3HTYA

Crystal structure of a lipocalin-like protein (bt_0869) from bacteroides thetaiotaomicron vpi-5482 at 1.95 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
94
Chain Sequence
b'GASIVGSWVEPVPGLEGQVQGIKMEEGGVASSVNMATLVYESWKQEGTKLILTGKSIGNGQTIEFVDTMDIKRLTADSLVLDNQGMEIRYAKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BT_0869
publication title Crystal structure of hypothetical protein BT_0869 from Bacteroides thetaiotaomicron VPI-5482 (NP_809782.1) at 1.95 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Structural genomics, unknown function
total genus 14
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.280 Mainly Beta Beta Barrel Lipocalin Lipocalin 3htyA00
3HTYA 5BYPA 4QRLA
chains in the Genus database with same CATH superfamily
1KL3A 5B5GA 2WEXA 2PY1A 4GJSA 1W5RA 1JBHA 5D8JA 1JZUA 5AQ6A 2AT3X 2AMMX 1EW3A 3SAOA 4OMWA 1VWJB 1XKIA 2N93A 3C77X 5IO7A 3RKGA 2GTLM 5LJHA 2JU8A 2F01A 2K23A 3Q34A 4OEMA 3KFHA 2AF5A 4ZHGA 1Z24A 1Y9TA 2KTSA 5CHKA 2OF8A 4N7DA 3AKNA 4NLJA 1AVGI 1SRGA 2RTCB 1SXWA 5HBSA 2G8CO 3NX2A 3OBLA 4M7MA 2G7BA 1L6MA 1UYNX 3NQ3A 4Y0SA 3BX8A 1PEEA 3CWKA 1VWLB 4IB7A 3RDMA 1MDCA 3RY1A 5D47A 4CPHA 1I06A 1RBPA 1WUBA 1ZNEA 3I17A 4BBOA 1N0SA 1NQMA 1QFVA 1B56A 4ES7A 1TVQA 3EW2A 3WZNA 5CE4A 5HZQA 2Z4HA 2R56A 1CJ5A 1MK5A 3LHNA 3F8AA 3H3IA 4ORXA 4YDAA 3VG5A 3FA7A 1TOUA 1U17A 3WJFA 2CM4A 2HKDA 3APWA 1LCWA 3NP1A 1LIDA 2NNQA 2A13A 1SLDB 1GGLA 2RTIB 3HWFA 4JHQA 2RTDB 4TKHA 1CBQA 1KT6A 5B3MO 3JSQA 4ZH6A 3WXQA 1TW4A 2A2GA 2UZ2A 1VWMB 4U46A 3WYQA 4Y59A 2RTOB 3NQ9A 1ZNHA 1KQWA 2LA7A 2Q39A 1BSOA 3EM0A 2FKGA 4QZTA 5AJCA 5F2BA 4GGRA 1B8EA 5F58A 2X32A 4IRWA 3WVMA 4DQ4A 4AZNA 1NGLA 1U18A 3EMMA 1X8NA 2RTHB 3FYFA 4GK9A 3VE2A 1NP4A 2IZCB 4QYNA 2QOSC 2CBRA 4GNWA 2LKKA 4TNNA 3QQ2A 1R0UA 2RTFB 3FEKA 3D9WA 4AZRA 1H91A 4A60A 4MISA 1GX9A 4KT5A 4YGGA 2MF6A 3VHIA 2O62A 4Y0PA 3SLTA 3ZZVA 5B2AO 1GX3A 4O3XB 1STRB 3UEUA 4CPIA 1LIBA 1JYJA 5F7GA 5B11O 1VYGA 1BLRA 5FENA 1S7DA 2NP1A 1SRIA 4QGVA 3CR6A 4IAXA 1DZMA 2NNDA 4GE1A 5HTDA 2RTNB 2FGSA 3BS2A 5HZ6A 3KFFA 4ORRA 3PK2A 4U8UO 1D3SA 1DZJA 1AVEA 1SLGB 3ZI8A 4DNEA 2C1QA 3P6DA 1S2PA 2JOZA 2RA6A 4GD9A 3FLLA 1BJ7A 1OBUA 3PQSA 3N91A 4BCSA 3CQNA 1YP7A 5L8OA 1EALA 1I4UA 1O8VA 1ZNDA 5LKFA 3RE5A 2RTAA 1SXXA 1X8QA 2A8GA 4CPHB 1EXSA 4NNSA 2OYBO 4CDCA 2IZBA 2QCBA 2OFRX 3PH5A 4DQ3A 4ORSA 1SWHA 3WBGA 4EDEA 5C0NA 2OFAA 2WUTA 2WQAE 4LKTA 4CDDA 1LCVA 1EPBA 4I3CA 2BS5A 5F6BA 4AZMA 3FA9A 5FQ8E 3ZW2A 1QABE 2GTLO 2MWHA 2RD7C 1W6FA 1T68X 4ML7B 1HBPA 2HNXA 3VHMA 2C4IA 2QMIA 4BJ8A 3G7XA 3ZW0A 2IZDB 4NNTA 3RSWA 1VPRA 4C5PA 3VHHA 4BX5A 2OL7A 4KH8A 1VWHB 1RXKA 1FELA 3PPTA 2JU3A 1HMSA 2FS7A 3BSZE 5EZ2A 1GXAA 3AUMO 1HXLA 1IIUA 2MHDA 1VWIB 5EEEA 5D48A 1A2DA 2F09A 2MM3A 4I60A 1O1UA 5BVQA 1LIEA 4BVMA 2FT9A 3VG3A 1JIWI 2OVSA 1I05A 1SWDA 1OEEA 4BX7A 5EEDA 3X00A 2CZUA 1JQPA 2IZEB 4QZUA 1MOYA 2AT8X 2CZTA 2IZHB 2OVAA 3PDFA 5IRUA 1CBRA 2YMSA 2LB6A 4AZQA 1YUPA 4AW8A 2Q4NA 3FMZA 3T6LA 1UYOX 4KC7A 2Y3EA 3V8UA 2MO5A 2A5CA 1CBSA 1RXJA 2JW1A 3OJYC 1GT1A 3LV4A 5D4AA 2FWVA 3P6CA 1TXLA 3MBTA 3SOTA 1KT4A 5LJEA 3FIQA 4FBRA 2OFBA 1ERBA 1ZNGA 2IZAA 2RQ0A 3NX1A 4O3ZA 2ALLX 5HTEA 5L8IA 3UEVA 4CSBA 2FKJA 4YBPA 5L3YA 4NV7A 1SXYA 4IB8A 4GH7A 4ON1A 3I0AA 2KT4B 1JV4A 2L9CA 4GKCA 1SY1A 2XKLA 4IAWA 4XMHA 4XMCA 4Y0QA 3PP6A 2RTRB 1GT5A 1MEPA 3ZQ3A 3RDSA 4XMFA 4KCAA 3U9PC 2BHVA 4GDAA 4TLJA 2HZRA 4YBUA 1QQSA 2OFMX 3PECA 2ZSCA 4WHIA 3P6FA 1E2TA 3D95A 1HMRA 3WJGA 1SWOA 1N9MA 5AJBA 5IO5A 4I3BA 3S60A 4PJ2A 5F6ZA 2X8SA 3RY2A 5K68A 3SZIA 4EKVA 2AVIA 1E00A 3KQ0A 5K06A 2HZQA 4OS0A 3GE2A 1K24A 1MX8A 1PTSA 5D45A 4YGZA 3HK1A 1JJXA 1KZWA 1OEKA 3O19A 4LZVA 1RSUB 3BU1A 2E4JA 2OY7A 3F9DA 5HA0A 4I9RA 1OBQA 1ZRYA 2IZGB 1MUPA 1KGLA 4NP1A 2GH7A 4HPBA 4O4OA 1SWGA 2BSZA 3S5VA 4FQBB 1YWAA 2FTBA 4Y5DA 3RDXA 4EFGA 2W2BA 3P6HA 2BT9A 4YFQA 1GT3A 2RN4A 2VFBA 1O1VA 1YWBA 2WR6A 3ZWEA 3ZW0B 3C78X 1VWDB 1VWCB 4QAEA 4UU2A 4BX5B 2G5LA 2LFOA 4GNYA 4YDBA 1AQBA 2OVEA 2AH7X 4JO6A 5LJBA 3RDUA 4A1HA 5FFHA 4QRLA 3RWXA 4A1YA 4GGZA 3PH6A 3MX7A 4AZOA 4TQ2A 3RDOA 2A3FX 2RTMA 1IKEA 4O3WA 4D6AA 1BRQA 1SWTA 4QYPA 