4IB8A

Bovine beta-lactoglobulin (isoform a) in complex with dodecyl sulphate (sds)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
158
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactoglobulin
publication title The differences in binding 12-carbon aliphatic ligands by bovine beta-lactoglobulin isoform A and B studied by isothermal titration calorimetry and X-ray crystallography
pubmed doi rcsb
molecule tags Transport protein
total genus 41
structure length 158
sequence length 162
ec nomenclature
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ib8A00
5F58A 4YDBA 2JN3A 3FELA 2ACPX 4NNTA 3TGAA 3TF6A 1T8VA 2ACOA 2ANSA 2AH7X 1DF3A 1QY2A 3B2LA 3FR2A 1IKEA 2NNEA 1GT5A 3BRNA 1ICMA 4EXZA 3BDRA 4ORRA 3CBSA 4NP1A 4N7DA 3QKGA 2R56A 3OJYC 1BJ7A 1SY2A 4AZPA 1VPRA 5H9LA 1QFTA 2HMBA 3UEUA 4YFQA 1CBQA 5EZ2A 3B2JA 5LJGA 2KTDA 2R74A 3VG6A 3HWFA 1CBSA 1G7NA 1LIBA 3U0DA 1EALA 5IO7A 1G74A 4OMWA 1YWCA 1JJJA 3EMMA 4WBKA 2OVEA 3U9PC 4DQ3A 3MBTA 1ZNKA 4A1YA 3D97A 2HYSA 4A8ZA 1EPAA 5HAEA 2ASNX 2AMMX 4N7CA 4M7MA 1SXXA 4Y0QA 5DPQA 1KQXA 4IB9A 2OFRX 4ALBA 4QGXA 1B8EA 2XSTA 1AELA 1G5WA 4ES7A 3EBWA 4ZHGA 5IO5A 4A60A 2GJ5A 5HZ9A 3FMZA 1TXLA 1BSQA 3FA8A 3SAOA 2POAA 3O19A 2JOZA 5HA0A 2NNDA 2IFBA 4YBUA 1ZNLA 1A3YA 1VYGA 1CJ5A 1AVGI 4BVMA 1E5PA 2NP1A 4ORSA 5H9AA 4I3DA 5F6ZA 1OBQA 2Q9SA 4YFPA 1IIUA 4HPCA 2HNXA 3ELXA 2ALLX 3D95A 5HZ6A 5EPQA 2Q4NA 1QFVA 2FT9A 1LICA 5EEEA 5LJDA 3VG5A 1B0OA 1OEJA 1ERBA 3EYCA 2OFMX 1I04A 4I9RA 4YCEA 3KFIA 1DZKA 1LFOA 2G78A 4ZFXA 4NYQA 2CZTA 5LKEA 1E06A 1X71A 4ZH9A 4YBPA 1DZJA 5FAZA 1JBHA 1KT5A 1ZNDA 1MX7A 1S7DA 4GETA 1Z24A 1YP7A 3WJEA 2WR6A 1HBQA 2HZQA 4ZR2A 1CBIA 4AZRA 4GNWA 5AQ6A 1SXWA 3I0AA 2FR3A 4QYPA 4QZUA 1IW2A 3CWKA 1UREA 1FE3A 4O9SA 5B27A 2MM3A 5LJKA 3UEVA 5IO6A 2CZUA 1RBPA 1OEKA 3EM0A 5H9KA 1BSOA 4IB8A 1KZXA 3PH6A 4IB7A 4MVKA 1OPAA 1MVGA 5LJHA 2HZRA 4OS0A 4AZOA 3ZQ3A 1JJXA 1LNMA 1H91A 3RSWA 1HMTA 3HWDA 5D8JA 3C78X 1KXOA 4GKCA 4ORYA 3APWA 4YCHA 1BRQA 