNM A;  3F9D A;  1EPB A;  4QGW A;  5KID A;  4QAE A;  2A2U A;  1BRP A;  4WFV A;  1EQD A;  4XMF A;  1G5W A;  5LJH A;  1DZK A;  1BSQ A;  1SA8 A;  3B2I A;  1KT3 A;  4NNT A;  4TKJ A;  2POA A;  3PH5 A;  5D45 A;  3DTQ A;  2WR6 A;  2OZQ A;  1JJX A;  3F8A A;  1FEN A;  1BSO A;  4AZR A;  1T68 X;  4K19 A;  2E4J A;  2WEW A;  3EM0 A;  1GX9 A;  1LF7 A;  1E02 A;  1OEJ A;  2Q39 A;  3FW4 A;  4NLJ A;  5D48 A;  2KTD A;  1VYG A;  1NP1 A;  1EW3 A;  4QYN A;  3TGB A;  2AT8 X;  1FEL A;  4EXZ A;  3TF6 A;  1BBP A;  5B27 A;  4ORU A;  2R56 A;  3JSQ A;  1LIF A;  1O8V A;  2LKK A;  2KT4 B;  4A1H A;  4I9R A;  4ZHD A;  5IO7 A;  2NP1 A;  1T0V A;  3K3L A;  3D95 A;  4AZN A;  1SXY A;  2CZU A;  4UU3 A;  4OS8 A;  4ES7 A;  3NP1 A;  4M7M A;  1DFV A;  3KZA A;  2ACO A;  2JOZ A;  3BRN A;  2L68 A;  2L67 A;  2RD7 C;  4LZV A;  3FEL A;  1QG5 A;  1VPR A;  2AT0 X;  5KHP A;  4OS0 A;  1ERX A;  3ZUO A;  4AZQ A;  1YUP A;  2OVA A;  2LB6 A;  3RSW A;  3P6F A;  5L8O A;  4ZHH A;  4Y0S A;  4ZHG A;  1KT6 A;  5F6Z A;  2LBV A;  1E06 A;  1DZP A;  4HFO A;  1HQP A;  4YBP A;  4IB9 A;  4TKH A;  3NR3 A;  1ZRY A;  1PEE A;  3TZS A;  5HA1 A;  4BVM A;  4XMD A;  1KOI A;  3B2H A;  3CBS A;  1P6P A;  1URE A;  5BVT A;  2HYS A;  2RCQ A;  1I05 A;  2JU8 A;  3WBG A;  2G7B A;  2ALL X;  4PSQ A;  3O19 A;  2LFO A;  3WJG A;  1ERB A;  2W2A A;  3KFH A;  3S26 A;  4ZCB A;  1IIU A;  3HWG A;  3NPO A;  4UU2 A;  4XME A;  2WUT A;  3RZY A;  4QGX A;  1ACD A;  1LID A;  1QWD A;  3FR5 A;  3WVM A;  1OPB A;  1BEB A;  2AL0 X;  3KFG A;  4I3C A;  3ZQ3 A;  3NX2 A;  4QZU A;  2R73 A;  1TOW A;  1KQW A;  1YP7 A;  3APW A;  1A3Y A;  1YWB A;  3FA9 A;  3BU9 A;  1QY0 A;  2AMM X;  4YGZ A;  2FR2 A;  4ZR2 A;  4ARH A;  4YDB A;  4YKM A;  1YWC A;  5D8J A;  4QYP A;  3TGA A;  1KZX A;  1GM6 A;  2G79 A;  1G85 A;  1OBU A;  5BVS A;  3NQ3 A;  1U18 A;  3HWF A;  5HZQ A;  3AKM A;  3VG2 A;  5FEN A;  4GRJ A;  4EDE A;  1BRQ A;  1LIB A;  4NNS A;  3C78 X;  1A57 A;  4TKB A;  2FS7 A;  1X89 A;  5L8N A;  3VG5 A;  2QM9 A;  3IA8 A;  2IFB A;  4IBA A;  5EZ2 A;  3HWD A;  1GT5 A;  4YFP A;  3FMZ A;  2QOS C;  4I3B A;  3WJC A;  3PH6 A;  3FEK A;  2X46 A;  3JS1 A;  1NGL A;  4GE1 A;  4ZFX A;  1EII A;  4GNY A;  1SXX A;  3KFF A;  4HPB A;  1FTP A;  3L4R A;  1ZNH A;  2Q2M A;  3VG6 A;  1JJJ A;  4QZT A;  5H9L A;  1KXO A;  3QKG A;  5HBS A;  4GKC A;  1U17 A;  2CZT A;  1BWY A;  2AT3 X;  5KIC A;  3UEU A;  2WQA E;  1YP6 A;  1XCA A;  1BLR A;  4NP1 A;  2XST A;  4M6S A;  5HZ9 A;  4ALO A;  1IKE A;  1EUO A;  1DZM A;  4NLI A;  3CBC A;  2JU7 A;  4YGG A;  4DQ4 A;  4ZJ0 A;  3STN A;  3P6H A;  1CRB A;  3PPT A;  2CBS A;  4AW8 A;  3EMM A;  5H9A A;  3BU1 A;  1GKA A;  3P6D A;  2OVD A;  2R74 A;  1GT4 A;  1TVQ A;  1CBQ A;  4D6B A;  4OS3 A;  4EFG A;  1OBQ A;  3O22 A;  2RCT A;  1OEE A;  2F73 A;  1B0O A;  4A1Y A;  5LKF A;  4IAW A;  1ZNL A;  3CQR A;  4I3D A;  3EBW A;  2JN3 A;  1N0S A;  1OPA A;  4TLJ A;  4QGV