2IZIA 3STMX 1RAVA 4BX7B 4QGWA 3ZW1A 4ZHHA 1QWDA 5HCEC 4IB9A 1SA8A 1OEJA 1XCAA 2X56A 3B2KA 3B2JA 5BVTA 2RTBB 3CKGA 2RTLA 4OS3A 5KIDA 1IFCA 1JJJA 5FAZA 3T6FA 1EI5A 2W2FA 2Q2MA 2XSTA 4MIRA 2LBAA 4JNJA 3SLJA 1QFTA 1Y53X 1YWDA 2Q9SA 4ZH9A 1GX8A 3D4RA 3EW1A 4ZHCA 5KHPA 3LTWA 2WEWA 4O3YA 2G78A 3KFIA 2X46A 2FHNX 5IRAA 4ALBA 3KVNA 2IZKA 2X4MA 1LKEA 1SLFB 2X55A 1PM1X 2X45A 1KFFA 2YG2A 1CBIA 1SWJA 3ELZA 3K3LA 1P6PA 4IB6A 3P02A 2RCQA 1EQDA 1N9YA 1A57A 4O4UA 3TZSA 3STKA 2FS6A 2RTGB 4MVIA 1SREA 2IZLB 3P6GA 4QGXA 1IJ8A 4ALOA 2ACOA 3WJEA 4CK4A 4YH0A 3FR5A 1VYFA 4FGIB 3HTYA 2C1SA 4JGLA 1X8PA 4OKAA 4CDFA 2VDFA 4GZVA 3TGCA 1KXOA 3EYCA 4MVKA 1SWUA 1KOIA 3NADA 4WBKA 1JYDA 3WJCA 3OD9A 1AB0A 5H8TA 3CKFA 5EPQA 1OPBA 2GJ5A 3APXA 5FQ7E 4BGFA 4RUUA 5K67A 1ADLA 3L4RA 3UEXA 3VU1A 4NV8A 3FELA 4R0BA 3T1DA 2OZQA 4GGTA 1LDQA 1MX7A 4IMNA 4YKMA 4GETA 1BBPA 3E3CA 1B4MA 1I04A 4Z27A 4XMGA 3EBKA 5DPQA 2I5ZO 2PI3O 3FR2A 5F1EA 3VG6A 4Z2PA 1SRHA 2KTDA 4OELA 5H9NA 1KT5A 5HAEA 4L3RA 1DF8A 1NQNA 3GAQA 1SWNA 1KT3A 1UZ2X 2FHLA 2AT5X 3APUA 1KT7A 1RXHA 3SLOA 3T2WA 3ZW1B 4BOEA 2P8GA 1IW2A 4EQAC 1FEMA 3RZYA 4GUZA 1DF3A 1SY3A 4HPAA 1T8VA 2LBVA 5LKEA 4CPFA 1X8UA 4O4SA 1YWCA 3AEHA 3BY0A 4MEEA 4Z6JA 5KICA 1A3YA 3MG5A 3VG2A 1NDJA 3DTQA 4YMYA 1ZNLA 3FDCA 3IA8A 1DC9A 4O4XA 3NBXX 5EDCA 1SY2A 3D97A 4YFPA 4LQZA 1JMZA 3HWDA 5LJDA 4YCEA 5DG4A 4EXZA 3NR3A 1RSTB 1X89A 4ODDA 5CYBA 4BX6A 5HZ8A 1E02A 3KZAA 4ID2A 3RDQA 1SMPI 2POAA 3WJBA 4B55A 1I78A 3WZOA 1VWRB 3WOVA 3BRNA 1LPJA 1SWRA 1OPAA 2ZAGA 2AL0X 3WYPA 2QO6A 3VG7A 1HY2A 1BSQA 4IABA 1X8OA 2RTKA 3TGBA 1STPA 2M4LA 2VFCA 3C76X 3FW4A 1FDQA 4WFUA 3MVFA 1IFBA 5JD2A 2BC3A 4HPCA 2FRSA 1BSYA 4NLIA 4KIIA 3EC5A 1FE3A 1DZKA 2L68A 2FR3A 1HXZA 2QM9A 2Q2PA 3WZPA 4YCHA 5IXGA 5FQ6E 1SWLA 4LKPA 1AVDA 4GDZA 1Y0GA 4O49A 4IBAA 2BLGA 5B10O 1DFVA 1N7YA 1SXUA 1PMPA 1MM9A 2ANSA 1KL5A 1QY2A 2IZJA 2JU7A 1FJ1E 1B0OA 3MM0A 3JQOA 3S26A 3UEWA 2HYSA 4QNIA 2L5PA 1A18A 4U9CA 2OY5O 3P24A 3RBYA 5HA1A 3O22A 4AYHA 3CBCA 1AELA 1KL4A 5HZ9A 1LDOA 3OE3A 1HN2A 4HPDA 3SZHA 1HBQA 4I6SA 2ACPX 1DZPA 3FIDA 1E5PA 3NPOA 1IKJA 3T2XA 3FA8A 4ZHDA 2Z4IA 3B2IA 3F6ZB 1VWPB 3FEPA 4GJVA 4NYRA 5EDBA 4N7CA 4CDEA 2Y32A 1EPAA 1ICNA 4K19A 4Z2OA 1GM6A 1ZNKA 3BU9A 4I95A 4Z28A 3TF6A 1EIOA 1VWQB 4TKBA 1TOWA 1STSB 1NBXA 3CQRA 1D2UA 4IMOA 3TGAA 1Y9LA 3JS1A 5HCCC 1KQXA 2F73A 5HCDC 3CBSA 4COTA 1FENA 3AKMA 4I3DA 3WJDA 2DM5A 3CMPA 5LJCA 2QOMA 3PQUA 1VWNB 3RE6A 2HMBA 1VWEB 2JN3A 3FENA 3P6EA 1K3BA 5CSEA 4ZGUA 4BX6B 1G74A 2OVDA 5B29A 5IRWA 1SWFA 1RLBE 1VWKB 1ACDA 1S44A 1Y52X 2QO4A 2UYWA 3FR4A 3D96A 1WBIA 4INNA 2CM9A 2DJFA 4LZUA 1QY1A 1ICMA 1QG5A 3VE1A 2X34A 2GTFX 3HPEA 1EIIA 1HQQA 4YVBA 1CRBA 2Y3FA 4ZR2A 2RCTA 2KD2A 5BYPA 4ARHA 1SWEA 1UREA 1NP1A 4XMEA 2R73A 2WQ9A 3BLGA 1DV9A 1OBPA 2RTJA 4DCBA 1ALBA 1NC9A 1SY0A 1SWAA 2QO5A 2X8FA 5LJKA 4TKJA 1ERXA 5B27A 3B2HA 1G7NA 4O9SA 1GT4A 1LICA 1SWPA 2WSJA 2DJGA 1VWGB 3ZUIA 5L8NA 2NNEA 4CV7A 1SRJA 4MVLA 1E06A 1N43A 2IZFB 1LCZA 3BX7A 3IFBA 1EUOA 1PBYA 1T0VA 1SWQA 2OF9A 4YKOA 3KFGA 5H9LA 4AZPA 1LELA 4YFRA 1YP6A 3UAQA 1QY0A 1GKAA 3STNA 5B5FA 1LNMA 1BM5A 1LF7A 2L67A 2AT0X 4TJZA 2MJIA 1X71A 1OSPO 2OL6O 4A8ZA 1KZXA 3VG4A 1SWCA 4FBOA 5LJGA 2A2UA 5IO6A 2RTQB 2ASNX 4ORYA 3U03A 3FW5A 4YGHA 3S5XA 4PSQA 4QQ1A 2OY8A 3O2YA 2OL8O 1U0XA 3FA6A 2AT6X 4I9SA 4OS8A 5HWZA 2R74A 3ZUOA 1SRFA 2WWPA 1LIFA 1VYOA 4Z2VA 4ZCBA 1JMXA 3PEDA 4CPEA 3SZJA 3WZQA 1SLEB 2W2AA 1LUQA 4HWMA 1N4JA 1W4TA 1LFOA 4NYQA 1PBOA 5BVSA 2A0AA 4M6SA 1SWBA 3ELXA 2WPUA 2RTPB 1BEBA 4GRJA 4UU3A 2G79A 4GU8A 5H9KA 2OY1O 5JR8A 4BQUA 1VWBB 2HLVA 4ORUA 1HQPA 1SWSA 2ZAIA 3EBWA 1SWKA 4U8UN 3VPJE 4KC8A 4OMXA 1VWFB 4U3QA 3U0DA 2BS6A 1ML7A 1I9HA 3DSZA 3B2LA 2FLJA 4EEJA 1BRPA 2RTEB 2FR2A 2JGSA 4ZJ0A 1VWOB 5HZ5A 1BWYA 4ORWA 2A5BA 1G85A 2KW1A 4XMDA 3VGWA 4Y0RA 4ZHFA 4MVEA 2CAMA 2GC9A 2K62A 3NQKA 4FBVA 4D6BA 4RUNA 4WFVA 4ZFXA 2X8TA 3HOLA 4U8UM 5AEOA 1MVGA 4HFOA 2AKQA 4L1NA 1YIVA 2GTLN 1Y55X 4NW4A 2JMBA 3HWGA 1VWAB 2IFBA 1HMTA 3HWEA 1G5WA 3Q6LA 3QKGA 2I5VO 3BDRA 1JJUA 3APVA 4ZGFA 2CBSA 3HOEA 1FTPA 5H9AA 2EU7X 1GKAB
chains in the Genus database with same CATH topology