4ARHA 3CQRA 1KT3A 3KFHA 4TKJA 3PPTA 4NLIA 3FENA 3FEKA 1QABE 1HQPA 1PM1X 5KHPA 3P6HA 1TOUA 2CBSA 3NX1A 5L8OA 2JU8A 3PEDA 1MUPA 2R73A 3WJBA 1KGLA 2L9CA 4MVIA 1YP6A 3VG7A 1GT3A 1UZ2X 4UU3A 1DZMA 4NYRA 2EU7X 4TQ2A 1JYDA 3BSZE 4XMDA 4Y0RA 2Q2MA 5KICA 1FELA 2A2GA 1SY3A 2RCQA 1MDCA 5LJEA 1MX8A 3FR5A 1YWAA 1GT4A 5K06A 2JU3A 5LKFA 4HPAA 5F6BA 1ML7A 3ELZA 5HCDC 4LZVA 1EW3A 1JV4A 1B56A 2FRSA 3NX2A 1R0UA 2GC9A 1NGLA 2X45A 3VG3A 4IAXA 1PEEA 2Q2PA 1A2DA 3CR6A 1QY0A 3DTQA 1BM5A 1B4MA 5B29A 4GNYA 2LB6A 2QOSC 4XMHA 4ORXA 3I17A 1A18A 5HWZA 2RA6A 3B2IA 5H9NA 2QO6A 2DM5A 5KIDA 3HK1A 1OBUA 3APUA 3WVMA 5LJBA 2YG2A 4LKPA 1EIOA 5D48A 1HMSA 4LZUA 4I9SA 2CM9A 3NPOA 4LKTA 3KZAA 1ICNA 4OS3A 1HBPA 5HA1A 1FENA 3ZUIA 4D6AA 5FFHA 2XKLA 1IFBA 1DFVA 3KQ0A 2FR2A 3BX7A 3VG2A 1I06A 1X8QA 2GTFX 2L68A 2WEWA 3FLLA 1SY1A 4IAWA 1G85A 5F1EA 3NQ3A 4TLJA 3B2KA 3BX8A 2AT3X 3K3LA 3CQNA 4ZGUA 1S2PA 4AZMA 4QGWA 2O62A 3BLGA 2G79A 5HBSA 3EBKA 3G7XA 2JU7A 5HZ8A 1ZNGA 1I4UA 4GE1A 1NP4A 1A57A 3APXA 4ZHFA 1QQSA 2CBRA 4ZH6A 1QG5A 1XKIA 1GXAA 3BU9A 2OVAA 3F8AA 1KQWA 1ACDA 3BS2A 1JZUA 4MVLA 4TNNA 2W2BA 2LKKA 1SXUA 3U03A 4HPDA 1FEMA 5BVTA 2LFOA 1LIDA 5EDCA 3B2HA 4ZHHA 1HMRA 1SXYA 2WEXA 4RUNA 4EDEA 4XMCA 2FS7A 1KOIA 5EEDA 1HN2A 2RCTA 4NNSA 3FW5A 2E4JA 1GKAB 1U17A 5D47A 1RLBE 3WJDA 3T1DA 3RZYA 5CE4A 1YUPA 4WFUA 4QZTA 3DSZA 1XCAA 4YMYA 1O1UA 3P6FA 4AYHA 4AW8A 2A0AA 5HCCC 1GX9A 1X8UA 2OZQA 1CBRA 1SY0A 4IMNA 4M6SA 4R0BA 2FTBA 4BQUA 4YKMA 1QY1A 3BU1A 3BY0A 4HPBA 1GT1A 1NP1A 1O8VA 1ZNEA 1OPBA 5EDBA 5H8TA 5FENA 3P6GA 3PH5A 1OBPA 4YGGA 4IMOA 3KFGA 2RD7C 1LPJA 1DV9A 1D3SA 1KT4A 1O1VA 2X46A 1BRPA 2AT0X 3FEPA 4ORWA 1EQDA 3O22A 3F9DA 4HFOA 5D45A 3CMPA 1KT6A 3GAQA 3NR3A 4QYNA 3WJGA 3FA9A 1EXSA 3STKA 1I05A 4CK4A 5HCEC 2AT6X 1EIIA 2KT4B 2L5PA 1T0VA 2FS6A 2N93A 4UU2A 3HWGA 1LIEA 2G7BA 1ALBA 2QO4A 3NP1A 1TOWA 4AZQA 3FA6A 4I3BA 3P6EA 5HTEA 4ZHCA 1BSYA 1N0SA 3D96A 5L8IA 5L8NA 1SA8A 4K19A 4WFVA 1TW4A 4KIIA 4TKBA 4GH7A 3AKNA 5HZ5A 4ZJ0A 4OMXA 