A;  4N7C A;  1CBR A;  4EEJ A;  1KT7 A;  4YFR A;  4GH7 A;  3NX1 A;  1IKJ A;  2K23 A;  1JBH A;  5HCE C;  1GT1 A;  2DM5 A;  3FW5 A;  1QFT A;  5HCD C;  3WJB A;  2QO5 A;  3HWE A;  4O9S A;  5LJG A;  5D47 A;  4AZO A;  1QY1 A;  5C0N A;  3APX A;  3UEX A;  2A13 A;  1X8N A;  3MVF A;  2HMB A;  3VG7 A;  1HBQ A;  1SY0 A;  3B2J A;  5LJB A;  1D3S A;  3ZUI A;  1KT4 A;  1VYF A;  3MBT A;  1SY3 A;  5HAE A;  4IMO A;  3VG3 A;  2BLG A;  1G7N A;  2QO6 A;  2QO4 A;  2AT5 X;  2HZQ A;  4TJZ A;  1ZND A;  5IO5 A;  2ASN X;  4LZU A;  2W2F A;  1PBO A;  1KQX A;  4MVI A;  4TQ2 A;  1LFO A;  4I9S A;  5FFH A;  2NNQ A;  1IFB A;  2CM4 A;  1MUP A;  2CM9 A;  3C76 X;  3FR2 A;  1B8E A;  3STM X;  2K62 A;  1ADL A;  5LJD A;  1LIE A;  4GET A;  3WXQ A;  1RLB E;  5HZ5 A;  1QQS A;  1SXU A;  1UZ2 X;  4XMH A;  1KT5 A;  1R0U A;  2Q2P A;  3BSZ E;  1TXL A;  4NYR A;  5DG4 A;  3FA7 A;  1YWD A;  5LJK A;  3ELZ A;  5BVQ A;  2JU3 A;  3ELX A;  3I17 A;  1AQB A;  1CBI A;  2X45 A;  1O1V A;  3OJY C;  3FEN A;  1LPJ A;  4TNN A;  1E5P A;  1MX8 A;  3I0A A;  2WSJ A;  1JV4 A;  1E00 A;  3EBK A;  4XMC A;  3APV A;  1MVG A;  3UEW A;  5F6B A;  4RUU A;  1H91 A;  2FT9 A; 
#chains in the Genus database with same CATH topology
 2OL8 O;  1X8Q A;  1AEL A;  3BDR A;  2FS6 A;  1RBP A;  1KGL A;  2X8F A;  3O2Y A;  4KII A;  2YG2 A;  3IFB A;  4ORY A;  1FJ1 E;  5AQ6 A;  3KFI A;  4O49 A;  1HMS A;  5IXG A;  4CK4 A;  3APU A;  2JGS A;  2MO5 A;  2XKL A;  3Q34 A;  1Y53 X;  2G78 A;  1TOU A;  1X8P A;  2P8G A;  2RTO B;  3NAD A;  4MVK A;  2A0A A;  4ZH6 A;  1IFC A;  2FWV A;  1ML7 A;  1VWE B;  2CBR A;  1GKA B;  2WPU A;  5LJE A;  1STP A;  4KT5 A;  5HWZ A;  1XKI A;  4Z27 A;  3U0D A;  4PJ2 A;  2OFR X;  3E3C A;  2RTR B;  1OEK A;  4FBV A;  5F1E A;  1NDJ A;  2A5B A;  1Y0G A;  5EPQ A;  3VGW A;  4C5P A;  2OVE A;  2NNE A;  3RY2 A;  1S7D A;  2AT6 X;  4YDA A;  3BX8 A;  1CBS A;  2F09 A;  3RDU A;  4D6A A;  2NND A;  1SRI A;  1PM1 X;  3LTW A;  4U8U M;  2Q9S A;  1GX8 A;  4KC8 A;  4BX6 B;  4ALB A;  1EIO A;  2MJI A;  2RTB B;  1X71 A;  1MM9 A;  1S2P A;  4DQ3 A;  2BSZ A;  4Y0Q A;  3CQN A;  4CV7 A;  1TW4 A;  2WWP A;  3B2K A;  1KL3 A;  1N9Y A;  1QFV A;  1DV9 A;  5HTD A;  1LUQ A;  2CAM A;  1G5W A;  5EDC A;  1X8U A;  4COT A;  4EQA C;  4HPC A;  3NQK A;  4U46 A;  1L6M A;  5HZ6 A;  4YGH A;  1JYD A;  3CMP A;  4GGZ A;  3Q6L A;  1SWR A;  2WEX A;  1MK5 A;  2ZAG A;  3AKN A;  3DSZ A;  4GNW A;  3B2L A;  4ID2 A;  1NP4 A;  1NQN A;  5F7G A;  1A2D A;  2EU7 X;  4IMN A;  3HPE A;  4YFQ A;  1CJ5 A;  3CR6 A;  3EYC A;  4LKT A;  4Z2V A;  2GC9 A;  4FBR A;  2RQ0 A;  3HOE A;  4Y5D A;  1G74 A;  2A5C A;  4O4O A;  1YIV A;  2LBA A;  2OL7 A;  5EEE A;  1I4U A;  5H8T A;  3STK A;  3VHH A;  3C77 X;  3HK1 A;  2FGS A;  2X55 A;  3FA6 A;  3GAQ A;  3OE3 A;  2AH7 X;  3U9P C;  1SY1 A;  4IB8 A;  3LHN A;  1EPA A;  4YKO A;  2FTB A;  3RDO A;  3ZZV A;  4CDD A;  4KH8 A;  2RA6 A;  1X8O A;  1EAL