3ZW0A

Structure of bambl lectin from burkholderia ambifaria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
MQTAAISWGTTPSIRVYTANGNKITERCYDGSNWYTGAFNQAGDNVSATCWLSGSAVHIRVYATSGGSTTEWCWDGDGWTRGAYTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords BAMBL LECTIN
publication title Fucose-Binding Lectin from Opportunistic Pathogen Burkholderia Ambifaria Binds to Both Plant and Human Oligosaccharidic Epitopes.
pubmed doi rcsb
source organism Burkholderia ambifaria
total genus 14
structure length 87
sequence length 87
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07938 Fungal_lectin Fungal fucose-specific lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.190 Mainly Beta Beta Barrel Lipocalin Lipocalin 3zw0A01
3ZW2A 3ZW1B 2BT9A 3ZWEA 5AJCA 4I6SA 2BS6A 3ZI8A 3ZZVA 5AJBA 3ZW1A 2BS5A 3ZW0A 3ZW0B
chains in the Genus database with same CATH superfamily
1DZMA 1KL4A 1UZ2X 5B5FA 1JMXA 2GTFX 3PQUA 4ES7A 2X45A 4XMHA 3C77X 1N0SA 3PQSA 1SRIA 2R73A 2IZDB 4HPBA 1I9HA 2A5CA 4Y5DA 2OVAA 4I3BA 5DG4A 1TW4A 3SZJA 1SWDA 4YVBA 2FR2A 2RTBB 2OFBA 1CJ5A 1XCAA 1GXAA 4IMNA 3D9WA 5IO5A 1JJJA 1YWDA 5HZ8A 3NX1A 2RTJA 4EXZA 1SWCA 2JMBA 3HOEA 1VYGA 5CYBA 1NBXA 1WBIA 3SAOA 5CHKA 4HPAA 5KHPA 3O2YA 1AELA 1JJUA 1NP4A 2RCTA 2Z4IA 5IRAA 1KZXA 2GJ5A 2P8GA 2CM4A 2IZCB 2X32A 3MG5A 4JHQA 2WWPA 1YP7A 3APXA 5FQ8E 3WXQA 3ZW0B 1B56A 3N91A 1A3YA 4HWMA 5D45A 4BX7A 1ERXA 3QQ2A 1SWNA 2VFBA 1T0VA 2Q39A 4QZTA 3ZUIA 4EQAC 3P6FA 2OVEA 4QZUA 1OEEA 1QQSA 1SWFA 4CPEA 4O4OA 5LJBA 4TJZA 1YUPA 4I3DA 2LBAA 4YKOA 1RLBE 2FWVA 2HLVA 2L9CA 3JS1A 4YMYA 1VWLB 4A1YA 3CMPA 4MVLA 2HMBA 3AUMO 1CRBA 3NBXX 4FBVA 4KC7A 4O9SA 4KC8A 1OEJA 2WR6A 4QNIA 1SY2A 2L67A 2RCQA 3FW5A 2AT5X 2IZKA 4ZCBA 3K3LA 3TZSA 2KW1A 3MVFA 2I5ZO 4ARHA 1BBPA 2MWHA 1OBQA 3WOVA 3Q34A 4FGIB 2F73A 2AMMX 1OPAA 1X89A 1SWTA 1YWAA 4I3CA 4CDDA 4NP1A 2HZQA 5HWZA 1GX9A 1IFCA 4A8ZA 1DZKA 4QGXA 1OEKA 1JYDA 1LPJA 1NDJA 1JMZA 1OBUA 2IZFB 2KTDA 2RTRB 3JQOA 3WZQA 2E4JA 1I78A 3BX8A 2AKQA 2L5PA 4RUNA 2QO5A 2QMIA 4YFPA 1ERBA 3T2WA 1K3BA 3MBTA 5AJBA 4WHIA 5KIDA 4GNWA 3WJCA 4FQBB 4AYHA 2JU3A 1VWIB 3H3IA 4IBAA 4IRWA 1CBQA 2OYBO 1EI5A 4XMDA 4YDBA 2O62A 4ORRA 3SLJA 1RXHA 5LJCA 5H9NA 1ACDA 2HKDA 1UYOX 2Y3FA 1MX8A 3KFGA 4ZHFA 2Q9SA 3VE2A 5HZ5A 4NLJA 4CPFA 2Y32A 1HQPA 1U18A 2RTDB 1KT7A 2X8FA 3UEVA 4LKPA 1TOUA 2KT4B 2QOMA 5HA1A 1GT5A 1GT3A 2MM3A 2Z4HA 4OEMA 5AEOA 1SRFA 4UU3A 3WBGA 5C0NA 1EALA 3BU1A 1EPBA 2G79A 2G8CO 1I06A 3KVNA 4U9CA 3JSQA 2OF9A 1QY1A 3NR3A 2HYSA 2RTPB 2A2GA 3O22A 1AQBA 1RSTB 3AKNA 3VPJE 2ZAIA 2HNXA 4GNYA 1BEBA 4BCSA 1PBYA 1SWLA 1TOWA 4BX6B 1FTPA 4TQ2A 4GJVA 1Y9LA 2X34A 3PK2A 4IABA 1N9YA 2W2FA 2JGSA 2K62A 2JU8A 4RUUA 2R56A 5B2AO 4EDEA 1KOIA 1GX3A 2OY7A 3VU1A 5IRUA 1SWOA 4TKJA 3AEHA 2VFCA 2QM9A 4GUZA 1XKIA 2OY8A 1GX8A 2C1QA 2RTEB 2MHDA 4IMOA 4QAEA 1QABE 1N43A 4IB8A 1TVQA 1G74A 4O3ZA 1GKAA 4YCHA 1LIDA 5EEEA 3RE5A 2XSTA 1LIBA 3WJDA 1N9MA 2W2AA 1JV4A 5H9LA 3E3CA 4ML7B 4PJ2A 2QO6A 3O19A 3PH6A 1A18A 4TKHA 3KQ0A 3RDOA 4QYNA 4AZNA 2YG2A 3MM0A 2MO5A 5D4AA 4CSBA 1NQMA 4R0BA 1PTSA 3CBSA 1MK5A 1S2PA 3B2KA 4DQ3A 3S26A 1LDOA 3HWEA 1ALBA 4HFOA 2JU7A 2KTSA 4Y59A 3ZWEA 4TLJA 2I5VO 4YFQA 4GD9A 1BWYA 1FELA 2VDFA 2WQAE 1JIWI 2RTNB 1SWUA 3IA8A 4O4XA 5FQ6E 4QGVA 2DJGA 2F01A 2ZSCA 3LV4A 2A2UA 3TGAA 1PM1X 1ML7A 3P6GA 1BRQA 4ON1A 3GAQA 5F6ZA 5L8OA 1HMRA 3Q6LA 1D3SA 1JBHA 2FRSA 1FJ1E 3GE2A 4ORWA 4WBKA 2Y3EA 2JW1A 3SLOA 1E06A 4D6BA 5H8TA 1ZNHA 3HOLA 2HZRA 4BGFA 2FKJA 2BLGA 4OELA 5AQ6A 2EU7X 4XMEA 1OPBA 4GZVA 4ZH9A 3OD9A 3HWGA 1BRPA 5LJEA 1G7NA 3AKMA 3I0AA 2PI3O 3FEKA 2A5BA 2OL6O 2OZQA 2RN4A 4QGWA 5HTEA 2RTIB 1X8PA 2X8SA 1I04A 3WZPA 4ALOA 4ORXA 1CBSA 2WEXA 1IIUA 2DM5A 1EQDA 2FHLA 4GRJA 2ACOA 3SZIA 4QYPA 3WJEA 1DF8A 3BDRA 4U8UM 2X4MA 1VYOA 1BSOA 1RXJA 1EUOA 5L3YA 4GH7A 4ORUA 1L6MA 1HMTA 1SWQA 3BRNA 4Y0SA 3RDQA 4CPHA 1FE3A 1LUQA 2X56A 4U8UN 4DNEA 1KXOA 5JR8A 5LJHA 1KZWA 5L8NA 1HXLA 1E00A 1UYNX 4N7DA 4AZRA 5F58A 2AT8X 1FDQA 1W4TA 4XMFA 1KT5A 4WFUA 3HPEA 4Z28A 4BOEA 2G78A 5B5GA 1VWFB 3B2LA 1IKEA 2BC3A 2ANSA 2OL8O 3PDFA 4KH8A 3WJBA 1G85A 4MIRA 1QWDA 1VWHB 3PH5A 5AJCA 3ELXA 2NNQA 4YBUA 4YH0A 1X71A 