2WEXA 2PY1A 1JBHA 5D8JA 1JZUA 5AQ6A 2AT3X 2AMMX 1EW3A 3SAOA 4OMWA 1XKIA 2N93A 3C77X 5IO7A 3RKGA 2GTLM 5LJHA 2JU8A 2K23A 3KFHA 4ZHGA 1Z24A 1Y9TA 2KTSA 4N7DA 3AKNA 4NLJA 1AVGI 5HBSA 1SXWA 3NX2A 3OBLA 4M7MA 4Y0SA 2G7BA 1L6MA 3NQ3A 1PEEA 5HTDA 3BX8A 3CWKA 4IB7A 1MDCA 5D47A 1I06A 1RBPA 1ZNEA 3I17A 1N0SA 1QFVA 4ES7A 1B56A 1TVQA 5CE4A 5HZQA 2Z4HA 2R56A 1CJ5A 3LHNA 3F8AA 3H3IA 4ORXA 4YDAA 3VG5A 3FA7A 1TOUA 1U17A 2CM4A 3APWA 3NP1A 1LIDA 2NNQA 2A13A 1GGLA 3HWFA 4TKHA 1CBQA 1KT6A 3JSQA 4ZH6A 3WXQA 1TW4A 2A2GA 3NQ9A 1ZNHA 1KQWA 2LA7A 2Q39A 1BSOA 3EM0A 4QZTA 5AJCA 5F58A 3WVMA 1B8EA 4DQ4A 4AZNA 1NGLA 1U18A 3EMMA 1X8NA 3FYFA 4GK9A 3VE2A 1NP4A 4QYNA 2QOSC 2CBRA 4GNWA 2LKKA 4TNNA 1R0UA 3FEKA 4AZRA 1H91A 4A60A 4MISA 1GX9A 4KT5A 4YGGA 2O62A 4Y0PA 3ZZVA 4O3XB 3UEUA 1LIBA 1JYJA 5F7GA 1VYGA 1BLRA 5FENA 1S7DA 2NP1A 4QGVA 3CR6A 4IAXA 1DZMA 2NNDA 4GE1A 5HZ6A 3BS2A 3KFFA 4ORRA 4U8UO 1D3SA 1DZJA 3ZI8A 3P6DA 1S2PA 2JOZA 2RA6A 3FLLA 1BJ7A 1OBUA 3PQSA 3N91A 3CQNA 1YP7A 5L8OA 1EALA 1I4UA 1O8VA 1ZNDA 1SXXA 1X8QA 1EXSA 4NNSA 2OFRX 3PH5A 4DQ3A 4ORSA 5C0NA 3WBGA 4EDEA 2WUTA 2WQAE 4LKTA 1EPBA 4I3CA 2BS5A 5F6BA 4AZMA 3FA9A 5FQ8E 3ZW2A 1QABE 2GTLO 2MWHA 2RD7C 4ML7B 1T68X 1HBPA 2HNXA 2QMIA 3G7XA 3ZW0A 4NNTA 3RSWA 1VPRA 4KH8A 1FELA 3PPTA 2JU3A 1HMSA 2FS7A 3BSZE 5EZ2A 1GXAA 2MHDA 1IIUA 5EEEA 5D48A 1A2DA 2F09A 2MM3A 5BVQA 1O1UA 1LIEA 4BVMA 2FT9A 3VG3A 1JIWI 2OVSA 1I05A 1OEEA 5EEDA 4YMYA 2CZUA 4QZUA 2AT8X 2CZTA 2OVAA 5LKFA 1CBRA 2YMSA 2LB6A 4AZQA 1YUPA 4AW8A 2Q4NA 3FMZA 4KC7A 3V8UA 2MO5A 1CBSA 2JW1A 5D4AA 3OJYC 1GT1A 3LV4A 2FWVA 3P6CA 1TXLA 3MBTA 3SOTA 1KT4A 5LJEA 3FIQA 4FBRA 1ERBA 1ZNGA 2RQ0A 4O3ZA 3NX1A 5L8IA 2ALLX 5HTEA 3UEVA 4CSBA 4YBPA 1SXYA 4IB8A 4GH7A 4ON1A 3I0AA 2KT4B 1JV4A 2L9CA 4GKCA 1SY1A 2XKLA 4IAWA 4XMHA 4XMCA 4Y0QA 3PP6A 1GT5A 3ZQ3A 4XMFA 4KCAA 3U9PC 2BHVA 4TLJA 2HZRA 4YBUA 1QQSA 2OFMX 3PECA 4WHIA 3P6FA 3D95A 1HMRA 3WJGA 5AJBA 1KZWA 5IO5A 4I3BA 3S60A 4PJ2A 5F6ZA 2X8SA 5K06A 1E00A 3KQ0A 2HZQA 4OS0A 3GE2A 1MX8A 5D45A 4YGZA 3HK1A 1JJXA 1OEKA 3O19A 4LZVA 3BU1A 2E4JA 3F9DA 5HA0A 4I9RA 1OBQA 1ZRYA 1KGLA 1MUPA 4NP1A 4O4OA 4HPBA 3S5VA 4FQBB 1YWAA 2FTBA 4EFGA 2W2BA 3P6HA 2BT9A 4YFQA 1GT3A 2RN4A 2WR6A 1O1VA 1YWBA 3ZWEA 3ZW0B 3C78X 4QAEA 4UU2A 2LFOA 4YDBA 4GNYA 2AH7X 1AQBA 2OVEA 5LJBA 4A1HA 5FFHA 4QRLA 3RWXA 4A1YA 3PH6A 3MX7A 4AZOA 4TQ2A 2A3FX 1IKEA 4O3WA 4D6AA 1BRQA 4QYPA 3STMX 4QGWA 3ZW1A 4ZHHA 1QWDA 5HCEC 4IB9A 1SA8A 1OEJA 1XCAA 3B2KA 3B2JA 5BVTA 4OS3A 5KIDA 1JJJA 1IFCA 5FAZA 1EI5A 2W2FA 2Q2MA 2XSTA 4MIRA 2LBAA 1QFTA 1YWDA 2Q9SA 4ZH9A 1GX8A 3D4RA 4ZHCA 5KHPA 2WEWA 4O3YA 2G78A 3KFIA 2X46A 4ALBA 1LKEA 1PM1X 2X45A 2YG2A 1CBIA 3ELZA 3K3LA 1P6PA 4IB6A 3P02A 2RCQA 1EQDA 1A57A 4O4UA 3TZSA 3STKA 2FS6A 4MVIA 3P6GA 4QGXA 4ALOA 2ACOA 3WJEA 4CK4A 4YH0A 3FR5A 1VYFA 4FGIB 3HTYA 4JGLA 1X8PA 4GZVA 3TGCA 1KXOA 3EYCA 4MVKA 4WBKA 1KOIA 3NADA 3WJCA 1JYDA 3OD9A 1AB0A 5H8TA 5EPQA 1OPBA 2GJ5A 3APXA 5FQ7E 4RUUA 1ADLA 3L4RA 3UEXA 3VU1A 3FELA 4R0BA 3T1DA 2OZQA 1MX7A 4IMNA 4YKMA 4GETA 1BBPA 3E3CA 1B4MA 1I04A 4XMGA 3EBKA 5DPQA 5F1EA 3FR2A 3VG6A 2KTDA 5H9NA 5HAEA 1KT5A 4L3RA 3GAQA 1KT3A 1UZ2X 3APUA 2AT5X 1KT7A 3ZW1B 4BOEA 2P8GA 1IW2A 4EQAC 1FEMA 3RZYA 1DF3A 1SY3A 4HPAA 1T8VA 2LBVA 5LKEA 1X8UA 4O4SA 1YWCA 3BY0A 5KICA 1A3YA 3VG2A 3DTQA 1ZNLA 3IA8A 4O4XA 1DC9A 3NBXX 5EDCA 1SY2A 3D97A 4YFPA 4LQZA 3HWDA 5LJDA 4YCEA 5DG4A 4EXZA 3NR3A 1X89A 4ODDA 5CYBA 5HZ8A 1E02A 3KZAA 4ID2A 1SMPI 2POAA 3WJBA 3WOVA 3BRNA 1LPJA 1OPAA 2ZAGA 2AL0X 2QO6A 3VG7A 1BSQA 4IABA 1X8OA 3TGBA 3C76X 2M4LA 3FW4A 4WFUA 1FDQA 3MVFA 1IFBA 4HPCA 2FRSA 1BSYA 4NLIA 4KIIA 1FE3A 1DZKA 2L68A 2FR3A 2QM9A 2Q2PA 4YCHA 5FQ6E 4LKPA 4GDZA 4O49A 4IBAA 2BLGA 1DFVA 1SXUA 1PMPA 2ANSA 2JU7A 3S26A 1QY2A 1B0OA 3JQOA 3UEWA 2HYSA 4QNIA 2L5PA 1A18A 4U9CA 3P24A 3RBYA 5HA1A 3O22A 4AYHA 3CBCA 1AELA 5HZ9A 3OE3A 1HN2A 4HPDA 1HBQA 4I6SA 2ACPX 1DZPA 1E5PA 3NPOA 1IKJA 3FA8A 4ZHDA 2Z4IA 3B2IA 3F6ZB 3FEPA 5EDBA 4NYRA 4N7CA 1EPAA 1ICNA 4K19A 1GM6A 1ZNKA 3BU9A 4I95A 3TF6A 1EIOA 4TKBA 1TOWA 3CQRA 4IMOA 1D2UA 3TGAA 1Y9LA 3JS1A 1KQXA 2F73A 5HCDC 3CBSA 4COTA 1FENA 3AKMA 4I3DA 