A;  3X00 A;  5FQ8 E;  1D2U A;  4OMX A;  5D4A A;  3D9W A;  1AB0 A;  2JMB A;  1OBP A;  2FRS A;  3P02 A;  3ZW2 A;  3CWK A;  2Y3E A;  3BX7 A;  1SRJ A;  1ZNG A;  2OVS A;  2ZSC A;  4Z2O A;  1VYO A;  4GD9 A;  2F01 A;  2O62 A;  5IRU A;  3U03 A;  2ANS A;  4BQU A;  1DZJ A;  1K3B A;  2VFB A;  2BT9 A;  1SLD B;  4NW4 A;  5EED A;  2MM3 A;  5AEO A;  1ALB A;  5HTE A;  5EDB A;  1AVG I;  3FDC A;  1UYO X;  4WFU A;  4BOE A;  1I04 A;  1FDQ A;  3NQ9 A;  3VG4 A;  5CE4 A;  2BHV A;  4AZP A;  1DF3 A;  1NQM A;  1DC9 A;  1SWT A;  2GTF X;  4Z28 A;  3WJF A;  1IJ8 A;  5B3M O;  2GTL N;  1FE3 A;  4HPD A;  4BX7 A;  3WYP A;  1Y9T A;  3EW1 A;  2Z4H A;  3AEH A;  3P6E A;  2HLV A;  3BY0 A;  4MVL A;  3WZP A;  4IB6 A;  1STS B;  1YWA A;  1S44 A;  3SLT A;  1QAB E;  2C1Q A;  3T1D A;  5LJC A;  1K24 A;  1FEM A;  4K19 A;  2BS6 A;  1Z24 A;  4I60 A;  4RUN A;  1SWP A;  1GT3 A;  3G7X A;  2LA7 A;  1SWQ A;  3P6C A;  2A3F X;  1BM5 A;  1SRG A;  2A8G A;  2L9C A;  2FLJ A;  2HZR A;  3P6G A;  1I06 A;  2OY8 A;  2HNX A;  4ORW A;  3WJE A;  1RST B;  1MX7 A;  4Y0P A;  2AF5 A;  4Z2P A;  4ZGU A;  4N7D A;  1B4M A;  4YBU A;  5FAZ A;  1GGL A;  1ICM A;  1UYN X;  3RBY A;  1VWP B;  2A2G A;  4ML7 B;  5IRW A;  2RTL A;  4ZH9 A;  1PMP A;  4CPI A;  3TGC A;  3ZI8 A;  1E2T A;  1EXS A;  3PED A;  1SWS A;  1U0X A;  2N93 A;  4LKP A;  4NYQ A;  5IO6 A;  4I95 A;  1NBX A;  1KL5 A;  3PEC A;  2IZH B;  1B56 A;  1SMP I;  4O3Z A;  4DNE A;  1SWD A;  4IB7 A;  5K06 A;  5L3Y A;  5L8I A;  2FKJ A;  1KZW A;  3BS2 A;  5HCC C;  4XMG A;  4ORX A;  3S5V A;  1MDC A;  1GXA A;  1O1U A;  1RXK A;  1SWC A;  2PY1 A;  5H9N A;  3D96 A;  1SY2 A;  1KL4 A;  3BLG A;  1LCZ A;  1VWN B;  4ODD A;  3SOT A;  1LKE A;  1LIC A;  1AVD A;  4WBK A;  2GJ5 A;  2W2B A;  1T8V A;  2OFM X;  4OMW A;  2IZE B;  2IZC B;  4O3X B;  1JZU A;  4QNI A;  1AVE A;  1HN2 A;  2RTG B;  2QMI A;  2RTQ B;  4YCE A;  3WJD A;  5B11 O;  2X8S A;  1ZNK A;  4U8U O;  3SAO A;  3FLL A;  2PI3 O;  1SRF A;  3T6L A;  3UEV A;  4AYH A;  5HZ8 A;  2ACP X;  2C4I A;  3D97 A;  4GDA A;  5JR8 A;  1JYJ A;  2Q4N A;  3NBX X;  1QY2 A;  4AZM A;  4ZHC A;  3HOL A;  5LKE A;  4ORS A;  2QOM A;  4OKA A;  2IZK A;  1HBP A;  5CYB A;  1SWH A;  3FEP A;  1BJ7 A;  1N7Y A;  1SXW A;  2L5P A;  2WQ9 A;  3FA8 A;  5K68 A;  4OEM A;  5H9K A;  4A8Z A;  1VWG B;  4BJ8 A;  4Y0R A;  5F58 A;  3WZN A;  5DPQ A;  3FR4 A;  4HWM A;  1JIW I;  4GJV A;  2AKQ A;  1HMR A;  1W4T A;  2IZD B;  5AJC A;  1SWU A;  1A18 A;  3PP6 A;  1LEL A;  4ORR A;  4YCH A;  1LCV A;  1SWA A;  1HMT A;  4HPA A;  4R0B A;  4ZHF A;  4YMY A;  3N91 A;  1ZNE A;  1ICN A;  5B29 A;  4YH0 A;  5HA0 A;  3KQ0 A;  4IAX A;  3P24 A;  1BSY A;  2RTA A;  2FR3 A;  1IW2 A;  1LNM A;  3F9D A;  1EPB A;  3FIQ A;  4QGW A;  5KID A;  4QAE A;  3RE5 A;  4I6S A;  1VWQ B;  2A2U A;  1JJU A;  3CKG A;  1BRP A;  4WFV A;  1EQD A;  2UZ2 A;  2RTM A;  4XMF A;  5CSE A;  2MWH A;  3ZW0 A;  1RSU B;  4BX5 