4CK4A 1G5WA 1LDQA 1AVGI 3VGWA 1B0OA 1ZNLA 1HBPA 2FS7A 3BY0A 2A8GA 1IW2A 3CQNA 1SRGA 1N4JA 1OBPA 3APWA 4ZHDA 1A57A 2RTHB 3PEDA 1MUPA 2OVDA 4M6SA 4CPIA 2UZ2A 3ELZA 4INNA 1PMPA 5F6BA 5LJDA 3RDSA 3FR5A 3T6LA 1SRHA 3P02A 4ZH6A 3KFIA 1RAVA 2FTBA 4HPCA 2WEWA 1T68X 4I9RA 3RBYA 3NQKA 4YGHA 4EFGA 1YWBA 3EM0A 3VG6A 4GU8A 4QRLA 4OMWA 2RTQB 2LBVA 3FLLA 4LZUA 1B8EA 4GKCA 4YGZA 1GM6A 3NP1A 3ZW0A 1SY3A 4KIIA 3RY2A 4A60A 3FMZA 1YIVA 2FT9A 4O3WA 2AH7X 5BVTA 2BS5A 1SRJA 2RTGB 3F9DA 2IZBA 2IZGB 1VWMB 4I60A 5K67A 3U03A 3CR6A 4GJSA 1S44A 4MVKA 3L4RA 1EPAA 4NV8A 4JGLA 1ZNEA 3RDUA 5B10O 3TF6A 4ZHHA 2M4LA 3NADA 4KT5A 2BSZA 5K06A 1Z24A 3KFHA 5IRWA 4EKVA 5HCEC 5CSEA 1BJ7A 1FEMA 1SA8A 1VWDB 4NYRA 4BX5B 4GGRA 1HBQA 2G5LA 1LF7A 2Q2PA 4MVEA 1LCWA 1MVGA 1MDCA 3VE1A 3TGBA 2L68A 3P24A 3WZOA 1BSQA 4BQUA 2IZAA 2K23A 5BYPA 4YFRA 1P6PA 2YMSA 1MEPA 1W5RA 1QFTA 2RD7C 2PY1A 4QQ1A 4IB6A 2JN3A 5HZQA 4CV7A 3STKA 1AVDA 1KFFA 2AL0X 2GC9A 2GTLM 5FAZA 5IO7A 3VG7A 1VWOB 4OS3A 3EYCA 2FHNX 2OF8A 5EDBA 1QFVA 4IAWA 2GTLN 3OBLA 1EXSA 1VWRB 4IB9A 1U0XA 1SWGA 2OL7A 3FR4A 1VWJB 4AW8A 1BM5A 2LA7A 1SWBA 4Y0QA 4WFVA 1GT4A 1SWKA 5D8JA 5LJKA 5HBSA 2ACPX 3KZAA 4Y0RA 1SLDB 3APUA 5K68A 4D6AA 2QO4A 4M7MA 1PEEA 4COTA 5L8IA 4NLIA 1A2DA 2OFRX 4MISA 3B2IA 1NC9A 4XMGA 4AZQA 1LCVA 4CDCA 3ZUOA 5CE4A 1RSUB 2W2BA 3PECA 4YBPA 5H9KA 3EMMA 4Z6JA 1HQQA 4B55A 1RBPA 4CDEA 2MJIA 1UREA 3UEWA 4ZGUA 3FYFA 3P6EA 1O1VA 2BS6A 5FFHA 3CKFA 1U17A 5DPQA 1FENA 1ADLA 1Y55X 4ORSA 5B29A 1O1UA 1STSB 2FR3A 2UYWA 4GDAA 3FIQA 4OMXA 3CKGA 1SXUA 3EW1A 4CDFA 1GGLA 3EBWA 1NQNA 4U46A 1W6FA 3C76X 1CBIA 1OSPO 4BX6A 1VWEB 3C78X 3EBKA 5EEDA 5B3MO 5HZ6A 5HZ9A 2CM9A 3WVMA 4BX7B 4JNJA 4O49A 2LFOA 1NGLA 2A0AA 1KT6A 1MX7A 2CZTA 1SWSA 4MVIA 4ALBA 2KD2A 5EPQA 4GDZA 3V8UA 3CBCA 4Z2OA 4ZR2A 4Z2VA 4FBOA 2CZUA 4PSQA 4YGGA 3RKGA 3FEPA 1E5PA 3FA8A 4OS0A 2RQ0A 1Y9TA 1DV9A 1LKEA 4NNTA 3ZI8A 1I05A 2AF5A 2N93A 3FENA 2MF6A 1SWPA 1ZNKA 3BS2A 4KCAA 5B27A 1TXLA 3VG5A 3RY1A 3VHHA 3DTQA 4AZPA 2Q4NA 3VG2A 1KQWA 2NNEA 4L1NA 1SXYA 3ZZVA 4AZMA 1O8VA 4IAXA 1VPRA 1S7DA 2A3FX 1KT4A 1VWNB 1JQPA 1RXKA 1DFVA 2IZJA 1ICNA 2CBSA 4LKTA 1KGLA 1LIFA 2IFBA 2RTFB 1SMPI 3FA9A 4GGZA 2NP1A 2IZLB 4C5PA 2FS6A 3WJFA 1KL5A 1STRB 2OY1O 3VHMA 4Z27A 3I17A 1LCZA 2ZAGA 3HWFA 3LHNA 4ID2A 4GETA 2G7BA 4OKAA 4NW4A 2JOZA 4K19A 4NV7A 3RZYA 1JZUA 1ZRYA 3T1DA 2POAA 2LB6A 2FLJA 3DSZA 3FA7A 3FDCA 3ZW2A 1VWCB 1X8QA 1SWRA 3FA6A 3WJGA 1HXZA 1SWAA 3U0DA 1EIIA 3NX2A 3T6FA 3EW2A 5BVQA 4U8UO 2CAMA 3UEXA 5HTDA 2CBRA 3F8AA 3VHIA 2A13A 1VWAB 3BSZE 4YCEA 5F2BA 2QCBA 1T8VA 5FQ7E 4GGTA 1YP6A 2X55A 5HAEA 3TGCA 1VWBB 1AVEA 1X8UA 1BLRA 1SXWA 4ODDA 1JJXA 2OVSA 3T2XA 2FGSA 3BX7A 3HK1A 1MM9A 3NQ9A 4O3XB 5IO6A 3RWXA 2AT6X 4GK9A 3SOTA 1IJ8A 4ORYA 1VWQB 5FENA 3P6HA 1K24A 2AT0X 1NP1A 4O4UA 1Y0GA 3FR2A 2X8TA 2RTMA 1LNMA 4IB7A 2OFAA 4BBOA 1SLGB 4I9SA 4NNSA 1VYFA 2ALLX 2WSJA 2IZEB 1VWPB 3HTYA 3PP6A 5D47A 3FELA 3P6CA 5EDCA 4HPDA 3ZW1B 1KL3A 3STMX 3SZHA 2RTLA 1ZNDA 3FW4A 2X46A 4TNNA 1LFOA 1LIEA 4MEEA 3RDXA 2AT3X 4ZHCA 1I4UA 1KT3A 1LICA 1SWHA 2DJFA 5F1EA 4A1HA 3APVA 1GKAB 3S5XA 3D96A 3STNA 1SWEA 4ZHGA 3BLGA 3NQ3A 3VG3A 1JYJA 1ZNGA 3WYPA 1LELA 1QG5A 3SLTA 3EC5A 2RA6A 3LTWA 3FIDA 3OJYC 1MOYA 5F7GA 1VWGB 1D2UA 5BVSA 5JD2A 3S60A 1B4MA 1H91A 4YDAA 3MX7A 2Q2MA 4O4SA 4TKBA 4YKMA 3S5VA 1HN2A 1Y53X 3ZQ3A 4BJ8A 4UU2A 3BU9A 3RDMA 1Y52X 1STPA 3RE6A 1WUBA 5B11O 1CBRA 1DC9A 4LZVA 4DQ4A 1AB0A 2R74A 3B2HA 2WQ9A 5HCCC 2RTKA 2BT9A 3D95A 2C1SA 1VWKB 3D4RA 4Z2PA 4AZOA 2IZHB 5LJGA 2FKGA 3X00A 3IFBA 3UEUA 5IXGA 3G7XA 5H9AA 3D97A 1SWJA 1KQXA 3U9PC 4U3QA 4FBRA 4I6SA 3P6DA 2WPUA 1DZPA 2GH7A 3HWDA 1DF3A 4GE1A 3ZW1A 2ASNX 4O3YA 4ZGFA 1HMSA 3CWKA 2GTLO 4NYQA 1R0UA 2RTOB 5D48A 1E02A 5KICA 5LKEA 1PBOA 3RSWA 1BSYA 3F6ZB 2OY5O 4OS8A 4ZJ0A 1EIOA 1IKJA 4BVMA 3WZNA 1DZJA 1EW3A 2RTAA 2QOSC 2F09A 3NPOA 1IFBA 1SLEB 3QKGA 4BX5A 1E2TA 2XKLA 2IZIA 2WUTA 1SREA 2C4IA 3B2JA 3UAQA 2OFMX 4JO6A 5HA0A 3OE3A 1SY0A 1QY0A 1SLFB 1X8NA 1SY1A 4CPHB 5HCDC 1X8OA 4N7CA 2NNDA 1YWCA 4L3RA 2LKKA 3KFFA 2BHVA 3VG4A 4ZFXA 1HY2A 3CQRA 3WYQA 1ICMA 4DCBA 4EEJA 1QY2A 3PPTA 4XMCA 1SXXA 1GT1A 4I95A 2AVIA 5LKFA 5EZ2A 2RTCB 4LQZA 4Y0PA 1N7YA