4Y0SA 1YWBA 1EPBA 3NADA 4TJZA 1X8NA 1T68X 5BVQA 2A13A 4EEJA 3WJCA 1YWDA 1GM6A 4IBAA 1GKAA 5D4AA 4QGVA 3S26A 2A3FX 2LBVA 5DG4A 2K62A 1AB0A 1E02A 1BWYA 2W2AA 4YGZA 1ERXA 1IFCA 1AQBA 3JS1A 2P8GA 3FR4A 1QWDA 3P6CA 1U0XA 2FWVA 1ZNHA 2WSJA 3FA7A 1D2UA 2HLVA 5F7GA 2K23A 1CRBA 2OVDA 3APVA 2LBAA 3TGCA 1BBPA 4YFRA 3PP6A 2QO5A 1E00A 4ODDA 3IA8A 3TZSA 2MJIA 3CBCA 2FLJA 1KT7A 5HTDA 1ADLA 3WBGA 3FIQA 3ZUOA 4ZCBA 2QM9A 2L67A 4XMGA 1ZRYA 1LIFA 3PECA 2NNQA 4I3CA 4ZHDA 1FTPA 4D6BA 5LJCA 1X8PA 3Q6LA 1L6MA 4XMEA 2WWPA 1KZWA 2AL0X 1VYFA 4PSQA 4GRJA 3C76X 1BLRA 1EUOA 3KFFA 3JSQA 1U18A 2W2FA 1X8OA 1GX8A 4ORUA 1DC9A 4AZNA 2AT5X 1OEEA 4NLJA 3WJFA 4DQ4A 2RQ0A 2WUTA 1JYJA 1TVQA 1PBOA 1FDQA 3IFBA 5HZQA 2MO5A 1S44A 3HWEA 3WXQA 1X89A 3VG4A 4RUUA 4Y0PA 1LF7A 4YGHA 1LKEA 4TKHA 4BOEA 2BLGA 3O2YA 4QAEA 3NQ9A 2Q39A 3TGBA 2WQ9A 3MVFA 2AT8X 4OS8A 4YKOA 2AKQA 4YDAA 3UEXA 2WQAE 4XMFA 3STMX 4IB6A 5C0NA 3STNA 5JR8A 4A1HA 2F73A 4YH0A 3AKMA 2A2UA 1IKJA 1BEBA 2PY1A 3UEWA 3P6DA 4ALOA 1DZPA 1PMPA 4EFGA 1GGLA 5BVSA 2CM4A 3C77X 3FW4A 1P6PA 1YIVA 3L4RA
chains in the Genus database with same CATH superfamily
5F58A 1SRFA 4YDBA 2JN3A 4NV8A 3FELA 1LELA 2ACPX 4NNTA 5B5FA 3TGAA 3TF6A 1T8VA 2ACOA 2ANSA 2AH7X 3UAQA 1DF3A 1QY2A 3B2LA 3FR2A 1MEPA 1IKEA 2NNEA 1GT5A 3BRNA 1ICMA 4EXZA 2BHVA 1SWKA 3BDRA 4ORRA 1NC9A 3CBSA 4NP1A 1VWCB 4CV7A 4N7DA 3QKGA 1VWRB 2R56A 3OJYC 1BJ7A 1SY2A 3P02A 5B10O 4AZPA 1VPRA 2C1QA 2GTLM 1I78A 5H9LA 1NQMA 1QFTA 1RXJA 2HMBA 3UEUA 4YFQA 1CBQA 2JGSA 5EZ2A 3B2JA 5LJGA 3S5VA 4U9CA 2KTDA 2IZFB 2R74A 3VG6A 3VGWA 3HWFA 3SLOA 2IZKA 4NV7A 4Z2PA 1CBSA 1G7NA 1LIBA 3U0DA 1EALA 3FDCA 3RY1A 5IO7A 1NQNA 1SWDA 2G5LA 3AEHA 3ZWEA 1G74A 4OMWA 1YWCA 1JJJA 3EMMA 4WBKA 2OVEA 2UYWA 4OELA 3U9PC 4DQ3A 3MBTA 2A8GA 2RTAA 3QQ2A 2Y3FA 1ZNKA 4A1YA 4FQBB 3D97A 2HYSA 4KH8A 2AF5A 4A8ZA 1EPAA 5HAEA 2ASNX 2RTHB 2AMMX 4O3YA 4N7CA 4M7MA 4Y5DA 4BX7B 3ZI8A 4BX5B 1SXXA 4Y0QA 5DPQA 1UYNX 1KQXA 4IB9A 3T6LA 2OFRX 2OVSA 4ALBA 2GH7A 2GTLO 4QGXA 