A;  3MX7 A;  1DZK A;  1PTS A;  1BSQ A;  5LJH A;  1SA8 A;  3B2I A;  1KT3 A;  1NC9 A;  4NNT A;  4TKJ A;  2POA A;  3PH5 A;  1VWM B;  5D45 A;  2BC3 A;  3DTQ A;  2WR6 A;  4MEE A;  4FQB B;  4LQZ A;  1SRE A;  4U8U N;  5BYP A;  2OZQ A;  1N43 A;  1JJX A;  3F8A A;  1FEN A;  1BSO A;  4AZR A;  3ZW1 B;  1JMX A;  1T68 X;  3EW2 A;  2E4J A;  2WEW A;  3EM0 A;  1GX9 A;  1LF7 A;  1E02 A;  1HQQ A;  1OEJ A;  2Q39 A;  3FW4 A;  4GUZ A;  4GGT A;  2KTD A;  4NLJ A;  5D48 A;  5FQ7 E;  2X34 A;  1VYG A;  1NP1 A;  1EW3 A;  3OD9 A;  4QYN A;  3TGB A;  2AT8 X;  1FEL A;  2UYW A;  4L1N A;  3TF6 A;  4EXZ A;  1BBP A;  3FYF A;  5B27 A;  4ORU A;  1HXL A;  2R56 A;  3JSQ A;  1LIF A;  1O8V A;  3AUM O;  3T2X A;  2OYB O;  2LKK A;  2KT4 B;  4A1H A;  4I9R A;  1VWA B;  4ZHD A;  5IO7 A;  2NP1 A;  1PBY A;  1T0V A;  3PK2 A;  3K3L A;  2I5V O;  3D95 A;  4CDF A;  4AZN A;  4BGF A;  1SXY A;  3ZW1 A;  2VDF A;  2CZU A;  4UU3 A;  4ON1 A;  4OS8 A;  3NP1 A;  4M7M A;  1DFV A;  3KZA A;  2ACO A;  5FQ6 E;  4BX7 B;  1SWK A;  1VWB B;  2JOZ A;  2YMS A;  3BRN A;  2L68 A;  2L67 A;  2RD7 C;  4LZV A;  3FEL A;  1QG5 A;  1VPR A;  2AT0 X;  3JQO A;  5KHP A;  4OS0 A;  2BS5 A;  2DJG A;  1ERX A;  3ZUO A;  4AZQ A;  1YUP A;  2OVA A;  3MG5 A;  1SWJ A;  2LB6 A;  1Y52 X;  3RSW A;  3P6F A;  5L8O A;  4ZHH A;  4Y0S A;  4ZHG A;  2X32 A;  1KT6 A;  4JNJ A;  3MM0 A;  5F6Z A;  2LBV A;  2RTI B;  4O3Y A;  1E06 A;  1DZP A;  1VWH B;  3KVN A;  3SZI A;  4HFO A;  1HQP A;  2IZB A;  4CDE A;  2RTK A;  4IB9 A;  4YBP A;  4TKH A;  3NR3 A;  1ZRY A;  1PEE A;  3TZS A;  2DJF A;  2KTS A;  2OL6 O;  1VWC B;  3OBL A;  5HA1 A;  1JQP A;  1SWE A;  4BVM A;  1MEP A;  3SZJ A;  1W5R A;  1KOI A;  4XMD A;  1VWF B;  3B2H A;  3CBS A;  1P6P A;  2GTL M;  1URE A;  5BVT A;  2HYS A;  3PQU A;  1I05 A;  2RCQ A;  2JU8 A;  3WBG A;  2G7B A;  1SWO A;  2ALL X;  4PSQ A;  3T6F A;  3O19 A;  4MVE A;  2LFO A;  3RDQ A;  1ERB A;  2W2A A;  3KFH A;  2G5L A;  1W6F A;  3WJG A;  1I9H A;  3S26 A;  4GJS A;  1IIU A;  3HWG A;  3NPO A;  4GZV A;  4UU2 A;  2WUT A;  4XME A;  4ZCB A;  4QGX A;  1ACD A;  3RZY A;  1LID A;  1SRH A;  1QWD A;  4CPH B;  5B10 O;  3FR5 A;  3VU1 A;  3WVM A;  4BBO A;  1OPB A;  1BEB A;  2AL0 X;  2FKG A;  3KFG A;  4I3C A;  4JO6 A;  3NX2 A;  3ZQ3 A;  3ZWE A;  1SLF B;  1VWD B;  2RTJ A;  4QZU A;  2R73 A;  2OY7 A;  5F2B A;  1TOW A;  3S5X A;  1KQW A;  1YP7 A;  2IZG B;  3APW A;  1A3Y A;  1YWB A;  3FA9 A;  3BU9 A;  4IAB A;  1QY0 A;  2HKD A;  2AMM X;  2RTD B;  4O4U A;  4YGZ A;  2FR2 A;  2ZAI A;  4ZR2 A;  4FGI B;  4MIS A;  4ARH A;  4O4S A;  4YDB A;  4CPH A;  4ZGF A;  4YKM A;  1YWC A;  5D8J A;  4QYP A;  3TGA A;  1KZX A;  1GM6 A;  2G79 A;  4CSB A;  1G85 A;  1OBU A;  4U3Q A;  5BVS A;  3NQ3 A;  1U18 A;  3HWF A;  5B2A O;  2AVI A;  3AKM A;  5HZQ A;  4GRJ A;  3VG2 A;  4EDE A;  5FEN A;  1BRQ A;  1LIB A;  1LCW A;  2KD2 A;  1RXH A;  3C78 X;  3QQ2 A;  4NNS A;  3VE2 A;  3ZW0 B;  