chains in the Genus database with same CATH topology
1DZMA 1UZ2X 2GTFX 3PQUA 4ES7A 2X45A 4XMHA 3C77X 1N0SA 3PQSA 2R73A 4HPBA 2OVAA 4I3BA 5DG4A 1TW4A 2FR2A 1CJ5A 1XCAA 1GXAA 4IMNA 5IO5A 1JJJA 1YWDA 5HZ8A 3NX1A 4EXZA 2JMBA 3HOEA 5CYBA 1VYGA 3SAOA 1AELA 4HPAA 5KHPA 3O2YA 1NP4A 2Z4IA 2RCTA 1KZXA 2GJ5A 2P8GA 2CM4A 5FQ8E 2WWPA 1YP7A 3APXA 3WXQA 3ZW0B 1B56A 3N91A 1A3YA 4HWMA 5D45A 1ERXA 1T0VA 2Q39A 4QZTA 3ZUIA 4EQAC 3P6FA 2OVEA 4QZUA 1OEEA 1QQSA 5LJBA 4O4OA 4TJZA 1YUPA 4I3DA 2LBAA 4YKOA 1RLBE 2FWVA 2HLVA 2L9CA 3JS1A 4YMYA 4A1YA 3CMPA 4MVLA 2HMBA 1CRBA 3NBXX 4FBVA 4KC7A 4O9SA 4KC8A 1OEJA 2WR6A 4QNIA 1SY2A 2L67A 2RCQA 3FW5A 2AT5X 4ZCBA 3K3LA 3TZSA 2KW1A 3MVFA 4ARHA 1BBPA 2MWHA 1OBQA 3WOVA 4FGIB 2F73A 2AMMX 1OPAA 1X89A 1YWAA 4I3CA 4NP1A 2HZQA 5HWZA 1GX9A 1IFCA 4A8ZA 1DZKA 4QGXA 1OEKA 1JYDA 1LPJA 1OBUA 2KTDA 3JQOA 2E4JA 3BX8A 2AKQA 2L5PA 4RUNA 2QO5A 2QMIA 4YFPA 1ERBA 3MBTA 5AJBA 4WHIA 5KIDA 4GNWA 3WJCA 4FQBB 4AYHA 2JU3A 3H3IA 4IBAA 1CBQA 1EI5A 4XMDA 4YDBA 2O62A 4ORRA 5LJCA 5H9NA 1ACDA 1MX8A 3KFGA 4ZHFA 2Q9SA 3VE2A 5HZ5A 4NLJA 1HQPA 1U18A 2X8FA 1KT7A 3UEVA 4LKPA 1TOUA 2KT4B 5HA1A 1GT5A 1GT3A 2MM3A 2Z4HA 5AEOA 4UU3A 3WBGA 5C0NA 1EALA 3BU1A 1EPBA 2G79A 4U9CA 1I06A 3JSQA 1QY1A 3NR3A 2HYSA 2A2GA 3O22A 1AQBA 3AKNA 3VPJE 1JBHA 2ZAIA 2HNXA 4GNYA 1BEBA 1TOWA 1FTPA 4TQ2A 1Y9LA 4IABA 2W2FA 2K62A 2JU8A 4RUUA 2R56A 4EDEA 1KOIA 3VU1A 4TKJA 2QM9A 1XKIA 1GX8A 2MHDA 4IMOA 4QAEA 1QABE 5EEEA 4IB8A 1TVQA 1G74A 4O3ZA 1GKAA 4YCHA 1LIDA 3VG5A 2XSTA 1LIBA 3WJDA 2W2AA 1JV4A 5H9LA 3E3CA 4ML7B 4PJ2A 2QO6A 3O19A 3PH6A 1A18A 4TKHA 3KQ0A 4QYNA 4AZNA 2YG2A 2MO5A 5D4AA 4CSBA 4R0BA 3CBSA 4DQ3A 1S2PA 3B2KA 3S26A 3HWEA 1ALBA 4HFOA 2JU7A 2KTSA 3ZWEA 4TLJA 4YFQA 1BWYA 1FELA 2WQAE 1JIWI 4O4XA 3IA8A 5FQ6E 4QGVA 3LV4A 2A2UA 3TGAA 1PM1X 1ML7A 3P6GA 1BRQA 4ON1A 3GAQA 5F6ZA 5L8OA 1HMRA 3Q6LA 1D3SA 2FRSA 4ORWA 3GE2A 4WBKA 2JW1A 1E06A 4D6BA 5H8TA 1ZNHA 3HOLA 2HZRA 2BLGA 5AQ6A 2EU7X 4XMEA 1OPBA 4GZVA 4ZH9A 3OD9A 3HWGA 1BRPA 5LJEA 1G7NA 3AKMA 3I0AA 3FEKA 2OZQA 2RN4A 4QGWA 5HTEA 2X8SA 1X8PA 4ALOA 1I04A 4ORXA 1CBSA 2WEXA 1IIUA 2DM5A 1EQDA 4GRJA 2ACOA 4QYPA 3WJEA 3BDRA 4U8UM 1BSOA 1EUOA 4GH7A 4ORUA 1L6MA 1HMTA 4Y0SA 3BRNA 5JR8A 1FE3A 4U8UN 5LJHA 1KXOA 1KZWA 5L8NA 1E00A 4N7DA 4AZRA 5F58A 2AT8X 1FDQA 4XMFA 1KT5A 4WFUA 4BOEA 2G78A 3B2LA 1IKEA 2ANSA 4KH8A 3WJBA 1G85A 4MIRA 1QWDA 3PH5A 5AJCA 3ELXA 2NNQA 4YBUA 4YH0A 1X71A 4CK4A 1G5WA 1AVGI 1B0OA 1ZNLA 1HBPA 2FS7A 3BY0A 1IW2A 3CQNA 3APWA 1OBPA 1A57A 4ZHDA 3PEDA 1MUPA 2OVDA 4M6SA 3ELZA 4INNA 1PMPA 5F6BA 5LJDA 3FR5A 3P02A 4ZH6A 3KFIA 2FTBA 4HPCA 2WEWA 1T68X 4I9RA 3RBYA 3NQKA 4YGHA 4EFGA 1YWBA 3EM0A 3VG6A 4GU8A 4QRLA 4OMWA 2LBVA 3FLLA 4LZUA 1B8EA 4GKCA 4YGZA 1GM6A 3NP1A 3ZW0A 1SY3A 4KIIA 4A60A 3FMZA 1YIVA 2FT9A 4O3WA 2AH7X 5BVTA 2BS5A 3F9DA 3U03A 3CR6A 1S44A 4MVKA 3L4RA 1EPAA 4JGLA 1ZNEA 3TF6A 4ZHHA 2M4LA 3NADA 4KT5A 5K06A 1Z24A 3KFHA 5HCEC 1BJ7A 1FEMA 1SA8A 4NYRA 1HBQA 1LF7A 2Q2PA 4MVEA 1MVGA 1MDCA 3VE1A 3TGBA 2L68A 3P24A 1BSQA 4BQUA 2K23A 5BYPA 4YFRA 1P6PA 2YMSA 1QFTA 2RD7C 2PY1A 4QQ1A 4IB6A 2JN3A 5HZQA 4CV7A 3STKA 5IO7A 2AL0X 2GC9A 2GTLM 5FAZA 3VG7A 4OS3A 3EYCA 5EDBA 1QFVA 4IAWA 2GTLN 3OBLA 1EXSA 4IB9A 1U0XA 4AW8A 3FR4A 1BM5A 2LA7A 4Y0QA 4WFVA 1GT4A 5D8JA 5LJKA 5HBSA 2ACPX 3KZAA 4Y0RA 3APUA 4D6AA 2QO4A 4M7MA 1PEEA 4COTA 5L8IA 4NLIA 1A2DA 2OFRX 4MISA 3B2IA 4XMGA 4AZQA 3ZUOA 5CE4A 3PECA 2W2BA 4YBPA 5H9KA 3EMMA 1RBPA 2MJIA 1UREA 3UEWA 4ZGUA 3FYFA 3P6EA 1O1VA 2BS6A 5FFHA 1U17A 5DPQA 1FENA 1ADLA 4ORSA 5B29A 1O1UA 2FR3A 3FIQA 4OMXA 1SXUA 1GGLA 3EBWA 3C76X 1CBIA 5HZ6A 3C78X 3EBKA 5EEDA 5HZ9A 2CM9A 3WVMA 4O49A 2LFOA 1NGLA 2A0AA 1KT6A 1MX7A 2CZTA 4MVIA 4ALBA 2KD2A 5EPQA 4GDZA 3V8UA 3CBCA 4ZR2A 4FBOA 2CZUA 4PSQA 4YGGA 3RKGA 3FEPA 1E5PA 3FA8A 4OS0A 2RQ0A 1Y9TA 1DV9A 1LKEA 4NNTA 3ZI8A 1I05A 2N93A 3FENA 1ZNKA 3BS2A 4KCAA 5B27A 1TXLA 4AZPA 3DTQA 2Q4NA 3VG2A 1KQWA 2NNEA 4L1NA 1SXYA 3ZZVA 4AZMA 1O8VA 4IAXA 1VPRA 1S7DA 2A3FX 1KT4A 3ZQ3A 1DFVA 4LKTA 1ICNA 2CBSA 1KGLA 1LIFA 2IFBA 1SMPI 3FA9A 2NP1A 2FS6A 3WJFA 3I17A 2ZAGA 3HWFA 3LHNA 4ID2A 4GETA 2G7BA 3RZYA 4NW4A 2JOZA 4K19A 1JZUA 1ZRYA 