1B8EA 2XSTA 1AELA 4FBVA 3KVNA 4CPHB 1G5WA 4ES7A 3EBWA 1SWHA 4WHIA 4ZHGA 1SWBA 4A60A 2GJ5A 1LCZA 1SLEB 3LHNA 3FMZA 1TXLA 3RDXA 5F2BA 5HZ9A 1BSQA 3FA8A 1SWRA 2X55A 4O49A 2FGSA 3SAOA 2POAA 2RTFB 2JOZA 3O19A 5HA0A 2NNDA 2FHNX 2IFBA 1JQPA 4YBUA 1ZNLA 4COTA 1A3YA 1VYGA 4FGIB 1CJ5A 3HPEA 1AVGI 4BVMA 1E5PA 2NP1A 4ORSA 5H9AA 4I3DA 5F6ZA 3X00A 1OBQA 3T2WA 2Q9SA 1WUBA 1IIUA 4YFPA 3D4RA 4HPCA 2HNXA 3ELXA 2DJFA 2ALLX 3D95A 3P24A 2OY5O 5EPQA 5HZ6A 2BT9A 4DCBA 2Q4NA 1QFVA 2FT9A 1LICA 3EW1A 5EEEA 5LJDA 3ZW0B 3VG5A 1B0OA 1E2TA 1HY2A 1OEJA 3SLTA 2I5ZO 1ERBA 3EYCA 2OFMX 1I04A 4I9RA 2RTEB 2MF6A 4MIRA 3FIDA 1VWQB 3KFIA 3H3IA 4YCEA 1DZKA 1LFOA 2G78A 4Z2OA 4ZFXA 4NYQA 2CZTA 2KW1A 5LKEA 4OKAA 1X71A 1E06A 1SLGB 1SRHA 4ZH9A 5L3YA 5B5GA 4YBPA 1DZJA 4O3ZA 5FAZA 2RTBB 1JBHA 1SWPA 1KT5A 1W6FA 3VHHA 3WOVA 2AVIA 1ZNDA 1MX7A 1S7DA 4ID2A 1RXHA 2UZ2A 4GETA 1Z24A 1YP7A 3WJEA 2VDFA 2WR6A 1Y9TA 3WZNA 1HBQA 2HZQA 4ZR2A 1CBIA 1K24A 2IZLB 4AZRA 4GNWA 2IZDB 4KC8A 5AQ6A 1SXWA 3I0AA 2FR3A 4QYPA 1VWNB 4QQ1A 4QZUA 1IW2A 1I9HA 3CWKA 2OL8O 1UREA 4GD9A 1FE3A 2JMBA 4O9SA 5B27A 4BX7A 2MM3A 4EKVA 5LJKA 3UEVA 5IO6A 2CZUA 2JW1A 2QOMA 1SWQA 4L1NA 1LCWA 1RBPA 1OEKA 3EM0A 4INNA 1BSOA 4IB8A 5H9KA 2BS6A 3PH6A 4IB7A 4MVKA 3ZW1A 1OPAA 5K68A 1MVGA 5LJHA 3Q34A 2HZRA 2RTKA 3RKGA 4CPHA 4OS0A 4AZOA 2CAMA 2DJGA 5HCDC 2X8SA 1Y55X 1Y0GA 1W5RA 1OSPO 3ZQ3A 1LNMA 1MK5A 1H91A 1JJXA 3RSWA 4O4OA 2VFBA 1HMTA 1Y53X 3HWDA 3OBLA 3C78X 1KXOA 1Y52X 4GKCA 3APWA 4ORYA 4GGZA 4YCHA 1VWLB 1BRQA 4ARHA 1SRIA 3CQRA 1KT3A 3KFHA 4TKJA 3PPTA 4NLIA 3FENA 3FEKA 4HWMA 3VE1A 1QABE 1HQPA 1PM1X 1SWUA 2M4LA 5BYPA 5KHPA 2OF9A 1N43A 3P6HA 5FQ7E 1TOUA 2CBSA 3NX1A 1SWTA 5L8OA 2JU8A 3PEDA 1MUPA 2R73A 2RTIB 2X56A 3WJBA 1KGLA 2L9CA 4MVIA 3RBYA 1YP6A 1VWIB 1K3BA 3VG7A 1GT3A 1UZ2X 3ZW0A 3MX7A 4UU3A 1DZMA 4GK9A 4NYRA 2EU7X 4TQ2A 1JYDA 3BSZE 4XMDA 4Y0RA 2Q2MA 1LDQA 1FELA 5KICA 2RTPB 5FQ6E 1SMPI 2A2GA 1SY3A 1RSUB 2RCQA 1VWPB 4ON1A 1MDCA 5LJEA 2RTJA 1MX8A 5JD2A 5IRAA 3FR5A 1YWAA 