3WJDA 2DM5A 3CMPA 5LJCA 3PQUA 2HMBA 2JN3A 3FENA 3P6EA 4ZGUA 1G74A 2OVDA 5B29A 1RLBE 1ACDA 1S44A 2QO4A 3FR4A 3D96A 4INNA 2CM9A 4LZUA 1QY1A 1ICMA 1QG5A 3VE1A 2GTFX 1EIIA 1CRBA 4ZR2A 2RCTA 2KD2A 5BYPA 4ARHA 1UREA 1NP1A 4XMEA 2R73A 2WQ9A 3BLGA 1DV9A 1OBPA 5LJKA 1ALBA 1SY0A 2QO5A 2X8FA 4TKJA 1ERXA 5B27A 3B2HA 1G7NA 4O9SA 1GT4A 1LICA 2WSJA 3WJFA 5L8NA 3ZUIA 2NNEA 4CV7A 4MVLA 1E06A 5HCCC 3BX7A 3IFBA 1EUOA 1T0VA 4YKOA 5H9LA 3KFGA 4AZPA 4YFRA 1YP6A 3UAQA 1QY0A 1GKAA 3STNA 1LNMA 1BM5A 1LF7A 2L67A 2AT0X 4TJZA 2MJIA 1X71A 4A8ZA 1KZXA 3VG4A 4FBOA 5LJGA 2A2UA 5IO6A 4ORYA 2ASNX 3U03A 3FW5A 4YGHA 3S5XA 4PSQA 4QQ1A 3O2YA 1U0XA 3FA6A 2AT6X 4I9SA 4OS8A 5HWZA 2R74A 3ZUOA 2WWPA 1LIFA 4ZCBA 3PEDA 4HWMA 2W2AA 1LFOA 4NYQA 1PBOA 5BVSA 2A0AA 4M6SA 3ELXA 1BEBA 4GRJA 4UU3A 2G79A 4GU8A 5H9KA 5JR8A 4BQUA 4ORUA 2HLVA 1HQPA 2ZAIA 3EBWA 4U8UN 3VPJE 4KC8A 4OMXA 4U3QA 3U0DA 2BS6A 1ML7A 3DSZA 3B2LA 2FLJA 4EEJA 1BRPA 2FR2A 4ZJ0A 5HZ5A 1BWYA 4ORWA 1G85A 2KW1A 4XMDA 4Y0RA 4ZHFA 4MVEA 2GC9A 2K62A 3NQKA 4D6BA 4FBVA 4RUNA 4WFVA 4ZFXA 2X8TA 3HOLA 4U8UM 5AEOA 1MVGA 4HFOA 2AKQA 4L1NA 1YIVA 2GTLN 4NW4A 1G5WA 2JMBA 3HWGA 2IFBA 3HWEA 1HMTA 3Q6LA 3QKGA 3BDRA 3APVA 4ZGFA 2CBSA 3HOEA 1FTPA 5H9AA 2EU7X 1GKAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTY A;  5BYP A;  4QRL A; 
#chains in the Genus database with same CATH topology
 1KL3 A;  5B5G A;  2WEX A;  2PY1 A;  4GJS A;  1W5R A;  1JBH A;  5D8J A;  1JZU A;  5AQ6 A;  2AT3 X;  2AMM X;  1EW3 A;  3SAO A;  4OMW A;  1VWJ B;  1XKI A;  2N93 A;  3C77 X;  5IO7 A;  3RKG A;  2GTL M;  5LJH A;  2JU8 A;  2F01 A;  2K23 A;  3Q34 A;  4OEM A;  3KFH A;  2AF5 A;  4ZHG A;  1Z24 A;  1Y9T A;  2KTS A;  5CHK A;  2OF8 A;  4N7D A;  3AKN A;  4NLJ A;  1AVG I;  1SRG A;  2RTC B;  1SXW A;  5HBS A;  2G8C O;  3NX2 A;  3OBL A;  4M7M A;  2G7B A;  1L6M A;  1UYN X;  3NQ3 A;  4Y0S A;  3BX8 A;  1PEE A;  3CWK A;  1VWL B;  4IB7 A;  3RDM A;  1MDC A;  3RY1 A;  5D47 A;  4CPH A;  1I06 A;  1RBP A;  1WUB A;  1ZNE A;  3I17 A;  4BBO A;  1N0S A;  1NQM A;  1QFV A;  1B56 A;  4ES7 A;  1TVQ A;  3EW2 A;  3WZN A;  5CE4 A;  5HZQ A;  2Z4H A;  2R56 A;  1CJ5 A;  1MK5 A;  3LHN A;  3F8A A;  3H3I A;  4ORX A;  4YDA A;  3VG5 A;  3FA7 A;  1TOU A;  1U17 A;  3WJF A;  2CM4 A;  2HKD A;  3APW A;  1LCW A;  3NP1 A;  1LID A;  2NNQ A;  2A13 A;  1SLD B;  1GGL A;  2RTI B;  3HWF A;  4JHQ A;  2RTD B;  4TKH A;  1CBQ A;  1KT6 A;  5B3M O;  3JSQ A;  4ZH6 A;  3WXQ A;  1TW4 A;  2A2G A;  2UZ2 A;  1VWM B;  4U46 A;  3WYQ A;  4Y59 A;  2RTO B;  3NQ9 A;  1ZNH A;  1KQW A;  2LA7 A;  2Q39 A;  1BSO A;  3EM0 A;  2FKG A;  4QZT A;  5AJC A;  5F2B A;  4GGR A;  1B8E A;  5F58 A;  2X32 A;  4IRW A;  3WVM A;  4DQ4 A;  4AZN A;  1NGL A;  1U18 A;  3EMM A;  1X8N A;  2RTH B;  3FYF A;  4GK9 A;  3VE2 A;  1NP4 A;  2IZC B;  4QYN A;  2QOS C;  2CBR A;  4GNW A;  2LKK A;  4TNN A;  3QQ2 A;  1R0U A;  2RTF B;  3FEK A;  3D9W A;  4AZR A;  1H91 A;  4A60 A;  4MIS A;  1GX9 A;  4KT5 A;  4YGG A;  2MF6 A;  3VHI A;  2O62 A;  4Y0P A;  3SLT A;  3ZZV A;  5B2A O;  1GX3 A;  4O3X B;  1STR B;  3UEU A;  4CPI A;  1LIB A;  1JYJ A;  5F7G A;  5B11 O;  1VYG A;  1BLR A;  5FEN A;  1S7D A;  2NP1 A;  1SRI A;  4QGV A;  3CR6 A;  4IAX A;  1DZM A;  2NND A;  4GE1 A;  5HTD A;  2RTN B;  2FGS A;  3BS2 A;  5HZ6 A;  3KFF A;  4ORR A;  3PK2 A;  4U8U O;  1D3S A;  1DZJ A;  1AVE A;  1SLG B;  3ZI8 A;  4DNE A;  2C1Q A;  3P6D A;  1S2P A;  2JOZ A;  2RA6 A;  4GD9 A;  3FLL A;  1BJ7 A;  1OBU A;  3PQS A;  3N91 A;  4BCS A;  3CQN A;  1YP7 A;  5L8O A;  1EAL A;  1I4U A;  1O8V A;  1ZND A;  5LKF A;  3RE5 A;  2RTA A;  1SXX A;  1X8Q A;  2A8G A;  4CPH B;  1EXS A;  4NNS A;  2OYB O;  4CDC A;  2IZB A;  2QCB A;  2OFR X;  3PH5 A;  4DQ3 A;  4ORS A;  1SWH A;  3WBG A;  4EDE A;  5C0N A;  2OFA A;  2WUT A;  2WQA E;  4LKT A;  4CDD A;  1LCV A;  1EPB A;  4I3C A;  2BS5 A;  5F6B A;  4AZM A;  3FA9 A;  5FQ8 E;  3ZW2 A;  1QAB E;  2GTL O;  2MWH A;  2RD7 C;  1W6F A;  1T68 X;  4ML7 B;  1HBP A;  2HNX A;  3VHM A;  2C4I A;  2QMI A;  4BJ8 A;  3G7X A;  3ZW0 A;  2IZD B;  4NNT A;  3RSW A;  1VPR A;  4C5P A;  3VHH A;  4BX5 A;  2OL7 A;  