3T1DA 2POAA 2LB6A 2FLJA 3DSZA 3FA7A 3ZW2A 3U0DA 1X8QA 3WJGA 3FA6A 1EIIA 3NX2A 5BVQA 4U8UO 3UEXA 5HTDA 2CBRA 3F8AA 2A13A 3BSZE 4YCEA 1T8VA 5FQ7E 1YP6A 5HAEA 3TGCA 1X8UA 1BLRA 1SXWA 4ODDA 1JJXA 2OVSA 3BX7A 3HK1A 4O3XB 3NQ9A 5IO6A 3RWXA 2AT6X 4GK9A 3SOTA 4ORYA 5FENA 3P6HA 2AT0X 1NP1A 4O4UA 3FR2A 2X8TA 1LNMA 4IB7A 4I9SA 4NNSA 1VYFA 2ALLX 2WSJA 3HTYA 3PP6A 5D47A 3FELA 3P6CA 5EDCA 4HPDA 3ZW1B 3STMX 1ZNDA 3FW4A 2X46A 4TNNA 1LFOA 1LIEA 2AT3X 4ZHCA 1I4UA 1KT3A 1LICA 5F1EA 4A1HA 3APVA 1GKAB 3S5XA 3D96A 3STNA 4ZHGA 3BLGA 3NQ3A 3VG3A 1JYJA 1ZNGA 1QG5A 2RA6A 3OJYC 5F7GA 1D2UA 5BVSA 3S60A 1B4MA 1H91A 4YDAA 3MX7A 2Q2MA 4O4SA 4TKBA 4YKMA 3S5VA 1HN2A 4UU2A 3BU9A 1CBRA 1DC9A 4LZVA 4DQ4A 1AB0A 2R74A 3B2HA 2WQ9A 5HCCC 2BT9A 3D95A 3D4RA 4AZOA 5LJGA 3IFBA 3UEUA 3G7XA 5H9AA 3D97A 1KQXA 3U9PC 4U3QA 4FBRA 4I6SA 3P6DA 3HWDA 1DZPA 1DF3A 4GE1A 3ZW1A 2ASNX 4O3YA 4ZGFA 1HMSA 3CWKA 2GTLO 4NYQA 1R0UA 5D48A 1E02A 5KICA 5LKEA 1PBOA 3RSWA 1BSYA 3F6ZB 4ZJ0A 4OS8A 1EIOA 1IKJA 4BVMA 1DZJA 1EW3A 2QOSC 2F09A 3NPOA 1IFBA 3QKGA 2XKLA 2WUTA 3UAQA 3B2JA 2OFMX 5HA0A 3OE3A 1SY0A 1QY0A 1X8NA 1SY1A 5HCDC 1X8OA 4N7CA 2NNDA 1YWCA 4L3RA 2LKKA 3KFFA 2BHVA 3VG4A 4ZFXA 3CQRA 1ICMA 4EEJA 1QY2A 3PPTA 4XMCA 1SXXA 1GT1A 4I95A 5LKFA 5EZ2A 4LQZA 4Y0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZW2 A;  3ZW1 B;  2BT9 A;  3ZWE A;  5AJC A;  4I6S A;  2BS6 A;  3ZI8 A;  3ZZV A;  5AJB A;  3ZW1 A;  2BS5 A;  3ZW0 A;  3ZW0 B; 
#chains in the Genus database with same CATH topology
 1DZM A;  1KL4 A;  1UZ2 X;  5B5F A;  1JMX A;  2GTF X;  3PQU A;  4ES7 A;  2X45 A;  4XMH A;  3C77 X;  1N0S A;  3PQS A;  1SRI A;  2R73 A;  2IZD B;  4HPB A;  1I9H A;  2A5C A;  4Y5D A;  2OVA A;  4I3B A;  5DG4 A;  1TW4 A;  3SZJ A;  1SWD A;  4YVB A;  2FR2 A;  2RTB B;  2OFB A;  1CJ5 A;  1XCA A;  1GXA A;  4IMN A;  3D9W A;  5IO5 A;  1JJJ A;  1YWD A;  5HZ8 A;  3NX1 A;  2RTJ A;  4EXZ A;  1SWC A;  2JMB A;  3HOE A;  1VYG A;  5CYB A;  1NBX A;  1WBI A;  3SAO A;  5CHK A;  4HPA A;  5KHP A;  3O2Y A;  1AEL A;  1JJU A;  1NP4 A;  2RCT A;  2Z4I A;  5IRA A;  1KZX A;  2GJ5 A;  2P8G A;  2CM4 A;  2IZC B;  2X32 A;  3MG5 A;  4JHQ A;  2WWP A;  1YP7 A;  3APX A;  5FQ8 E;  3WXQ A;  3ZW0 B;  1B56 A;  3N91 A;  1A3Y A;  4HWM A;  5D45 A;  4BX7 A;  1ERX A;  3QQ2 A;  1SWN A;  2VFB A;  1T0V A;  2Q39 A;  4QZT A;  3ZUI A;  4EQA C;  3P6F A;  2OVE A;  4QZU A;  1OEE A;  1QQS A;  1SWF A;  4CPE A;  4O4O A;  5LJB A;  4TJZ A;  1YUP A;  4I3D A;  2LBA A;  4YKO A;  1RLB E;  2FWV A;  2HLV A;  2L9C A;  3JS1 A;  4YMY A;  1VWL B;  4A1Y A;  3CMP A;  4MVL A;  2HMB A;  3AUM O;  1CRB A;  3NBX X;  4FBV A;  4KC7 A;  4O9S A;  4KC8 A;  1OEJ A;  2WR6 A;  4QNI A;  1SY2 A;  2L67 A;  2RCQ A;  3FW5 A;  2AT5 X;  2IZK A;  4ZCB A;  3K3L A;  3TZS A;  2KW1 A;  3MVF A;  2I5Z O;  4ARH A;  1BBP A;  2MWH A;  1OBQ A;  3WOV A;  3Q34 A;  4FGI B;  2F73 A;  2AMM X;  1OPA A;  1X89 A;  1SWT A;  1YWA A;  4I3C A;  4CDD A;  4NP1 A;  2HZQ A;  5HWZ A;  1GX9 A;  1IFC A;  4A8Z A;  1DZK A;  4QGX A;  1OEK A;  1JYD A;  1LPJ A;  1NDJ A;  1JMZ A;  1OBU A;  2IZF B;  2KTD A;  2RTR B;  3JQO A;  3WZQ A;  2E4J A;  1I78 A;  3BX8 A;  2AKQ A;  2L5P A;  4RUN A;  2QO5 A;  2QMI A;  4YFP A;  1ERB A;  3T2W A;  1K3B A;  3MBT A;  5AJB A;  4WHI A;  5KID A;  4GNW A;  3WJC A;  4FQB B;  4AYH A;  2JU3 A;  1VWI B;  3H3I A;  4IBA A;  4IRW A;  1CBQ A;  2OYB O;  1EI5 A;  4XMD A;  4YDB A;  2O62 A;  4ORR A;  3SLJ A;  1RXH A;  5LJC A;  5H9N A;  1ACD A;  2HKD A;  1UYO X;  2Y3F A;  1MX8 A;  3KFG A;  4ZHF A;  2Q9S A;  3VE2 A;  5HZ5 A;  4NLJ A;  4CPF A;  2Y32 A;  1HQP A;  1U18 A;  2RTD B;  1KT7 A;  2X8F A;  3UEV A;  4LKP A;  1TOU A;  2KT4 B;  2QOM A;  5HA1 A;  1GT5 A;  1GT3 A;  2MM3 A;  2Z4H A;  4OEM A;  5AEO A;  1SRF A;  4UU3 A;  3WBG A;  5C0N A;  1EAL A;  3BU1 A;  1EPB A;  2G79 A;  2G8C O;  1I06 A;  3KVN A;  4U9C A;  3JSQ A;  2OF9 A;  1QY1 A;  3NR3 A;  2HYS A;  2RTP B;  2A2G A;  3O22 A;  1AQB A;  1RST B;  3AKN A;  3VPJ E;  2ZAI A;  2HNX A;  4GNY A;  1BEB A;  4BCS A;  1PBY A;  1SWL A;  1TOW A;  4BX6 B;  1FTP A;  4TQ2 A;  4GJV A;  1Y9L A;  2X34 A;  3PK2 A;  4IAB A;  1N9Y A;  2W2F