1GT4A 3WYQA 4CPFA 2JU3A 5K06A 5LKFA 1GX3A 1DF8A 4HPAA 5F6BA 1ML7A 1SRJA 3ELZA 5B2AO 1VWKB 1EW3A 1JV4A 1B56A 2FRSA 3NX2A 4LZVA 1KZXA 1R0UA 2KD2A 2GC9A 4U46A 1NGLA 3JQOA 2X45A 4IABA 3VG3A 4IAXA 1PEEA 2Q2PA 4Z2VA 1A2DA 3CR6A 3LTWA 1QY0A 2IZCB 3DTQA 1BM5A 1B4MA 4PJ2A 5B29A 4FBOA 1MOYA 4JNJA 1HQQA 1STPA 4GNYA 3VPJE 2LB6A 2QOSC 1VWAB 4XMHA 4ORXA 3VU1A 3I17A 1A18A 1FJ1E 4O4XA 5HWZA 2RA6A 3B2IA 5H9NA 3ZZVA 2QO6A 2DM5A 3MM0A 4IRWA 2ZAGA 1MM9A 2VFCA 5KIDA 5IRWA 3HK1A 1OBUA 2RTLA 3APUA 3VHIA 3WVMA 5LJBA 2YG2A 3VE2A 4LKPA 1EIOA 2Z4IA 5D48A 1HMSA 2OYBO 4LZUA 3RE6A 4I9SA 3VHMA 4C5PA 2CM9A 3NPOA 4LKTA 5CSEA 3KZAA 1Y9LA 1ICNA 4OS3A 1HBPA 5HA1A 2OY7A 3RY2A 1FENA 1NBXA 1KL3A 3ZUIA 4D6AA 4GGRA 5FFHA 4CPIA 2A5CA 2XKLA 1IFBA 1DFVA 3KQ0A 2FR2A 3BX7A 3VG2A 1I06A 2RTQB 1X8QA 2GTFX 2L68A 2WEWA 4CSBA 2IZJA 3FLLA 1SY1A 1SWFA 1G85A 4IAWA 4GGTA 5F1EA 3RDOA 4DNEA 4JHQA 3NQ3A 4CDDA 2FKGA 1JJUA 3B2KA 3BX8A 2AT3X 3K3LA 4ML7B 3CQNA 4TLJA 2Y32A 3WZQA 4ZGUA 5IXGA 1SREA 1S2PA 4AZMA 1VWHB 4QGWA 2O62A 1KL4A 2G79A 3BLGA 3AUMO 5HBSA 1RAVA 3EBKA 3G7XA 2JU7A 4OEMA 5HZ8A 1PTSA 4B55A 1ZNGA 1I4UA 4GE1A 1NP4A 1A57A 3APXA 4ZHFA 1QQSA 2CBRA 4I60A 1QG5A 4GUZA 4ZH6A 1XKIA 3PQSA 1GXAA 1RSTB 1SLFB 3BU9A 2OVAA 3F8AA 1KQWA 1ACDA 1RXKA 3BS2A 4EQAC 1JZUA 4MVLA 4TNNA 2W2BA 2LKKA 4CDEA 5AJBA 1SXUA 3U03A 2RTRB 4HPDA 3RDQA 1FEMA 4CDCA 4I95A 1N4JA 3RDUA 2LFOA 3WZOA 5BVTA 1N7YA 4O3WA 1SWNA 1VWGB 1LIDA 5EDCA 3B2HA 4Z6JA 1HMRA 4ZHHA 4BX5A 4BX6B 1SXYA 1N9MA 2WEXA 4RUNA 4EDEA 3CKFA 3HOLA 3N91A 2FS7A 4XMCA 1KOIA 5EEDA 1HN2A 2OF8A 4L3RA 2RCTA 4NNSA 3FW5A 2E4JA 1GKAB 2GTLN 4BGFA 1U17A 2KTSA 1RLBE 4JGLA 4JO6A 5D47A 2RTDB 3T1DA 4I6SA 3WJDA 4KC7A 3RZYA 5IO5A 5CE4A 3V8UA 1YUPA 4WFUA 4QZTA 3DSZA 1XCAA 1SWGA 2BC3A 4QNIA 4YMYA 1SWAA 1VWDB 1STRB 1O1UA 3PDFA 3P6FA 3T6FA 4AYHA 2RTGB 1VWFB 2OL6O 4AW8A 4Z27A 2A0AA 5HCCC 3T2XA 1GX9A 1X8UA 2OZQA 1CBRA 1SY0A 4IMNA 4M6SA 4R0BA 5CYBA 2FTBA 1KFFA 4BQUA 4YKMA 1KL5A 1QY1A 1IJ8A 3BU1A 3BY0A 4HPBA 1GT1A 