4KH8 A;  1VWH B;  1RXK A;  1FEL A;  3PPT A;  2JU3 A;  1HMS A;  2FS7 A;  3BSZ E;  5EZ2 A;  1GXA A;  3AUM O;  1HXL A;  1IIU A;  2MHD A;  1VWI B;  5EEE A;  5D48 A;  1A2D A;  2F09 A;  2MM3 A;  4I60 A;  1O1U A;  5BVQ A;  1LIE A;  4BVM A;  2FT9 A;  3VG3 A;  1JIW I;  2OVS A;  1I05 A;  1SWD A;  1OEE A;  4BX7 A;  5EED A;  3X00 A;  2CZU A;  1JQP A;  2IZE B;  4QZU A;  1MOY A;  2AT8 X;  2CZT A;  2IZH B;  2OVA A;  3PDF A;  5IRU A;  1CBR A;  2YMS A;  2LB6 A;  4AZQ A;  1YUP A;  4AW8 A;  2Q4N A;  3FMZ A;  3T6L A;  1UYO X;  4KC7 A;  2Y3E A;  3V8U A;  2MO5 A;  2A5C A;  1CBS A;  1RXJ A;  2JW1 A;  3OJY C;  1GT1 A;  3LV4 A;  5D4A A;  2FWV A;  3P6C A;  1TXL A;  3MBT A;  3SOT A;  1KT4 A;  5LJE A;  3FIQ A;  4FBR A;  2OFB A;  1ERB A;  1ZNG A;  2IZA A;  2RQ0 A;  3NX1 A;  4O3Z A;  2ALL X;  5HTE A;  5L8I A;  3UEV A;  4CSB A;  2FKJ A;  4YBP A;  5L3Y A;  4NV7 A;  1SXY A;  4IB8 A;  4GH7 A;  4ON1 A;  3I0A A;  2KT4 B;  1JV4 A;  2L9C A;  4GKC A;  1SY1 A;  2XKL A;  4IAW A;  4XMH A;  4XMC A;  4Y0Q A;  3PP6 A;  2RTR B;  1GT5 A;  1MEP A;  3ZQ3 A;  3RDS A;  4XMF A;  4KCA A;  3U9P C;  2BHV A;  4GDA A;  4TLJ A;  2HZR A;  4YBU A;  1QQS A;  2OFM X;  3PEC A;  2ZSC A;  4WHI A;  3P6F A;  1E2T A;  3D95 A;  1HMR A;  3WJG A;  1SWO A;  1N9M A;  5AJB A;  5IO5 A;  4I3B A;  3S60 A;  4PJ2 A;  5F6Z A;  2X8S A;  3RY2 A;  5K68 A;  3SZI A;  4EKV A;  2AVI A;  1E00 A;  3KQ0 A;  5K06 A;  2HZQ A;  4OS0 A;  3GE2 A;  1K24 A;  1MX8 A;  1PTS A;  5D45 A;  4YGZ A;  3HK1 A;  1JJX A;  1KZW A;  1OEK A;  3O19 A;  4LZV A;  1RSU B;  3BU1 A;  2E4J A;  2OY7 A;  3F9D A;  5HA0 A;  4I9R A;  1OBQ A;  1ZRY A;  2IZG B;  1MUP A;  1KGL A;  4NP1 A;  2GH7 A;  4HPB A;  4O4O A;  1SWG A;  2BSZ A;  3S5V A;  4FQB B;  1YWA A;  2FTB A;  4Y5D A;  3RDX A;  4EFG A;  2W2B A;  3P6H A;  2BT9 A;  4YFQ A;  1GT3 A;  2RN4 A;  2VFB A;  1O1V A;  1YWB A;  2WR6 A;  3ZWE A;  3ZW0 B;  3C78 X;  1VWD B;  1VWC B;  4QAE A;  4UU2 A;  4BX5 B;  2G5L A;  2LFO A;  4GNY A;  4YDB A;  1AQB A;  2OVE A;  2AH7 X;  4JO6 A;  5LJB A;  3RDU A;  4A1H A;  5FFH A;  4QRL A;  3RWX A;  4A1Y A;  4GGZ A;  3PH6 A;  3MX7 A;  4AZO A;  4TQ2 A;  3RDO A;  2A3F X;  2RTM A;  1IKE A;  4O3W A;  4D6A A;  1BRQ A;  1SWT A;  4QYP A;  2IZI A;  3STM X;  1RAV A;  4BX7 B;  4QGW A;  3ZW1 A;  4ZHH A;  1QWD A;  5HCE C;  4IB9 A;  1SA8 A;  1OEJ A;  1XCA A;  2X56 A;  3B2K A;  3B2J A;  5BVT A;  2RTB B;  3CKG A;  2RTL A;  4OS3 A;  5KID A;  1IFC A;  1JJJ A;  5FAZ A;  3T6F A;  1EI5 A;  2W2F A;  2Q2M A;  2XST A;  4MIR A;  2LBA A;  4JNJ A;  3SLJ A;  1QFT A;  1Y53 X;  1YWD A;  2Q9S A;  4ZH9 A;  1GX8 A;  3D4R A;  3EW1 A;  4ZHC A;  5KHP A;  3LTW A;  2WEW A;  4O3Y A;  2G78 A;  3KFI A;  2X46 A;  2FHN X;  5IRA A;  4ALB A;  3KVN A;  2IZK A;  2X4M A;  1LKE A;  1SLF B;  2X55 A;  1PM1 X;  2X45 A;  1KFF A;  2YG2 A;  1CBI A;  1SWJ A;  3ELZ A;  3K3L A;  1P6P A;  4IB6 A;  3P02 A;  2RCQ A;  1EQD A;  1N9Y A;  1A57 A;  4O4U A;  3TZS A;  3STK A;  2FS6 A;  2RTG B;  4MVI A;  1SRE A;  2IZL B;  3P6G A;  4QGX A;  1IJ8 A;  4ALO A;  2ACO A;  3WJE A;  4CK4 A;  4YH0 A;  3FR5 A;  1VYF A;  4FGI B;  3HTY A;  2C1S A;  4JGL A;  1X8P A;  4OKA A;  4CDF A;  2VDF A;  4GZV A;  3TGC A;  1KXO A;  3EYC A;  4MVK A;  1SWU A;  1KOI A;  3NAD A;  4WBK A;  1JYD A;  3WJC A;  3OD9 A;  1AB0 A;  5H8T A;  3CKF A;  5EPQ A;  1OPB A;  2GJ5 A;  3APX A;  5FQ7 E;  4BGF A;  4RUU A;  5K67 A;  1ADL A;  3L4R A;  3UEX A;  3VU1 A;  4NV8 A;  3FEL A;  4R0B A;  3T1D A;  2OZQ A;  4GGT A;  1LDQ A;  1MX7 A;  4IMN A;  4YKM A;  4GET A;  1BBP A;  3E3C A;  1B4M A;  1I04 A;  4Z27 A;  4XMG A;  3EBK A;  5DPQ A;  2I5Z O;  2PI3 O;  3FR2 A;  5F1E A;  3VG6 A;  4Z2P A;  1SRH A;  2KTD A;  4OEL A;  5H9N A;  1KT5 A;  5HAE A;  4L3R A;  1DF8 A;  1NQN A;  3GAQ A;  1SWN A;  1KT3 A;  1UZ2 X;  2FHL A;  2AT5 X;  3APU A;  1KT7 A;  1RXH A;  3SLO A;  3T2W A;  3ZW1 B;  4BOE A;  2P8G A;  1IW2 A;  4EQA C;  1FEM A;  3RZY A;  4GUZ A;  1DF3 A;  1SY3 A;  4HPA A;  1T8V A;  2LBV A;  5LKE A;  4CPF A;  1X8U A;  4O4S A;  1YWC A;  3AEH A;  3BY0 A;  4MEE A;  4Z6J A;  5KIC A;  1A3Y A;  3MG5 A;  3VG2 A;  1NDJ A;  