A;  2JGS A;  2K62 A;  2JU8 A;  4RUU A;  2R56 A;  5B2A O;  4EDE A;  1KOI A;  1GX3 A;  2OY7 A;  3VU1 A;  5IRU A;  1SWO A;  4TKJ A;  3AEH A;  2VFC A;  2QM9 A;  4GUZ A;  1XKI A;  2OY8 A;  1GX8 A;  2C1Q A;  2RTE B;  2MHD A;  4IMO A;  4QAE A;  1QAB E;  1N43 A;  4IB8 A;  1TVQ A;  1G74 A;  4O3Z A;  1GKA A;  4YCH A;  1LID A;  5EEE A;  3RE5 A;  2XST A;  1LIB A;  3WJD A;  1N9M A;  2W2A A;  1JV4 A;  5H9L A;  3E3C A;  4ML7 B;  4PJ2 A;  2QO6 A;  3O19 A;  3PH6 A;  1A18 A;  4TKH A;  3KQ0 A;  3RDO A;  4QYN A;  4AZN A;  2YG2 A;  3MM0 A;  2MO5 A;  5D4A A;  4CSB A;  1NQM A;  4R0B A;  1PTS A;  3CBS A;  1MK5 A;  1S2P A;  3B2K A;  4DQ3 A;  3S26 A;  1LDO A;  3HWE A;  1ALB A;  4HFO A;  2JU7 A;  2KTS A;  4Y59 A;  3ZWE A;  4TLJ A;  2I5V O;  4YFQ A;  4GD9 A;  1BWY A;  1FEL A;  2VDF A;  2WQA E;  1JIW I;  2RTN B;  1SWU A;  3IA8 A;  4O4X A;  5FQ6 E;  4QGV A;  2DJG A;  2F01 A;  2ZSC A;  3LV4 A;  2A2U A;  3TGA A;  1PM1 X;  1ML7 A;  3P6G A;  1BRQ A;  4ON1 A;  3GAQ A;  5F6Z A;  5L8O A;  1HMR A;  3Q6L A;  1D3S A;  1JBH A;  2FRS A;  1FJ1 E;  3GE2 A;  4ORW A;  4WBK A;  2Y3E A;  2JW1 A;  3SLO A;  1E06 A;  4D6B A;  5H8T A;  1ZNH A;  3HOL A;  2HZR A;  4BGF A;  2FKJ A;  2BLG A;  4OEL A;  5AQ6 A;  2EU7 X;  4XME A;  1OPB A;  4GZV A;  4ZH9 A;  3OD9 A;  3HWG A;  1BRP A;  5LJE A;  1G7N A;  3AKM A;  3I0A A;  2PI3 O;  3FEK A;  2A5B A;  2OL6 O;  2OZQ A;  2RN4 A;  4QGW A;  5HTE A;  2RTI B;  1X8P A;  2X8S A;  1I04 A;  3WZP A;  4ALO A;  4ORX A;  1CBS A;  2WEX A;  1IIU A;  2DM5 A;  1EQD A;  2FHL A;  4GRJ A;  2ACO A;  3SZI A;  4QYP A;  3WJE A;  1DF8 A;  3BDR A;  4U8U M;  2X4M A;  1VYO A;  1BSO A;  1RXJ A;  1EUO A;  5L3Y A;  4GH7 A;  4ORU A;  1L6M A;  1HMT A;  1SWQ A;  3BRN A;  4Y0S A;  3RDQ A;  4CPH A;  1FE3 A;  1LUQ A;  2X56 A;  4U8U N;  4DNE A;  1KXO A;  5JR8 A;  5LJH A;  1KZW A;  5L8N A;  1HXL A;  1E00 A;  1UYN X;  4N7D A;  4AZR A;  5F58 A;  2AT8 X;  1FDQ A;  1W4T A;  4XMF A;  1KT5 A;  4WFU A;  3HPE A;  4Z28 A;  4BOE A;  2G78 A;  5B5G A;  1VWF B;  3B2L A;  1IKE A;  2BC3 A;  2ANS A;  2OL8 O;  3PDF A;  4KH8 A;  3WJB A;  1G85 A;  4MIR A;  1QWD A;  1VWH B;  3PH5 A;  5AJC A;  3ELX A;  2NNQ A;  4YBU A;  4YH0 A;  1X71 A;  4CK4 A;  1G5W A;  1LDQ A;  1AVG I;  3VGW A;  1B0O A;  1ZNL A;  1HBP A;  2FS7 A;  3BY0 A;  2A8G A;  1IW2 A;  3CQN A;  1SRG A;  1N4J A;  1OBP A;  3APW A;  4ZHD A;  1A57 A;  2RTH B;  3PED A;  1MUP A;  2OVD A;  4M6S A;  4CPI A;  2UZ2 A;  3ELZ A;  4INN A;  1PMP A;  5F6B A;  5LJD A;  3RDS A;  3FR5 A;  3T6L A;  1SRH A;  3P02 A;  4ZH6 A;  3KFI A;  1RAV A;  2FTB A;  4HPC A;  2WEW A;  1T68 X;  4I9R A;  3RBY A;  3NQK A;  4YGH A;  4EFG A;  1YWB A;  3EM0 A;  3VG6 A;  4GU8 A;  4QRL A;  4OMW A;  2RTQ B;  2LBV A;  3FLL A;  4LZU A;  1B8E A;  4GKC A;  4YGZ A;  1GM6 A;  3NP1 A;  3ZW0 A;  1SY3 A;  4KII A;  3RY2 A;  4A60 A;  3FMZ A;  1YIV A;  2FT9 A;  4O3W A;  2AH7 X;  5BVT A;  2BS5 A;  1SRJ A;  2RTG B;  3F9D A;  2IZB A;  2IZG B;  1VWM B;  4I60 A;  5K67 A;  3U03 A;  3CR6 A;  4GJS A;  1S44 A;  4MVK A;  3L4R A;  1EPA A;  4NV8 A;  4JGL A;  1ZNE A;  3RDU A;  5B10 O;  3TF6 A;  4ZHH A;  2M4L A;  3NAD A;  4KT5 A;  2BSZ A;  5K06 A;  1Z24 A;  3KFH A;  5IRW A;  4EKV A;  5HCE C;  5CSE A;  1BJ7 A;  1FEM A;  1SA8 A;  1VWD B;  4NYR A;  4BX5 B;  4GGR A;  1HBQ A;  2G5L A;  1LF7 A;  2Q2P A;  4MVE A;  1LCW A;  1MVG A;  1MDC A;  3VE1 A;  3TGB A;  2L68 A;  3P24 A;  3WZO A;  1BSQ A;  4BQU A;  2IZA A;  2K23 A;  5BYP A;  4YFR A;  1P6P A;  2YMS A;  1MEP A;  1W5R A;  1QFT A;  2RD7 C;  2PY1 A;  4QQ1 A;  4IB6 A;  2JN3 A;  5HZQ A;  4CV7 A;  3STK A;  1AVD A;  1KFF A;  2AL0 X;  2GC9 A;  2GTL M;  5FAZ A;  5IO7 A;  3VG7 A;  1VWO B;  4OS3 A;  3EYC A;  2FHN X;  2OF8 A;  5EDB A;  1QFV A;  4IAW A;  2GTL N;  3OBL A;  1EXS A;  1VWR B;  4IB9 A;  1U0X A;  1SWG A;  2OL7 A;  3FR4 A;  1VWJ B;  4AW8 A;  1BM5 A;  2LA7 A;  1SWB A;  4Y0Q A;  4WFV A;  1GT4 A;  1SWK A;  5D8J A;  5LJK A;  5HBS A;  2ACP X;  3KZA A;  4Y0R A;  1SLD B;  3APU A;  5K68 A;  4D6A A;  2QO4 A;  4M7M A;  1PEE A;  4COT A;  5L8I A;  4NLI A;  1A2D A;  2OFR X;  4MIS A;  3B2I A;  1NC9 A;  4XMG A;  4AZQ A;  