1NP1A 1O8VA 1W4TA 1ZNEA 1OPBA 5EDBA 5H8TA 3RE5A 5FENA 4BJ8A 3P6GA 3PH5A 1OBPA 2IZHB 4YGGA 4IMOA 3KFGA 2RD7C 5D8JA 4FBRA 1LPJA 2Y3EA 1DV9A 1D3SA 1KT4A 1O1VA 1VWMB 2X46A 1BRPA 2AT0X 3FEPA 4U8UN 1SWSA 1EQDA 3O22A 4ORWA 3EW2A 3F9DA 4HFOA 1SWEA 3CMPA 5D45A 1KT6A 3GAQA 3NR3A 4QYNA 5CHKA 4O4UA 3WJGA 3FA9A 1EXSA 3STKA 3WZPA 1I05A 4CK4A 5HCEC 2AT6X 3HTYA 1EIIA 2KT4B 2L5PA 3FYFA 1AVEA 1JMXA 1T0VA 2FS6A 2N93A 3HWGA 3LV4A 2OY1O 1LIEA 2G7BA 4UU2A 2IZIA 3SZJA 2RTMA 1ALBA 2QO4A 2YMSA 3NP1A 1TOWA 5FQ8E 4AZQA 4KT5A 3FA6A 4I3BA 3P6EA 1SWLA 5HTEA 4CDFA 4BBOA 4QRLA 4ZHCA 1BSYA 2F09A 2X8TA 1SWJA 1N0SA 3GE2A 3D96A 2X8FA 4Y59A 5L8IA 4CPEA 5L8NA 1SA8A 4K19A 2OY8A 4WFVA 1TW4A 4KIIA 4TKBA 2ZSCA 4GH7A 4GZVA 3AKNA 5HZ5A 1SLDB 4ZJ0A 4OMXA 4Y0SA 1YWBA 4Z28A 1EPBA 3NADA 2WPUA 4BX6A 2MWHA 4TJZA 3OE3A 4GU8A 3SZHA 1X8NA 1T68X 5BVQA 3RDSA 2A13A 4EEJA 5AEOA 3NQKA 3WJCA 1YWDA 1GM6A 1VYOA 2QMIA 1WBIA 1GKAA 4IBAA 5D4AA 4QGVA 2C4IA 2X4MA 2G8CO 5K67A 3S26A 2A3FX 2LBVA 5DG4A 1JMZA 3E3CA 2K62A 1AB0A 1E02A 1BWYA 1LCVA 2W2AA 1ERXA 4YGZA 1IFCA 1AQBA 3JS1A 2P8GA 3FR4A 5IRUA 1QWDA 1LUQA 3P6CA 1U0XA 2FWVA 4U8UM 1ZNHA 2WSJA 3FA7A 1D2UA 2HLVA 5F7GA 2K23A 1CRBA 2PI3O 2OVDA 3APVA 2LBAA 3ZW1B 3TGCA 1STSB 1BBPA 1JIWI 1UYOX 4MISA 3PP6A 4YFRA 3OD9A 2QO5A 1E00A 4ODDA 3IA8A 3TZSA 1EI5A 2FKJA 2MJIA 3CBCA 2FLJA 3EC5A 4MEEA 5AJCA 5B3MO 1KT7A 5HTDA 1ADLA 3WBGA 1SRGA 3FIQA 4O4SA 3ZUOA 4LQZA 2QM9A 4ZCBA 2L67A 4XMGA 1ZRYA 1LIFA 3PECA 2NNQA 4I3CA 4ZHDA 1FTPA 2QCBA 3WYPA 1LDOA 2RTCB 4NW4A 4D6BA 5LJCA 3D9WA 3ZW2A 1X8PA 3PQUA 2RN4A 3CKGA 3Q6LA 3S5XA 1L6MA 4XMEA 2WWPA 4ZGFA 2AL0X 1KZWA 1VYFA 4PSQA 4GRJA 3C76X 1BLRA 1EUOA 2HKDA 2RTNB 3KFFA 3JSQA 4U3QA 3S60A 1U18A 2W2FA 1VWOB 1GX8A 1X8OA 2Z4HA 2ZAIA 4ORUA 4U8UO 1DC9A 2BS5A 2OFBA 1VWJB 4AZNA 2AT5X 1OEEA 3RDMA 4NLJA 3WJFA 4DQ4A 3SOTA 1N9YA 2RQ0A 2WUTA 1JYJA 2OFAA 1TVQA 1PBOA 1FDQA 3IFBA 5HZQA 2MO5A 1S44A 2A5BA 2F01A 2C1SA 3F6ZB 3HWEA 3RWXA 1AVDA 3WXQA 3SLJA 1X89A 2OL7A 1SWOA 2IZBA 3VG4A 3PK2A 