4TKB A;  2FS7 A;  4BX5 B;  1X89 A;  1A57 A;  5L8N A;  2I5Z O;  5IRA A;  3VG5 A;  2IZL B;  2QM9 A;  3IA8 A;  4YVB A;  2IFB A;  4IBA A;  5EZ2 A;  3HWD A;  3EC5 A;  1N4J A;  3H3I A;  1GT5 A;  4Y59 A;  4YFP A;  3FMZ A;  2QOS C;  4I3B A;  3WJC A;  3PH6 A;  3FEK A;  2X46 A;  3JS1 A;  1SWL A;  3PDF A;  1NGL A;  4GK9 A;  4GE1 A;  5JD2 A;  4ZFX A;  4GDZ A;  1EII A;  4GNY A;  1SXX A;  3RKG A;  3KFF A;  4HPB A;  1FTP A;  2OF8 A;  2OFA A;  3L4R A;  1ZNH A;  2Q2M A;  3VG6 A;  1JJJ A;  4QZT A;  5H9L A;  1KXO A;  3QKG A;  5HBS A;  4GKC A;  1U17 A;  2CZT A;  3VPJ E;  1BWY A;  1LDQ A;  4IRW A;  2AT3 X;  5KIC A;  3UEU A;  2WQA E;  1YP6 A;  1HY2 A;  1RXJ A;  1VWJ B;  1XCA A;  1BLR A;  4NP1 A;  2XST A;  4M6S A;  5HZ9 A;  1LDO A;  4ALO A;  1IKE A;  1EUO A;  1DZM A;  2FHN X;  4NLI A;  4WHI A;  3CBC A;  1VWL B;  2JU7 A;  4YGG A;  4B55 A;  2MF6 A;  3STN A;  2OY1 O;  4DQ4 A;  4ZJ0 A;  3P6H A;  3PQS A;  1CRB A;  3PPT A;  2CBS A;  2IZA A;  2X4M A;  4AW8 A;  3EMM A;  5H9A A;  2Y3F A;  3BU1 A;  1GKA A;  3P6D A;  3SLO A;  2OVD A;  2R74 A;  1GT4 A;  1SWN A;  1SWB A;  1TVQ A;  3VHM A;  3FID A;  1WUB A;  1CBQ A;  4D6B A;  4O3W A;  4OS3 A;  4EFG A;  1OBQ A;  3O22 A;  2RCT A;  1OEE A;  3RDS A;  2F73 A;  1VWO B;  1B0O A;  4A1Y A;  4NV8 A;  5LKF A;  4OEL A;  1N9M A;  4IAW A;  1ZNL A;  1I78 A;  3CQR A;  4I3D A;  3GE2 A;  3EBW A;  2GH7 A;  4MIR A;  2JN3 A;  5AJB A;  3HTY A;  1N0S A;  1OPA A;  3LV4 A;  4TLJ A;  1OSP O;  4QGV A;  4N7C A;  1CBR A;  3S60 A;  4FBO A;  4EEJ A;  3D4R A;  1KT7 A;  4YFR A;  2FHL A;  4GH7 A;  2OY5 O;  3NX1 A;  3VE1 A;  1IKJ A;  1STR B;  4BX6 A;  4QQ1 A;  4KC7 A;  2K23 A;  1JBH A;  2GTL O;  5HCE C;  1GT1 A;  2DM5 A;  3FW5 A;  1QFT A;  2X56 A;  4JGL A;  5K67 A;  5HCD C;  3UAQ A;  3WJB A;  2QO5 A;  3HWE A;  4O9S A;  5LJG A;  2IZF B;  5D47 A;  3SLJ A;  4KCA A;  3RE6 A;  4AZO A;  1QY1 A;  3RDM A;  3APX A;  3UEX A;  2A13 A;  1X8N A;  4NV7 A;  5C0N A;  3T2W A;  1MOY A;  3MVF A;  4JHQ A;  1VWK B;  3WZQ A;  1EI5 A;  2KW1 A;  2X8T A;  2HMB A;  3VG7 A;  1Y9L A;  1HBQ A;  2OF9 A;  2IZI A;  1SY0 A;  4CDC A;  3B2J A;  5B5F A;  5LJB A;  2RTC B;  1D3S A;  3CKF A;  3ZUI A;  1KT4 A;  1VYF A;  1SWG A;  3MBT A;  1WBI A;  1SY3 A;  4A60 A;  1SLE B;  2QCB A;  2JW1 A;  1HXZ A;  5HAE A;  4IMO A;  3VG3 A;  3WYQ A;  2BLG A;  1G7N A;  2QO6 A;  2QO4 A;  2RTF B;  2AT5 X;  2HZQ A;  4TJZ A;  1Y55 X;  1ZND A;  5IO5 A;  2ASN X;  4LZU A;  2W2F A;  2VFC A;  1PBO A;  1KQX A;  4MVI A;  4TQ2 A;  4DCB A;  1LFO A;  4I9S A;  4GU8 A;  5FFH A;  2NNQ A;  1IFB A;  2C1S A;  2CM4 A;  1MUP A;  5CHK A;  2CM9 A;  1VWI B;  2Y32 A;  3C76 X;  3FR2 A;  1B8E A;  3F6Z B;  3STM X;  1RAV A;  2K62 A;  2RTN B;  1ADL A;  5LJD A;  1GX3 A;  1LIE A;  3SZH A;  4GGR A;  2M4L A;  3RDX A;  4GET A;  3WXQ A;  3WZO A;  1RLB E;  4BCS A;  5HZ5 A;  1QQS A;  1SXU A;  2RTH B;  3VHI A;  1UZ2 X;  2G8C O;  3RWX A;  