1LCV A;  4CDC A;  3ZUO A;  5CE4 A;  1RSU B;  2W2B A;  3PEC A;  4YBP A;  5H9K A;  3EMM A;  4Z6J A;  1HQQ A;  4B55 A;  1RBP A;  4CDE A;  2MJI A;  1URE A;  3UEW A;  4ZGU A;  3FYF A;  3P6E A;  1O1V A;  2BS6 A;  5FFH A;  3CKF A;  1U17 A;  5DPQ A;  1FEN A;  1ADL A;  1Y55 X;  4ORS A;  5B29 A;  1O1U A;  1STS B;  2FR3 A;  2UYW A;  4GDA A;  3FIQ A;  4OMX A;  3CKG A;  1SXU A;  3EW1 A;  4CDF A;  1GGL A;  3EBW A;  1NQN A;  4U46 A;  1W6F A;  3C76 X;  1CBI A;  1OSP O;  4BX6 A;  1VWE B;  3C78 X;  3EBK A;  5EED A;  5B3M O;  5HZ6 A;  5HZ9 A;  2CM9 A;  3WVM A;  4BX7 B;  4JNJ A;  4O49 A;  2LFO A;  1NGL A;  2A0A A;  1KT6 A;  1MX7 A;  2CZT A;  1SWS A;  4MVI A;  4ALB A;  2KD2 A;  5EPQ A;  4GDZ A;  3V8U A;  3CBC A;  4Z2O A;  4ZR2 A;  4Z2V A;  4FBO A;  2CZU A;  4PSQ A;  4YGG A;  3RKG A;  3FEP A;  1E5P A;  3FA8 A;  4OS0 A;  2RQ0 A;  1Y9T A;  1DV9 A;  1LKE A;  4NNT A;  3ZI8 A;  1I05 A;  2AF5 A;  2N93 A;  3FEN A;  2MF6 A;  1SWP A;  1ZNK A;  3BS2 A;  4KCA A;  5B27 A;  1TXL A;  3VG5 A;  3RY1 A;  3VHH A;  3DTQ A;  4AZP A;  2Q4N A;  3VG2 A;  1KQW A;  2NNE A;  4L1N A;  1SXY A;  3ZZV A;  4AZM A;  1O8V A;  4IAX A;  1VPR A;  1S7D A;  2A3F X;  1KT4 A;  1VWN B;  1JQP A;  1RXK A;  1DFV A;  2IZJ A;  1ICN A;  2CBS A;  4LKT A;  1KGL A;  1LIF A;  2IFB A;  2RTF B;  1SMP I;  3FA9 A;  4GGZ A;  2NP1 A;  2IZL B;  4C5P A;  2FS6 A;  3WJF A;  1KL5 A;  1STR B;  2OY1 O;  3VHM A;  4Z27 A;  3I17 A;  1LCZ A;  2ZAG A;  3HWF A;  3LHN A;  4ID2 A;  4GET A;  2G7B A;  4OKA A;  4NW4 A;  2JOZ A;  4K19 A;  4NV7 A;  3RZY A;  1JZU A;  1ZRY A;  3T1D A;  2POA A;  2LB6 A;  2FLJ A;  3DSZ A;  3FA7 A;  3FDC A;  3ZW2 A;  1VWC B;  1X8Q A;  1SWR A;  3FA6 A;  3WJG A;  1HXZ A;  1SWA A;  3U0D A;  1EII A;  3NX2 A;  3T6F A;  3EW2 A;  5BVQ A;  4U8U O;  2CAM A;  3UEX A;  5HTD A;  2CBR A;  3F8A A;  3VHI A;  2A13 A;  1VWA B;  3BSZ E;  4YCE A;  5F2B A;  2QCB A;  1T8V A;  5FQ7 E;  4GGT A;  1YP6 A;  2X55 A;  5HAE A;  3TGC A;  1VWB B;  1AVE A;  1X8U A;  1BLR A;  1SXW A;  4ODD A;  1JJX A;  2OVS A;  3T2X A;  2FGS A;  3BX7 A;  3HK1 A;  1MM9 A;  3NQ9 A;  4O3X B;  5IO6 A;  3RWX A;  2AT6 X;  4GK9 A;  3SOT A;  1IJ8 A;  4ORY A;  1VWQ B;  5FEN A;  3P6H A;  1K24 A;  2AT0 X;  1NP1 A;  4O4U A;  1Y0G A;  3FR2 A;  2X8T A;  2RTM A;  1LNM A;  4IB7 A;  2OFA A;  4BBO A;  1SLG B;  4I9S A;  4NNS A;  1VYF A;  2ALL X;  2WSJ A;  2IZE B;  1VWP B;  3HTY A;  3PP6 A;  5D47 A;  3FEL A;  3P6C A;  5EDC A;  4HPD A;  3ZW1 B;  1KL3 A;  3STM X;  3SZH A;  2RTL A;  1ZND A;  3FW4 A;  2X46 A;  4TNN A;  1LFO A;  1LIE A;  4MEE A;  3RDX A;  2AT3 X;  4ZHC A;  1I4U A;  1KT3 A;  1LIC A;  1SWH A;  2DJF A;  5F1E A;  4A1H A;  3APV A;  1GKA B;  3S5X A;  3D96 A;  3STN A;  1SWE A;  4ZHG A;  3BLG A;  3NQ3 A;  3VG3 A;  1JYJ A;  1ZNG A;  3WYP A;  1LEL A;  1QG5 A;  3SLT A;  3EC5 A;  2RA6 A;  3LTW A;  3FID A;  3OJY C;  1MOY A;  5F7G A;  1VWG B;  1D2U A;  5BVS A;  5JD2 A;  3S60 A;  1B4M A;  1H91 A;  4YDA A;  3MX7 A;  2Q2M A;  4O4S A;  4TKB A;  4YKM A;  3S5V A;  1HN2 A;  1Y53 X;  3ZQ3 A;  4BJ8 A;  4UU2 A;  3BU9 A;  3RDM A;  1Y52 X;  1STP A;  3RE6 A;  1WUB A;  5B11 O;  1CBR A;  1DC9 A;  4LZV A;  4DQ4 A;  1AB0 A;  2R74 A;  3B2H A;  2WQ9 A;  5HCC C;  2RTK A;  2BT9 A;  3D95 A;  2C1S A;  1VWK B;  3D4R A;  4Z2P A;  4AZO A;  2IZH B;  5LJG A;  2FKG A;  3X00 A;  3IFB A;  3UEU A;  5IXG A;  3G7X A;  5H9A A;  3D97 A;  1SWJ A;  1KQX A;  3U9P C;  4U3Q A;  4FBR A;  4I6S A;  3P6D A;  2WPU A;  1DZP A;  2GH7 A;  3HWD A;  1DF3 A;  4GE1 A;  3ZW1 A;  2ASN X;  4O3Y A;  4ZGF A;  1HMS A;  3CWK A;  2GTL O;  4NYQ A;  1R0U A;  2RTO B;  5D48 A;  1E02 A;  5KIC A;  5LKE A;  1PBO A;  3RSW A;  1BSY A;  3F6Z B;  2OY5 O;  4OS8 A;  4ZJ0 A;  1EIO A;  1IKJ A;  4BVM A;  3WZN A;  1DZJ A;  1EW3 A;  2RTA A;  2QOS C;  2F09 A;  3NPO A;  1IFB A;  1SLE B;  3QKG A;  4BX5 A;  1E2T A;  2XKL A;  2IZI A;  2WUT A;  1SRE A;  2C4I A;  3B2J A;  3UAQ A;  2OFM X;  4JO6 A;  5HA0 A;  3OE3 A;  1SY0 A;  1QY0 A;  1SLF B;  1X8N A;  1SY1 A;  4CPH B;  5HCD C;  1X8O A;  4N7C A;  2NND A;  1YWC A;  4L3R A;  2LKK A;  3KFF A;  2BHV A;  3VG4 A;  4ZFX A;  1HY2 A;  3CQR A;  3WYQ A;  1ICM A;  4DCB A;  4EEJ A;  1QY2 A;  3PPT A;  4XMC A;  1SXX A;  1GT1 A;  4I95 A;  2AVI A;  5LKF A;  5EZ2 A;  2RTC B;  4LQZ A;  4Y0P A;  1N7Y A; 