2MHDA 4KCAA 4RUUA 4Y0PA 1LF7A 4YGHA 1LKEA 4TKHA 2LA7A 2IZAA 4GDAA 2X32A 4GJSA 2I5VO 4BOEA 2BLGA 3O2YA 4QAEA 3NQ9A 2Q39A 3TGBA 2WQ9A 3MVFA 2AT8X 3MG5A 4OS8A 4YKOA 1HXLA 2RTOB 1HXZA 2AKQA 4GJVA 3HOEA 4YDAA 3UEXA 2WQAE 4BCSA 5B11O 4XMFA 3STMX 2FHLA 4IB6A 5C0NA 2X34A 1VWBB 3STNA 5JR8A 4A1HA 2F73A 2IZGB 1SWCA 3AKMA 4YH0A 3SZIA 2A2UA 4YVBA 1IKJA 1BEBA 1VWEB 2PY1A 3UEWA 3P6DA 4ALOA 1DZPA 1PMPA 4EFGA 1GGLA 1NDJA 2BSZA 5BVSA 2CM4A 3C77X 2IZEB 3FW4A 1P6PA 4MVEA 1YIVA 1PBYA 3NBXX 4O3XB 4GDZA 3L4RA
chains in the Genus database with same CATH topology
5F58A 4YDBA 2JN3A 3FELA 2ACPX 4NNTA 3TGAA 3TF6A 1T8VA 2ACOA 2ANSA 2AH7X 3UAQA 1DF3A 1QY2A 3B2LA 3FR2A 1IKEA 2NNEA 1GT5A 3BRNA 1ICMA 4EXZA 2BHVA 3BDRA 4ORRA 3CBSA 4NP1A 4CV7A 4N7DA 3QKGA 2R56A 3OJYC 1BJ7A 1SY2A 3P02A 4AZPA 1VPRA 2GTLM 5H9LA 1QFTA 2HMBA 3UEUA 4YFQA 1CBQA 5EZ2A 3B2JA 5LJGA 3S5VA 4U9CA 2KTDA 2R74A 3VG6A 3HWFA 1CBSA 1G7NA 1LIBA 3U0DA 1EALA 5IO7A 3ZWEA 1G74A 4OMWA 1YWCA 1JJJA 3EMMA 4WBKA 2OVEA 3U9PC 4DQ3A 3MBTA 1ZNKA 4A1YA 4FQBB 3D97A 2HYSA 4KH8A 4A8ZA 1EPAA 5HAEA 2ASNX 2AMMX 4O3YA 4N7CA 4M7MA 3ZI8A 1SXXA 4Y0QA 5DPQA 1KQXA 4IB9A 2OFRX 2OVSA 4ALBA 2GTLO 4QGXA 1B8EA 2XSTA 1AELA 4FBVA 1G5WA 4ES7A 3EBWA 4WHIA 4ZHGA 5IO5A 4A60A 2GJ5A 5HZ9A 3LHNA 3FMZA 1TXLA 1BSQA 3FA8A 4O49A 3SAOA 2POAA 3O19A 2JOZA 5HA0A 2NNDA 2IFBA 4YBUA 4COTA 1ZNLA 1A3YA 1VYGA 4FGIB 1CJ5A 1AVGI 4BVMA 1E5PA 2NP1A 4ORSA 5H9AA 4I3DA 5F6ZA 1OBQA 2Q9SA 4YFPA 1IIUA 3D4RA 4HPCA 2HNXA 3ELXA 2ALLX 3D95A 3P24A 5HZ6A 5EPQA 2BT9A 2Q4NA 1QFVA 2FT9A 1LICA 5EEEA 5LJDA 3ZW0B 3VG5A 1B0OA 1OEJA 1ERBA 3EYCA 2OFMX 1I04A 4I9RA 4MIRA 4YCEA 3KFIA 3H3IA 1DZKA 1LFOA 2G78A 4ZFXA 4NYQA 2CZTA 2KW1A 5LKEA 1E06A 1X71A 4ZH9A 4YBPA 1DZJA 4O3ZA 5FAZA 1JBHA 1KT5A 3WOVA 1ZNDA 1MX7A 1S7DA 4ID2A 4GETA 1Z24A 1YP7A 3WJEA 2WR6A 1Y9TA 1HBQA 2HZQA 4ZR2A 1CBIA 4AZRA 4GNWA 4KC8A 5AQ6A 1SXWA 3I0AA 2FR3A 4QYPA 4QZUA 4QQ1A 1IW2A 3CWKA 1UREA 1FE3A 2JMBA 4O9SA 5B27A 2MM3A 5LJKA 3UEVA 5IO6A 2CZUA 2JW1A 