4XMH A;  4INN A;  1KT5 A;  2RTP B;  1R0U A;  1DF8 A;  4CPE A;  2Q2P A;  4CPF A;  3BSZ E;  1TXL A;  4NYR A;  3V8U A;  5DG4 A;  2MHD A;  4L3R A;  3FA7 A;  1YWD A;  5LJK A;  3ELZ A;  5BVQ A;  2JU3 A;  3ELX A;  3I17 A;  4QRL A;  5B5G A;  1AQB A;  1CBI A;  2X45 A;  4ES7 A;  1O1V A;  3OJY C;  3FEN A;  1LPJ A;  4TNN A;  1E5P A;  1MX8 A;  2OFB A;  3RY1 A;  3I0A A;  1KFF A;  1JV4 A;  1VWR B;  2IZJ A;  2WSJ A;  1E00 A;  3EBK A;  4XMC A;  3APV A;  1MVG A;  4Z6J A;  3UEW A;  5F6B A;  4RUU A;  2Z4I A;  1H91 A;  4U9C A;  3WOV A;  1JMZ A;  1SLG B;  2FT9 A;  2RN4 A;  1SWF A;  2RTE B;  4EKV A;  4O4X A; 
#chains in the Genus database with same CATH homology
 1X8Q A;  1AEL A;  3BDR A;  2FS6 A;  1RBP A;  1KGL A;  2X8F A;  3O2Y A;  4KII A;  2YG2 A;  3IFB A;  4ORY A;  5AQ6 A;  3KFI A;  4O49 A;  1HMS A;  4CK4 A;  3APU A;  2MO5 A;  2XKL A;  2G78 A;  1TOU A;  1X8P A;  2P8G A;  3NAD A;  4MVK A;  2A0A A;  4ZH6 A;  1IFC A;  2FWV A;  1ML7 A;  2CBR A;  1GKA B;  5LJE A;  4KT5 A;  5HWZ A;  1XKI A;  3U0D A;  4PJ2 A;  2OFR X;  3E3C A;  1OEK A;  4FBV A;  5F1E A;  5EPQ A;  2OVE A;  2NNE A;  1S7D A;  2AT6 X;  4YDA A;  3BX8 A;  1CBS A;  2F09 A;  4D6A A;  2NND A;  1PM1 X;  4U8U M;  2Q9S A;  1GX8 A;  4KC8 A;  4ALB A;  1EIO A;  2MJI A;  1X71 A;  1S2P A;  4DQ3 A;  4Y0Q A;  3CQN A;  4CV7 A;  1TW4 A;  2WWP A;  3B2K A;  1QFV A;  1DV9 A;  5HTD A;  5EDC A;  1X8U A;  4COT A;  4EQA C;  4HPC A;  3NQK A;  5HZ6 A;  1L6M A;  4YGH A;  1JYD A;  3CMP A;  3Q6L A;  2WEX A;  2ZAG A;  3AKN A;  3DSZ A;  4GNW A;  3B2L A;  4ID2 A;  1NP4 A;  5F7G A;  1A2D A;  2EU7 X;  4IMN A;  4YFQ A;  1CJ5 A;  3CR6 A;  3EYC A;  4LKT A;  2GC9 A;  4FBR A;  2RQ0 A;  3HOE A;  1G74 A;  4O4O A;  1YIV A;  2LBA A;  5EEE A;  5H8T A;  1I4U A;  3STK A;  3C77 X;  3HK1 A;  3FA6 A;  3GAQ A;  3OE3 A;  2AH7 X;  3U9P C;  1SY1 A;  4IB8 A;  3LHN A;  1EPA A;  4YKO A;  2FTB A;  3ZZV A;  4KH8 A;  2RA6 A;  1X8O A;  1EAL A;  5FQ8 E;  1D2U A;  4OMX A;  5D4A A;  3ZW2 A;  1AB0 A;  2JMB A;  1OBP A;  2FRS A;  3P02 A;  3CWK A;  3BX7 A;  1ZNG A;  2OVS A;  2O62 A;  3U03 A;  2ANS A;  4BQU A;  1DZJ A;  2BT9 A;  4NW4 A;  5EED A;  2MM3 A;  5AEO A;  1ALB A;  5HTE A;  5EDB A;  1AVG I;  4BOE A;  4WFU A;  1I04 A;  1FDQ A;  3NQ9 A;  3VG4 A;  5CE4 A;  2BHV A;  4AZP A;  1DF3 A;  1DC9 A;  2GTF X;  3WJF A;  2GTL N;  1FE3 A;  4HPD A;  1Y9T A;  2Z4H A;  3P6E A;  2HLV A;  3BY0 A;  4MVL A;  4IB6 A;  1YWA A;  1S44 A;  1QAB E;  3T1D A;  5LJC A;  1FEM A;  2BS6 A;  1Z24 A;  4RUN A;  1GT3 A;  3G7X A;  2LA7 A;  3P6C A;  2A3F X;  1BM5 A;  2L9C A;  2FLJ A;  2HZR A;  3P6G A;  1I06 A;  4ORW A;  2HNX A;  3WJE A;  4A60 A;  1B4M A;  1MX7 A;  4Y0P A;  4ZGU A;  4N7D A;  4YBU A;  5FAZ A;  1GGL A;  1ICM A;  3RBY A;  2A2G A;  4ML7 B;  4ZH9 A;  1PMP A;  3TGC A;  3ZI8 A;  1EXS A;  3PED A;  2N93 A;  1U0X A;  4LKP A;  4NYQ A;  5IO6 A;  4I95 A;  3PEC A;  1B56 A;  1SMP I;  