#chains in the Genus database with same CATH homology
 1DZM A;  1UZ2 X;  2GTF X;  3PQU A;  4ES7 A;  2X45 A;  4XMH A;  3C77 X;  1N0S A;  3PQS A;  2R73 A;  4HPB A;  2OVA A;  4I3B A;  5DG4 A;  1TW4 A;  2FR2 A;  1CJ5 A;  1XCA A;  1GXA A;  4IMN A;  5IO5 A;  1JJJ A;  1YWD A;  5HZ8 A;  3NX1 A;  4EXZ A;  2JMB A;  3HOE A;  5CYB A;  1VYG A;  3SAO A;  1AEL A;  4HPA A;  5KHP A;  3O2Y A;  1NP4 A;  2Z4I A;  2RCT A;  1KZX A;  2GJ5 A;  2P8G A;  2CM4 A;  5FQ8 E;  2WWP A;  1YP7 A;  3APX A;  3WXQ A;  3ZW0 B;  1B56 A;  3N91 A;  1A3Y A;  4HWM A;  5D45 A;  1ERX A;  1T0V A;  2Q39 A;  4QZT A;  3ZUI A;  4EQA C;  3P6F A;  2OVE A;  4QZU A;  1OEE A;  1QQS A;  5LJB A;  4O4O A;  4TJZ A;  1YUP A;  4I3D A;  2LBA A;  4YKO A;  1RLB E;  2FWV A;  2HLV A;  2L9C A;  3JS1 A;  4YMY A;  4A1Y A;  3CMP A;  4MVL A;  2HMB A;  1CRB A;  3NBX X;  4FBV A;  4KC7 A;  4O9S A;  4KC8 A;  1OEJ A;  2WR6 A;  4QNI A;  1SY2 A;  2L67 A;  2RCQ A;  3FW5 A;  2AT5 X;  4ZCB A;  3K3L A;  3TZS A;  2KW1 A;  3MVF A;  4ARH A;  1BBP A;  2MWH A;  1OBQ A;  3WOV A;  4FGI B;  2F73 A;  2AMM X;  1OPA A;  1X89 A;  1YWA A;  4I3C A;  4NP1 A;  2HZQ A;  5HWZ A;  1GX9 A;  1IFC A;  4A8Z A;  1DZK A;  4QGX A;  1OEK A;  1JYD A;  1LPJ A;  1OBU A;  2KTD A;  3JQO A;  2E4J A;  3BX8 A;  2AKQ A;  2L5P A;  4RUN A;  2QO5 A;  2QMI A;  4YFP A;  1ERB A;  3MBT A;  5AJB A;  4WHI A;  5KID A;  4GNW A;  3WJC A;  4FQB B;  4AYH A;  2JU3 A;  3H3I A;  4IBA A;  1CBQ A;  1EI5 A;  4XMD A;  4YDB A;  2O62 A;  4ORR A;  5LJC A;  5H9N A;  1ACD A;  1MX8 A;  3KFG A;  4ZHF A;  2Q9S A;  3VE2 A;  5HZ5 A;  4NLJ A;  1HQP A;  1U18 A;  2X8F A;  1KT7 A;  3UEV A;  4LKP A;  1TOU A;  2KT4 B;  5HA1 A;  1GT5 A;  1GT3 A;  2MM3 A;  2Z4H A;  5AEO A;  4UU3 A;  3WBG A;  5C0N A;  1EAL A;  3BU1 A;  1EPB A;  2G79 A;  4U9C A;  1I06 A;  3JSQ A;  1QY1 A;  3NR3 A;  2HYS A;  2A2G A;  3O22 A;  1AQB A;  3AKN A;  3VPJ E;  1JBH A;  2ZAI A;  2HNX A;  4GNY A;  1BEB A;  1TOW A;  1FTP A;  4TQ2 A;  1Y9L A;  4IAB A;  2W2F A;  2K62 A;  2JU8 A;  4RUU A;  2R56 A;  4EDE A;  1KOI A;  3VU1 A;  4TKJ A;  2QM9 A;  1XKI A;  1GX8 A;  2MHD A;  4IMO A;  4QAE A;  1QAB E;  5EEE A;  4IB8 A;  1TVQ A;  1G74 A;  4O3Z A;  1GKA A;  4YCH A;  1LID A;  3VG5 A;  2XST A;  1LIB A;  3WJD A;  2W2A A;  1JV4 A;  5H9L A;  3E3C A;  4ML7 B;  4PJ2 A;  2QO6 A;  3O19 A;  3PH6 A;  1A18 A;  4TKH A;  3KQ0 A;  4QYN A;  4AZN A;  2YG2 A;  2MO5 A;  5D4A A;  4CSB A;  4R0B A;  3CBS A;  4DQ3 A;  1S2P A;  3B2K A;  3S26 A;  3HWE A;  1ALB A;  4HFO A;  2JU7 A;  2KTS A;  3ZWE A;  4TLJ A;  4YFQ A;  1BWY A;  1FEL A;  2WQA E;  1JIW I;  4O4X A;  3IA8 A;  5FQ6 E;  4QGV A;  3LV4 A;  2A2U A;  3TGA A;  1PM1 X;  1ML7 A;  3P6G A;  1BRQ A;  4ON1 A;  3GAQ A;  5F6Z A;  5L8O A;  1HMR A;  3Q6L A;  1D3S A;  2FRS A;  4ORW A;  3GE2 A;  4WBK A;  2JW1 A;  1E06 A;  4D6B A;  5H8T A;  1ZNH A;  3HOL A;  2HZR A;  2BLG A;  5AQ6 A;  2EU7 X;  4XME A;  1OPB A;  4GZV A;  4ZH9 A;  3OD9 A;  3HWG A;  1BRP A;  5LJE A;  1G7N A;  3AKM A;  3I0A A;  3FEK A;  2OZQ A;  2RN4 A;  4QGW A;  5HTE A;  2X8S A;  1X8P A;  4ALO A;  1I04 A;  4ORX A;  1CBS A;  2WEX A;  1IIU A;  2DM5 A;  1EQD A;  4GRJ A;  2ACO A;  4QYP A;  3WJE A;  3BDR A;  4U8U M;  1BSO A;  1EUO A;  4GH7 A;  4ORU A;  1L6M A;  1HMT A;  4Y0S A;  3BRN A;  5JR8 A;  1FE3 A;  4U8U N;  5LJH A;  1KXO A;  1KZW A;  5L8N A;  1E00 A;  4N7D A;  4AZR A;  5F58 A;  2AT8 X;  1FDQ A;  4XMF A;  1KT5 A;  4WFU A;  4BOE A;  2G78 A;  3B2L A;  1IKE A;  2ANS A;  4KH8 A;  3WJB A;  1G85 A;  4MIR A;  1QWD A;  3PH5 A;  5AJC A;  3ELX A;  2NNQ A;  4YBU A;  4YH0 A;  1X71 A;  4CK4 A;  1G5W A;  1AVG I;  1B0O A;  1ZNL A;  1HBP A;  2FS7 A;  3BY0 A;  1IW2 A;  3CQN A;  3APW A;  1OBP A;  1A57 A;  4ZHD A;  3PED A;  1MUP A;  2OVD A;  4M6S A;  3ELZ A;  4INN A;  1PMP A;  5F6B A;  5LJD A;  3FR5 A;  3P02 A;  4ZH6 A;  3KFI A;  2FTB A;  4HPC A;  2WEW A;  1T68 X;  4I9R A;  3RBY A;  3NQK A;  4YGH A;  4EFG A;  1YWB A;  3EM0 A;  3VG6 A;  4GU8 A;  4QRL A;  