3DTQ A;  4YMY A;  1ZNL A;  3FDC A;  3IA8 A;  1DC9 A;  4O4X A;  3NBX X;  5EDC A;  1SY2 A;  3D97 A;  4YFP A;  4LQZ A;  1JMZ A;  3HWD A;  5LJD A;  4YCE A;  5DG4 A;  4EXZ A;  3NR3 A;  1RST B;  1X89 A;  4ODD A;  5CYB A;  4BX6 A;  5HZ8 A;  1E02 A;  3KZA A;  4ID2 A;  3RDQ A;  1SMP I;  2POA A;  3WJB A;  4B55 A;  1I78 A;  3WZO A;  1VWR B;  3WOV A;  3BRN A;  1LPJ A;  1SWR A;  1OPA A;  2ZAG A;  2AL0 X;  3WYP A;  2QO6 A;  3VG7 A;  1HY2 A;  1BSQ A;  4IAB A;  1X8O A;  2RTK A;  3TGB A;  1STP A;  2M4L A;  2VFC A;  3C76 X;  3FW4 A;  1FDQ A;  4WFU A;  3MVF A;  1IFB A;  5JD2 A;  2BC3 A;  4HPC A;  2FRS A;  1BSY A;  4NLI A;  4KII A;  3EC5 A;  1FE3 A;  1DZK A;  2L68 A;  2FR3 A;  1HXZ A;  2QM9 A;  2Q2P A;  3WZP A;  4YCH A;  5IXG A;  5FQ6 E;  1SWL A;  4LKP A;  1AVD A;  4GDZ A;  1Y0G A;  4O49 A;  4IBA A;  2BLG A;  5B10 O;  1DFV A;  1N7Y A;  1SXU A;  1PMP A;  1MM9 A;  2ANS A;  1KL5 A;  1QY2 A;  2IZJ A;  2JU7 A;  1FJ1 E;  1B0O A;  3MM0 A;  3JQO A;  3S26 A;  3UEW A;  2HYS A;  4QNI A;  2L5P A;  1A18 A;  4U9C A;  2OY5 O;  3P24 A;  3RBY A;  5HA1 A;  3O22 A;  4AYH A;  3CBC A;  1AEL A;  1KL4 A;  5HZ9 A;  1LDO A;  3OE3 A;  1HN2 A;  4HPD A;  3SZH A;  1HBQ A;  4I6S A;  2ACP X;  1DZP A;  3FID A;  1E5P A;  3NPO A;  1IKJ A;  3T2X A;  3FA8 A;  4ZHD A;  2Z4I A;  3B2I A;  3F6Z B;  1VWP B;  3FEP A;  4GJV A;  4NYR A;  5EDB A;  4N7C A;  4CDE A;  2Y32 A;  1EPA A;  1ICN A;  4K19 A;  4Z2O A;  1GM6 A;  1ZNK A;  3BU9 A;  4I95 A;  4Z28 A;  3TF6 A;  1EIO A;  1VWQ B;  4TKB A;  1TOW A;  1STS B;  1NBX A;  3CQR A;  1D2U A;  4IMO A;  3TGA A;  1Y9L A;  3JS1 A;  5HCC C;  1KQX A;  2F73 A;  5HCD C;  3CBS A;  4COT A;  1FEN A;  3AKM A;  4I3D A;  3WJD A;  2DM5 A;  3CMP A;  5LJC A;  2QOM A;  3PQU A;  1VWN B;  3RE6 A;  2HMB A;  1VWE B;  2JN3 A;  3FEN A;  3P6E A;  1K3B A;  5CSE A;  4ZGU A;  4BX6 B;  1G74 A;  2OVD A;  5B29 A;  5IRW A;  1SWF A;  1RLB E;  1VWK B;  1ACD A;  1S44 A;  1Y52 X;  2QO4 A;  2UYW A;  3FR4 A;  3D96 A;  1WBI A;  4INN A;  2CM9 A;  2DJF A;  4LZU A;  1QY1 A;  1ICM A;  1QG5 A;  3VE1 A;  2X34 A;  2GTF X;  3HPE A;  1EII A;  1HQQ A;  4YVB A;  1CRB A;  2Y3F A;  4ZR2 A;  2RCT A;  2KD2 A;  5BYP A;  4ARH A;  1SWE A;  1URE A;  1NP1 A;  4XME A;  2R73 A;  2WQ9 A;  3BLG A;  1DV9 A;  1OBP A;  2RTJ A;  4DCB A;  1ALB A;  1NC9 A;  1SY0 A;  1SWA A;  2QO5 A;  2X8F A;  5LJK A;  4TKJ A;  1ERX A;  5B27 A;  3B2H A;  1G7N A;  4O9S A;  1GT4 A;  1LIC A;  1SWP A;  2WSJ A;  2DJG A;  1VWG B;  3ZUI A;  5L8N A;  2NNE A;  4CV7 A;  1SRJ A;  4MVL A;  1E06 A;  1N43 A;  2IZF B;  1LCZ A;  3BX7 A;  3IFB A;  1EUO A;  1PBY A;  1T0V A;  1SWQ A;  2OF9 A;  4YKO A;  3KFG A;  5H9L A;  4AZP A;  1LEL A;  4YFR A;  1YP6 A;  3UAQ A;  1QY0 A;  1GKA A;  3STN A;  5B5F A;  1LNM A;  1BM5 A;  1LF7 A;  2L67 A;  2AT0 X;  4TJZ A;  2MJI A;  1X71 A;  1OSP O;  2OL6 O;  4A8Z A;  1KZX A;  3VG4 A;  1SWC A;  4FBO A;  5LJG A;  2A2U A;  5IO6 A;  2RTQ B;  2ASN X;  4ORY A;  3U03 A;  3FW5 A;  4YGH A;  3S5X A;  4PSQ A;  4QQ1 A;  2OY8 A;  3O2Y A;  2OL8 O;  1U0X A;  3FA6 A;  2AT6 X;  4I9S A;  4OS8 A;  5HWZ A;  2R74 A;  3ZUO A;  1SRF A;  2WWP A;  1LIF A;  1VYO A;  4Z2V A;  4ZCB A;  1JMX A;  3PED A;  4CPE A;  3SZJ A;  3WZQ A;  1SLE B;  2W2A A;  1LUQ A;  4HWM A;  1N4J A;  1W4T A;  1LFO A;  4NYQ A;  1PBO A;  5BVS A;  2A0A A;  4M6S A;  1SWB A;  3ELX A;  2WPU A;  2RTP B;  1BEB A;  4GRJ A;  4UU3 A;  2G79 A;  4GU8 A;  5H9K A;  2OY1 O;  5JR8 A;  4BQU A;  1VWB B;  2HLV A;  4ORU A;  1HQP A;  1SWS A;  2ZAI A;  3EBW A;  1SWK A;  4U8U N;  3VPJ E;  4KC8 A;  4OMX A;  1VWF B;  4U3Q A;  3U0D A;  2BS6 A;  1ML7 A;  1I9H A;  3DSZ A;  3B2L A;  2FLJ A;  4EEJ A;  1BRP A;  2RTE B;  2FR2 A;  2JGS A;  4ZJ0 A;  1VWO B;  5HZ5 A;  1BWY A;  4ORW A;  2A5B A;  1G85 A;  2KW1 A;  4XMD A;  3VGW A;  4Y0R A;  4ZHF A;  4MVE A;  2CAM A;  2GC9 A;  2K62 A;  3NQK A;  4FBV A;  4D6B A;  4RUN A;  4WFV A;  4ZFX A;  2X8T A;  3HOL A;  4U8U M;  5AEO A;  1MVG A;  4HFO A;  2AKQ A;  4L1N A;  1YIV A;  2GTL N;  1Y55 X;  4NW4 A;  2JMB A;  3HWG A;  1VWA B;  2IFB A;  1HMT A;  3HWE A;  1G5W A;  3Q6L A;  3QKG A;  2I5V O;  3BDR A;  1JJU A;  3APV A;  4ZGF A;  2CBS A;  3HOE A;  1FTP A;  5H9A A;  2EU7 X;  1GKA B; 