4O3Z A;  4IB7 A;  5K06 A;  5L8I A;  1KZW A;  3BS2 A;  5HCC C;  4XMG A;  4ORX A;  3S5V A;  1MDC A;  1GXA A;  1O1U A;  2PY1 A;  5H9N A;  3D96 A;  1SY2 A;  3BLG A;  4ODD A;  3SOT A;  1LKE A;  1LIC A;  4WBK A;  2GJ5 A;  2W2B A;  1T8V A;  2OFM X;  4OMW A;  4O3X B;  1JZU A;  4QNI A;  1HN2 A;  4YCE A;  2QMI A;  3WJD A;  2X8S A;  1ZNK A;  4U8U O;  3SAO A;  3FLL A;  3UEV A;  4AYH A;  5HZ8 A;  2ACP X;  3D97 A;  5JR8 A;  1JYJ A;  2Q4N A;  3NBX X;  1QY2 A;  4AZM A;  4ZHC A;  3HOL A;  5LKE A;  4ORS A;  1HBP A;  5CYB A;  3FEP A;  1BJ7 A;  1SXW A;  2L5P A;  2WQ9 A;  3FA8 A;  4A8Z A;  5H9K A;  4Y0R A;  5F58 A;  5DPQ A;  3FR4 A;  4HWM A;  1JIW I;  2AKQ A;  1HMR A;  5AJC A;  3PP6 A;  1A18 A;  4YCH A;  4ORR A;  1HMT A;  4HPA A;  4R0B A;  4ZHF A;  4YMY A;  3N91 A;  1ZNE A;  1ICN A;  5B29 A;  4YH0 A;  5HA0 A;  3KQ0 A;  4IAX A;  3P24 A;  1BSY A;  3FIQ A;  2FR3 A;  1IW2 A;  1LNM A;  3F9D A;  1EPB A;  4QGW A;  5KID A;  4QAE A;  4I6S A;  2A2U A;  1BRP A;  4WFV A;  1EQD A;  4XMF A;  3ZW0 A;  1G5W A;  2MWH A;  5LJH A;  3MX7 A;  1DZK A;  1BSQ A;  1SA8 A;  3B2I A;  1KT3 A;  4NNT A;  4TKJ A;  2POA A;  3PH5 A;  5D45 A;  3DTQ A;  2WR6 A;  4FQB B;  4LQZ A;  4U8U N;  5BYP A;  2OZQ A;  1JJX A;  3F8A A;  1FEN A;  1BSO A;  4AZR A;  3ZW1 B;  1T68 X;  4K19 A;  2E4J A;  2WEW A;  3EM0 A;  1GX9 A;  1LF7 A;  1E02 A;  1OEJ A;  2Q39 A;  3FW4 A;  4NLJ A;  5D48 A;  2KTD A;  5FQ7 E;  1VYG A;  1NP1 A;  1EW3 A;  3OD9 A;  4QYN A;  3TGB A;  2AT8 X;  1FEL A;  4L1N A;  3TF6 A;  4EXZ A;  1BBP A;  3FYF A;  5B27 A;  4ORU A;  2R56 A;  3JSQ A;  1LIF A;  1O8V A;  2LKK A;  2KT4 B;  4A1H A;  4I9R A;  4ZHD A;  5IO7 A;  2NP1 A;  1T0V A;  3K3L A;  3D95 A;  4AZN A;  1SXY A;  3ZW1 A;  2CZU A;  4UU3 A;  4ON1 A;  4OS8 A;  3NP1 A;  4M7M A;  1DFV A;  3KZA A;  2ACO A;  5FQ6 E;  4ES7 A;  2JOZ A;  2YMS A;  3BRN A;  2L68 A;  2L67 A;  2RD7 C;  4LZV A;  3FEL A;  1QG5 A;  1VPR A;  2AT0 X;  3JQO A;  5KHP A;  4OS0 A;  2BS5 A;  1ERX A;  3ZUO A;  4AZQ A;  1YUP A;  2OVA A;  2LB6 A;  3RSW A;  3P6F A;  5L8O A;  4ZHH A;  4Y0S A;  4ZHG A;  1KT6 A;  5F6Z A;  2LBV A;  4O3Y A;  1E06 A;  1DZP A;  4HFO A;  1HQP A;  4YBP A;  4IB9 A;  4TKH A;  3NR3 A;  1ZRY A;  1PEE A;  3TZS A;  2KTS A;  3OBL A;  5HA1 A;  4BVM A;  4XMD A;  1KOI A;  3B2H A;  3CBS A;  1P6P A;  2GTL M;  1URE A;  5BVT A;  2HYS A;  3PQU A;  1I05 A;  2RCQ A;  2JU8 A;  3WBG A;  2G7B A;  2ALL X;  4PSQ A;  3O19 A;  4MVE A;  2LFO A;  3WJG A;  1ERB A;  2W2A A;  3KFH A;  3S26 A;  4ZCB A;  1IIU A;  3HWG A;  3NPO A;  4GZV A;  4UU2 A;  2WUT A;  4XME A;  3RZY A;  4QGX A;  1ACD A;  1LID A;  1QWD A;  3VU1 A;  3FR5 A;  3WVM A;  1OPB A;  1BEB A;  2AL0 X;  3KFG A;  3ZWE A;  4I3C A;  3ZQ3 A;  3NX2 A;  4QZU A;  2R73 A;  1TOW A;  3S5X A;  1KQW A;  1YP7 A;  3APW A;  1A3Y A;  1YWB A;  3FA9 A;  3BU9 A;  4IAB A;  1QY0 A;  4O4U A;  2AMM X;  4YGZ A;  2FR2 A;  2ZAI A;  4ZR2 A;  