4OMW A;  2LBV A;  3FLL A;  4LZU A;  1B8E A;  4GKC A;  4YGZ A;  1GM6 A;  3NP1 A;  3ZW0 A;  1SY3 A;  4KII A;  4A60 A;  3FMZ A;  1YIV A;  2FT9 A;  4O3W A;  2AH7 X;  5BVT A;  2BS5 A;  3F9D A;  3U03 A;  3CR6 A;  1S44 A;  4MVK A;  3L4R A;  1EPA A;  4JGL A;  1ZNE A;  3TF6 A;  4ZHH A;  2M4L A;  3NAD A;  4KT5 A;  5K06 A;  1Z24 A;  3KFH A;  5HCE C;  1BJ7 A;  1FEM A;  1SA8 A;  4NYR A;  1HBQ A;  1LF7 A;  2Q2P A;  4MVE A;  1MVG A;  1MDC A;  3VE1 A;  3TGB A;  2L68 A;  3P24 A;  1BSQ A;  4BQU A;  2K23 A;  5BYP A;  4YFR A;  1P6P A;  2YMS A;  1QFT A;  2RD7 C;  2PY1 A;  4QQ1 A;  4IB6 A;  2JN3 A;  5HZQ A;  4CV7 A;  3STK A;  5IO7 A;  2AL0 X;  2GC9 A;  2GTL M;  5FAZ A;  3VG7 A;  4OS3 A;  3EYC A;  5EDB A;  1QFV A;  4IAW A;  2GTL N;  3OBL A;  1EXS A;  4IB9 A;  1U0X A;  4AW8 A;  3FR4 A;  1BM5 A;  2LA7 A;  4Y0Q A;  4WFV A;  1GT4 A;  5D8J A;  5LJK A;  5HBS A;  2ACP X;  3KZA A;  4Y0R A;  3APU A;  4D6A A;  2QO4 A;  4M7M A;  1PEE A;  4COT A;  5L8I A;  4NLI A;  1A2D A;  2OFR X;  4MIS A;  3B2I A;  4XMG A;  4AZQ A;  3ZUO A;  5CE4 A;  3PEC A;  2W2B A;  4YBP A;  5H9K A;  3EMM A;  1RBP A;  2MJI A;  1URE A;  3UEW A;  4ZGU A;  3FYF A;  3P6E A;  1O1V A;  2BS6 A;  5FFH A;  1U17 A;  5DPQ A;  1FEN A;  1ADL A;  4ORS A;  5B29 A;  1O1U A;  2FR3 A;  3FIQ A;  4OMX A;  1SXU A;  1GGL A;  3EBW A;  3C76 X;  1CBI A;  5HZ6 A;  3C78 X;  3EBK A;  5EED A;  5HZ9 A;  2CM9 A;  3WVM A;  4O49 A;  2LFO A;  1NGL A;  2A0A A;  1KT6 A;  1MX7 A;  2CZT A;  4MVI A;  4ALB A;  2KD2 A;  5EPQ A;  4GDZ A;  3V8U A;  3CBC A;  4ZR2 A;  4FBO A;  2CZU A;  4PSQ A;  4YGG A;  3RKG A;  3FEP A;  1E5P A;  3FA8 A;  4OS0 A;  2RQ0 A;  1Y9T A;  1DV9 A;  1LKE A;  4NNT A;  3ZI8 A;  1I05 A;  2N93 A;  3FEN A;  1ZNK A;  3BS2 A;  4KCA A;  5B27 A;  1TXL A;  4AZP A;  3DTQ A;  2Q4N A;  3VG2 A;  1KQW A;  2NNE A;  4L1N A;  1SXY A;  3ZZV A;  4AZM A;  1O8V A;  4IAX A;  1VPR A;  1S7D A;  2A3F X;  1KT4 A;  3ZQ3 A;  1DFV A;  4LKT A;  1ICN A;  2CBS A;  1KGL A;  1LIF A;  2IFB A;  1SMP I;  3FA9 A;  2NP1 A;  2FS6 A;  3WJF A;  3I17 A;  2ZAG A;  3HWF A;  3LHN A;  4ID2 A;  4GET A;  2G7B A;  3RZY A;  4NW4 A;  2JOZ A;  4K19 A;  1JZU A;  1ZRY A;  3T1D A;  2POA A;  2LB6 A;  2FLJ A;  3DSZ A;  3FA7 A;  3ZW2 A;  3U0D A;  1X8Q A;  3WJG A;  3FA6 A;  1EII A;  3NX2 A;  5BVQ A;  4U8U O;  3UEX A;  5HTD A;  2CBR A;  3F8A A;  2A13 A;  3BSZ E;  4YCE A;  1T8V A;  5FQ7 E;  1YP6 A;  5HAE A;  3TGC A;  1X8U A;  1BLR A;  1SXW A;  4ODD A;  1JJX A;  2OVS A;  3BX7 A;  3HK1 A;  4O3X B;  3NQ9 A;  5IO6 A;  3RWX A;  2AT6 X;  4GK9 A;  3SOT A;  4ORY A;  5FEN A;  3P6H A;  2AT0 X;  1NP1 A;  4O4U A;  3FR2 A;  2X8T A;  1LNM A;  4IB7 A;  4I9S A;  4NNS A;  1VYF A;  2ALL X;  2WSJ A;  3HTY A;  3PP6 A;  5D47 A;  3FEL A;  3P6C A;  5EDC A;  4HPD A;  3ZW1 B;  3STM X;  1ZND A;  3FW4 A;  2X46 A;  4TNN A;  1LFO A;  1LIE A;  2AT3 X;  4ZHC A;  1I4U A;  1KT3 A;  1LIC A;  5F1E A;  4A1H A;  3APV A;  1GKA B;  3S5X A;  3D96 A;  3STN A;  4ZHG A;  3BLG A;  3NQ3 A;  3VG3 A;  1JYJ A;  1ZNG A;  1QG5 A;  2RA6 A;  3OJY C;  5F7G A;  1D2U A;  5BVS A;  3S60 A;  1B4M A;  1H91 A;  4YDA A;  3MX7 A;  2Q2M A;  4O4S A;  4TKB A;  4YKM A;  3S5V A;  1HN2 A;  4UU2 A;  3BU9 A;  1CBR A;  1DC9 A;  4LZV A;  4DQ4 A;  1AB0 A;  2R74 A;  3B2H A;  2WQ9 A;  5HCC C;  2BT9 A;  3D95 A;  3D4R A;  4AZO A;  5LJG A;  3IFB A;  3UEU A;  3G7X A;  5H9A A;  3D97 A;  1KQX A;  3U9P C;  4U3Q A;  4FBR A;  4I6S A;  3P6D A;  3HWD A;  1DZP A;  1DF3 A;  4GE1 A;  3ZW1 A;  2ASN X;  4O3Y A;  4ZGF A;  1HMS A;  3CWK A;  2GTL O;  4NYQ A;  1R0U A;  5D48 A;  1E02 A;  5KIC A;  5LKE A;  1PBO A;  3RSW A;  1BSY A;  3F6Z B;  4ZJ0 A;  4OS8 A;  1EIO A;  1IKJ A;  4BVM A;  1DZJ A;  1EW3 A;  2QOS C;  2F09 A;  3NPO A;  1IFB A;  3QKG A;  2XKL A;  2WUT A;  3UAQ A;  3B2J A;  2OFM X;  5HA0 A;  3OE3 A;  1SY0 A;  1QY0 A;  1X8N A;  1SY1 A;  5HCD C;  1X8O A;  4N7C A;  2NND A;  1YWC A;  4L3R A;  2LKK A;  3KFF A;  2BHV A;  3VG4 A;  4ZFX A;  3CQR A;  1ICM A;  4EEJ A;  1QY2 A;  3PPT A;  4XMC A;  1SXX A;  1GT1 A;  4I95 A;  5LKF A;  5EZ2 A;  4LQZ A;  4Y0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...