#chains in the Genus database with same CATH homology
 2WEX A;  2PY1 A;  1JBH A;  5D8J A;  1JZU A;  5AQ6 A;  2AT3 X;  2AMM X;  1EW3 A;  3SAO A;  4OMW A;  1XKI A;  2N93 A;  3C77 X;  5IO7 A;  3RKG A;  2GTL M;  5LJH A;  2JU8 A;  2K23 A;  3KFH A;  4ZHG A;  1Z24 A;  1Y9T A;  2KTS A;  4N7D A;  3AKN A;  4NLJ A;  1AVG I;  5HBS A;  1SXW A;  3NX2 A;  3OBL A;  4M7M A;  4Y0S A;  2G7B A;  1L6M A;  3NQ3 A;  1PEE A;  5HTD A;  3BX8 A;  3CWK A;  4IB7 A;  1MDC A;  5D47 A;  1I06 A;  1RBP A;  1ZNE A;  3I17 A;  1N0S A;  1QFV A;  4ES7 A;  1B56 A;  1TVQ A;  5CE4 A;  5HZQ A;  2Z4H A;  2R56 A;  1CJ5 A;  3LHN A;  3F8A A;  3H3I A;  4ORX A;  4YDA A;  3VG5 A;  3FA7 A;  1TOU A;  1U17 A;  2CM4 A;  3APW A;  3NP1 A;  1LID A;  2NNQ A;  2A13 A;  1GGL A;  3HWF A;  4TKH A;  1CBQ A;  1KT6 A;  3JSQ A;  4ZH6 A;  3WXQ A;  1TW4 A;  2A2G A;  3NQ9 A;  1ZNH A;  1KQW A;  2LA7 A;  2Q39 A;  1BSO A;  3EM0 A;  4QZT A;  5AJC A;  5F58 A;  3WVM A;  1B8E A;  4DQ4 A;  4AZN A;  1NGL A;  1U18 A;  3EMM A;  1X8N A;  3FYF A;  4GK9 A;  3VE2 A;  1NP4 A;  4QYN A;  2QOS C;  2CBR A;  4GNW A;  2LKK A;  4TNN A;  1R0U A;  3FEK A;  4AZR A;  1H91 A;  4A60 A;  4MIS A;  1GX9 A;  4KT5 A;  4YGG A;  2O62 A;  4Y0P A;  3ZZV A;  4O3X B;  3UEU A;  1LIB A;  1JYJ A;  5F7G A;  1VYG A;  1BLR A;  5FEN A;  1S7D A;  2NP1 A;  4QGV A;  3CR6 A;  4IAX A;  1DZM A;  2NND A;  4GE1 A;  5HZ6 A;  3BS2 A;  3KFF A;  4ORR A;  4U8U O;  1D3S A;  1DZJ A;  3ZI8 A;  3P6D A;  1S2P A;  2JOZ A;  2RA6 A;  3FLL A;  1BJ7 A;  1OBU A;  3PQS A;  3N91 A;  3CQN A;  1YP7 A;  5L8O A;  1EAL A;  1I4U A;  1O8V A;  1ZND A;  1SXX A;  1X8Q A;  1EXS A;  4NNS A;  2OFR X;  3PH5 A;  4DQ3 A;  4ORS A;  5C0N A;  3WBG A;  4EDE A;  2WUT A;  2WQA E;  4LKT A;  1EPB A;  4I3C A;  2BS5 A;  5F6B A;  4AZM A;  3FA9 A;  5FQ8 E;  3ZW2 A;  1QAB E;  2GTL O;  2MWH A;  2RD7 C;  4ML7 B;  1T68 X;  1HBP A;  2HNX A;  2QMI A;  3G7X A;  3ZW0 A;  4NNT A;  3RSW A;  1VPR A;  4KH8 A;  1FEL A;  3PPT A;  2JU3 A;  1HMS A;  2FS7 A;  3BSZ E;  5EZ2 A;  1GXA A;  2MHD A;  1IIU A;  5EEE A;  5D48 A;  1A2D A;  2F09 A;  2MM3 A;  5BVQ A;  1O1U A;  1LIE A;  4BVM A;  2FT9 A;  3VG3 A;  1JIW I;  2OVS A;  1I05 A;  1OEE A;  5EED A;  4YMY A;  2CZU A;  4QZU A;  2AT8 X;  2CZT A;  2OVA A;  5LKF A;  1CBR A;  2YMS A;  2LB6 A;  4AZQ A;  1YUP A;  4AW8 A;  2Q4N A;  3FMZ A;  4KC7 A;  3V8U A;  2MO5 A;  1CBS A;  2JW1 A;  5D4A A;  3OJY C;  1GT1 A;  3LV4 A;  2FWV A;  3P6C A;  1TXL A;  3MBT A;  3SOT A;  1KT4 A;  5LJE A;  3FIQ A;  4FBR A;  1ERB A;  1ZNG A;  2RQ0 A;  4O3Z A;  3NX1 A;  5L8I A;  2ALL X;  5HTE A;  3UEV A;  4CSB A;  4YBP A;  1SXY A;  4IB8 A;  4GH7 A;  4ON1 A;  3I0A A;  2KT4 B;  1JV4 A;  2L9C A;  4GKC A;  1SY1 A;  2XKL A;  4IAW A;  4XMH A;  4XMC A;  4Y0Q A;  3PP6 A;  1GT5 A;  3ZQ3 A;  4XMF A;  4KCA A;  3U9P C;  2BHV A;  4TLJ A;  2HZR A;  4YBU A;  1QQS A;  2OFM X;  3PEC A;  4WHI A;  3P6F A;  3D95 A;  1HMR A;  3WJG A;  5AJB A;  1KZW A;  5IO5 A;  4I3B A;  3S60 A;  4PJ2 A;  5F6Z A;  2X8S A;  5K06 A;  1E00 A;  3KQ0 A;  2HZQ A;  4OS0 A;  3GE2 A;  1MX8 A;  5D45 A;  4YGZ A;  3HK1 A;  1JJX A;  1OEK A;  3O19 A;  4LZV A;  3BU1 A;  2E4J A;  3F9D A;  5HA0 A;  4I9R A;  1OBQ A;  1ZRY A;  1KGL A;  1MUP A;  4NP1 A;  4O4O A;  4HPB A;  3S5V A;  4FQB B;  1YWA A;  2FTB A;  4EFG A;  2W2B A;  3P6H A;  2BT9 A;  4YFQ A;  1GT3 A;  2RN4 A;  2WR6 A;  1O1V A;  1YWB A;  3ZWE A;  3ZW0 B;  3C78 X;  4QAE A;  4UU2 A;  2LFO A;  4YDB A;  4GNY A;  2AH7 X;  1AQB A;  2OVE A;  5LJB A;  4A1H A;  5FFH A;  4QRL A;  3RWX A;  4A1Y A;  3PH6 A;  3MX7 A;  4AZO A;  4TQ2 A;  2A3F X;  1IKE A;  4O3W A;  4D6A A;  1BRQ A;  4QYP A;  3STM X;  4QGW A;  3ZW1 A;  4ZHH A;  1QWD A;  5HCE C;  4IB9 A;  1SA8 A;  1OEJ A;  1XCA A;  3B2K A;  3B2J A;  5BVT A;  4OS3 A;  5KID A;  1JJJ A;  1IFC A;  5FAZ A;  1EI5 A;  2W2F A;  2Q2M A;  2XST A;  4MIR A;  2LBA A;  1QFT A;  1YWD A;  2Q9S A;  4ZH9 A;  1GX8 A;  3D4R A;  4ZHC A;  5KHP A;  2WEW A;  4O3Y A;  2G78 A;  3KFI A;  2X46 A;  4ALB A;  1LKE A;  