4FGI B;  4MIS A;  4ARH A;  4O4S A;  4YDB A;  4ZGF A;  4YKM A;  1YWC A;  5D8J A;  4QYP A;  3TGA A;  1KZX A;  1GM6 A;  2G79 A;  1G85 A;  1OBU A;  4U3Q A;  5BVS A;  3NQ3 A;  1U18 A;  3HWF A;  5HZQ A;  3AKM A;  3VG2 A;  5FEN A;  4GRJ A;  4EDE A;  1BRQ A;  1LIB A;  2KD2 A;  4NNS A;  3C78 X;  3VE2 A;  3ZW0 B;  4TKB A;  1A57 A;  2FS7 A;  1X89 A;  5L8N A;  3VG5 A;  2QM9 A;  3IA8 A;  2IFB A;  4IBA A;  5EZ2 A;  3HWD A;  3H3I A;  1GT5 A;  4YFP A;  3FMZ A;  2QOS C;  4I3B A;  3WJC A;  3PH6 A;  3FEK A;  2X46 A;  3JS1 A;  4GK9 A;  1NGL A;  4GE1 A;  4ZFX A;  4GDZ A;  1EII A;  4GNY A;  1SXX A;  3RKG A;  3KFF A;  4HPB A;  1FTP A;  3L4R A;  1ZNH A;  2Q2M A;  3VG6 A;  1JJJ A;  4QZT A;  5H9L A;  1KXO A;  3QKG A;  5HBS A;  4GKC A;  1U17 A;  2CZT A;  3VPJ E;  1BWY A;  2AT3 X;  5KIC A;  3UEU A;  2WQA E;  1YP6 A;  1XCA A;  1BLR A;  4NP1 A;  2XST A;  4M6S A;  5HZ9 A;  4ALO A;  1IKE A;  1EUO A;  1DZM A;  4NLI A;  4WHI A;  4CSB A;  3CBC A;  2JU7 A;  4YGG A;  4DQ4 A;  4ZJ0 A;  3STN A;  3P6H A;  3PQS A;  1CRB A;  3PPT A;  2CBS A;  4AW8 A;  3EMM A;  5H9A A;  3BU1 A;  1GKA A;  3P6D A;  2OVD A;  2R74 A;  1GT4 A;  1TVQ A;  1CBQ A;  4D6B A;  4O3W A;  4OS3 A;  4EFG A;  1OBQ A;  3O22 A;  2RCT A;  1OEE A;  2F73 A;  1B0O A;  4A1Y A;  5LKF A;  4IAW A;  1ZNL A;  3CQR A;  4I3D A;  3GE2 A;  3EBW A;  4MIR A;  2JN3 A;  5AJB A;  3HTY A;  1N0S A;  1OPA A;  3LV4 A;  4TLJ A;  4QGV A;  4N7C A;  1CBR A;  3S60 A;  4FBO A;  4EEJ A;  3D4R A;  1KT7 A;  4YFR A;  4GH7 A;  3NX1 A;  3VE1 A;  1IKJ A;  4QQ1 A;  4KC7 A;  2K23 A;  1JBH A;  2GTL O;  5HCE C;  1GT1 A;  2DM5 A;  3FW5 A;  1QFT A;  4JGL A;  5HCD C;  3UAQ A;  3WJB A;  2QO5 A;  3HWE A;  4O9S A;  5LJG A;  5D47 A;  4KCA A;  4AZO A;  1QY1 A;  5C0N A;  3APX A;  3UEX A;  2A13 A;  1X8N A;  3MVF A;  1EI5 A;  2KW1 A;  2X8T A;  2HMB A;  3VG7 A;  1Y9L A;  1HBQ A;  1SY0 A;  3B2J A;  5LJB A;  1D3S A;  3ZUI A;  1KT4 A;  1VYF A;  3MBT A;  1SY3 A;  5HAE A;  2JW1 A;  4IMO A;  3VG3 A;  2BLG A;  1G7N A;  2QO6 A;  2QO4 A;  2AT5 X;  2HZQ A;  4TJZ A;  1ZND A;  5IO5 A;  2ASN X;  4LZU A;  2W2F A;  1PBO A;  1KQX A;  4MVI A;  4TQ2 A;  1LFO A;  4I9S A;  4GU8 A;  5FFH A;  2NNQ A;  1IFB A;  2CM4 A;  1MUP A;  2CM9 A;  3C76 X;  3FR2 A;  1B8E A;  3F6Z B;  3STM X;  2K62 A;  1ADL A;  5LJD A;  1LIE A;  2M4L A;  4GET A;  3WXQ A;  1RLB E;  5HZ5 A;  1QQS A;  1SXU A;  1UZ2 X;  3RWX A;  4XMH A;  4INN A;  1KT5 A;  1R0U A;  2Q2P A;  3BSZ E;  1TXL A;  4NYR A;  3V8U A;  5DG4 A;  2MHD A;  4L3R A;  3FA7 A;  1YWD A;  5LJK A;  3ELZ A;  5BVQ A;  2JU3 A;  3ELX A;  3I17 A;  4QRL A;  1AQB A;  1CBI A;  2X45 A;  1O1V A;  3OJY C;  3FEN A;  1LPJ A;  4TNN A;  1E5P A;  1MX8 A;  3I0A A;  2WSJ A;  1JV4 A;  1E00 A;  3EBK A;  4XMC A;  3APV A;  1MVG A;  3UEW A;  5F6B A;  4RUU A;  2Z4I A;  1H91 A;  4U9C A;  3WOV A;  2FT9 A;  2RN4 A;  4O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...