1PM1 X;  2X45 A;  2YG2 A;  1CBI A;  3ELZ A;  3K3L A;  1P6P A;  4IB6 A;  3P02 A;  2RCQ A;  1EQD A;  1A57 A;  4O4U A;  3TZS A;  3STK A;  2FS6 A;  4MVI A;  3P6G A;  4QGX A;  4ALO A;  2ACO A;  3WJE A;  4CK4 A;  4YH0 A;  3FR5 A;  1VYF A;  4FGI B;  3HTY A;  4JGL A;  1X8P A;  4GZV A;  3TGC A;  1KXO A;  3EYC A;  4MVK A;  4WBK A;  1KOI A;  3NAD A;  3WJC A;  1JYD A;  3OD9 A;  1AB0 A;  5H8T A;  5EPQ A;  1OPB A;  2GJ5 A;  3APX A;  5FQ7 E;  4RUU A;  1ADL A;  3L4R A;  3UEX A;  3VU1 A;  3FEL A;  4R0B A;  3T1D A;  2OZQ A;  1MX7 A;  4IMN A;  4YKM A;  4GET A;  1BBP A;  3E3C A;  1B4M A;  1I04 A;  4XMG A;  3EBK A;  5DPQ A;  5F1E A;  3FR2 A;  3VG6 A;  2KTD A;  5H9N A;  5HAE A;  1KT5 A;  4L3R A;  3GAQ A;  1KT3 A;  1UZ2 X;  3APU A;  2AT5 X;  1KT7 A;  3ZW1 B;  4BOE A;  2P8G A;  1IW2 A;  4EQA C;  1FEM A;  3RZY A;  1DF3 A;  1SY3 A;  4HPA A;  1T8V A;  2LBV A;  5LKE A;  1X8U A;  4O4S A;  1YWC A;  3BY0 A;  5KIC A;  1A3Y A;  3VG2 A;  3DTQ A;  1ZNL A;  3IA8 A;  4O4X A;  1DC9 A;  3NBX X;  5EDC A;  1SY2 A;  3D97 A;  4YFP A;  4LQZ A;  3HWD A;  5LJD A;  4YCE A;  5DG4 A;  4EXZ A;  3NR3 A;  1X89 A;  4ODD A;  5CYB A;  5HZ8 A;  1E02 A;  3KZA A;  4ID2 A;  1SMP I;  2POA A;  3WJB A;  3WOV A;  3BRN A;  1LPJ A;  1OPA A;  2ZAG A;  2AL0 X;  2QO6 A;  3VG7 A;  1BSQ A;  4IAB A;  1X8O A;  3TGB A;  3C76 X;  2M4L A;  3FW4 A;  4WFU A;  1FDQ A;  3MVF A;  1IFB A;  4HPC A;  2FRS A;  1BSY A;  4NLI A;  4KII A;  1FE3 A;  1DZK A;  2L68 A;  2FR3 A;  2QM9 A;  2Q2P A;  4YCH A;  5FQ6 E;  4LKP A;  4GDZ A;  4O49 A;  4IBA A;  2BLG A;  1DFV A;  1SXU A;  1PMP A;  2ANS A;  2JU7 A;  3S26 A;  1QY2 A;  1B0O A;  3JQO A;  3UEW A;  2HYS A;  4QNI A;  2L5P A;  1A18 A;  4U9C A;  3P24 A;  3RBY A;  5HA1 A;  3O22 A;  4AYH A;  3CBC A;  1AEL A;  5HZ9 A;  3OE3 A;  1HN2 A;  4HPD A;  1HBQ A;  4I6S A;  2ACP X;  1DZP A;  1E5P A;  3NPO A;  1IKJ A;  3FA8 A;  4ZHD A;  2Z4I A;  3B2I A;  3F6Z B;  3FEP A;  5EDB A;  4NYR A;  4N7C A;  1EPA A;  1ICN A;  4K19 A;  1GM6 A;  1ZNK A;  3BU9 A;  4I95 A;  3TF6 A;  1EIO A;  4TKB A;  1TOW A;  3CQR A;  4IMO A;  1D2U A;  3TGA A;  1Y9L A;  3JS1 A;  1KQX A;  2F73 A;  5HCD C;  3CBS A;  4COT A;  1FEN A;  3AKM A;  4I3D A;  3WJD A;  2DM5 A;  3CMP A;  5LJC A;  3PQU A;  2HMB A;  2JN3 A;  3FEN A;  3P6E A;  4ZGU A;  1G74 A;  2OVD A;  5B29 A;  1RLB E;  1ACD A;  1S44 A;  2QO4 A;  3FR4 A;  3D96 A;  4INN A;  2CM9 A;  4LZU A;  1QY1 A;  1ICM A;  1QG5 A;  3VE1 A;  2GTF X;  1EII A;  1CRB A;  4ZR2 A;  2RCT A;  2KD2 A;  5BYP A;  4ARH A;  1URE A;  1NP1 A;  4XME A;  2R73 A;  2WQ9 A;  3BLG A;  1DV9 A;  1OBP A;  5LJK A;  1ALB A;  1SY0 A;  2QO5 A;  2X8F A;  4TKJ A;  1ERX A;  5B27 A;  3B2H A;  1G7N A;  4O9S A;  1GT4 A;  1LIC A;  2WSJ A;  3WJF A;  5L8N A;  3ZUI A;  2NNE A;  4CV7 A;  4MVL A;  1E06 A;  5HCC C;  3BX7 A;  3IFB A;  1EUO A;  1T0V A;  4YKO A;  5H9L A;  3KFG A;  4AZP A;  4YFR A;  1YP6 A;  3UAQ A;  1QY0 A;  1GKA A;  3STN A;  1LNM A;  1BM5 A;  1LF7 A;  2L67 A;  2AT0 X;  4TJZ A;  2MJI A;  1X71 A;  4A8Z A;  1KZX A;  3VG4 A;  4FBO A;  5LJG A;  2A2U A;  5IO6 A;  4ORY A;  2ASN X;  3U03 A;  3FW5 A;  4YGH A;  3S5X A;  4PSQ A;  4QQ1 A;  3O2Y A;  1U0X A;  3FA6 A;  2AT6 X;  4I9S A;  4OS8 A;  5HWZ A;  2R74 A;  3ZUO A;  2WWP A;  1LIF A;  4ZCB A;  3PED A;  4HWM A;  2W2A A;  1LFO A;  4NYQ A;  1PBO A;  5BVS A;  2A0A A;  4M6S A;  3ELX A;  1BEB A;  4GRJ A;  4UU3 A;  2G79 A;  4GU8 A;  5H9K A;  5JR8 A;  4BQU A;  4ORU A;  2HLV A;  1HQP A;  2ZAI A;  3EBW A;  4U8U N;  3VPJ E;  4KC8 A;  4OMX A;  4U3Q A;  3U0D A;  2BS6 A;  1ML7 A;  3DSZ A;  3B2L A;  2FLJ A;  4EEJ A;  1BRP A;  2FR2 A;  4ZJ0 A;  5HZ5 A;  1BWY A;  4ORW A;  1G85 A;  2KW1 A;  4XMD A;  4Y0R A;  4ZHF A;  4MVE A;  2GC9 A;  2K62 A;  3NQK A;  4D6B A;  4FBV A;  4RUN A;  4WFV A;  4ZFX A;  2X8T A;  3HOL A;  4U8U M;  5AEO A;  1MVG A;  4HFO A;  2AKQ A;  4L1N A;  1YIV A;  2GTL N;  4NW4 A;  1G5W A;  2JMB A;  3HWG A;  2IFB A;  3HWE A;  1HMT A;  3Q6L A;  3QKG A;  3BDR A;  3APV A;  4ZGF A;  2CBS A;  3HOE A;  1FTP A;  5H9A A;  2EU7 X;  1GKA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...