4L1NA 1RBPA 1OEKA 3EM0A 4INNA 1BSOA 4IB8A 5H9KA 2BS6A 3PH6A 4IB7A 4MVKA 3ZW1A 1OPAA 1MVGA 5LJHA 2HZRA 4OS0A 4AZOA 2X8SA 3ZQ3A 1JJXA 1LNMA 1H91A 3RSWA 4O4OA 1HMTA 3HWDA 3OBLA 3C78X 1KXOA 4GKCA 4ORYA 3APWA 5D8JA 4YCHA 1BRQA 4ARHA 3CQRA 1KT3A 3KFHA 4TKJA 3PPTA 4NLIA 3FENA 3FEKA 4HWMA 1QABE 1HQPA 1PM1X 5BYPA 2M4LA 5KHPA 3P6HA 5FQ7E 1TOUA 2CBSA 3NX1A 5L8OA 2JU8A 3PEDA 1MUPA 2R73A 3WJBA 1KGLA 2L9CA 4MVIA 3RBYA 1YP6A 3VG7A 1GT3A 1UZ2X 3ZW0A 3MX7A 4UU3A 1DZMA 4GK9A 4NYRA 2EU7X 4TQ2A 1JYDA 3BSZE 4XMDA 4Y0RA 2Q2MA 5KICA 1FELA 5FQ6E 1SMPI 2A2GA 1SY3A 2RCQA 4ON1A 1MDCA 5LJEA 1MX8A 3FR5A 1YWAA 1GT4A 5K06A 2JU3A 5LKFA 4HPAA 5F6BA 3RKGA 1ML7A 3ELZA 3VE1A 5HCDC 4LZVA 1EW3A 1JV4A 1B56A 2FRSA 3NX2A 1KZXA 1R0UA 2KD2A 2GC9A 1NGLA 3JQOA 2X45A 4IABA 3VG3A 4IAXA 1PEEA 2Q2PA 1A2DA 3CR6A 1QY0A 3DTQA 1BM5A 1B4MA 4PJ2A 5B29A 4FBOA 3VPJE 4GNYA 2LB6A 2QOSC 4XMHA 3VU1A 4ORXA 3I17A 1A18A 4O4XA 5HWZA 2RA6A 3B2IA 5H9NA 3ZZVA 2QO6A 2DM5A 2ZAGA 5KIDA 3HK1A 1OBUA 3APUA 3WVMA 5LJBA 2YG2A 3VE2A 4LKPA 1EIOA 2Z4IA 5D48A 1HMSA 4LZUA 4I9SA 2CM9A 3NPOA 4LKTA 3KZAA 1Y9LA 1ICNA 4OS3A 1HBPA 5HA1A 1FENA 3ZUIA 4D6AA 5FFHA 2XKLA 1IFBA 1DFVA 3KQ0A 2FR2A 3BX7A 3VG2A 1I06A 1X8QA 2GTFX 2L68A 2WEWA 4CSBA 3FLLA 1SY1A 4IAWA 1G85A 5F1EA 3NQ3A 4TLJA 3B2KA 3BX8A 2AT3X 3K3LA 4ML7B 3CQNA 4ZGUA 1S2PA 4AZMA 4QGWA 2O62A 3BLGA 2G79A 5HBSA 3EBKA 3G7XA 2JU7A 5HZ8A 1ZNGA 1I4UA 4GE1A 1NP4A 1A57A 3APXA 4ZHFA 1QQSA 2CBRA 4ZH6A 1QG5A 1XKIA 3PQSA 1GXAA 3BU9A 2OVAA 3F8AA 1KQWA 1ACDA 3BS2A 4EQAC 1JZUA 4MVLA 4TNNA 2W2BA 2LKKA 5AJBA 1SXUA 3U03A 4HPDA 1FEMA 4I95A 5BVTA 2LFOA 4O3WA 1LIDA 5EDCA 3B2HA 4ZHHA 1HMRA 1SXYA 2WEXA 4RUNA 4EDEA 3HOLA 3N91A 2FS7A 4XMCA 1KOIA 5EEDA 1HN2A 4L3RA 2RCTA 4NNSA 3FW5A 2E4JA 1GKAB 2GTLN 1U17A 2KTSA 1RLBE 4JGLA 5D47A 3T1DA 3WJDA 4I6SA 4KC7A 3RZYA 5CE4A 3V8UA 1YUPA 4WFUA 4QZTA 3DSZA 1XCAA 4YMYA 4QNIA 1O1UA 3P6FA 4AYHA 4AW8A 2A0AA 5HCCC 1GX9A 1X8UA 2OZQA 1CBRA 1SY0A 4IMNA 4M6SA 4R0BA 5CYBA 2FTBA 4BQUA 4YKMA 1QY1A 3BU1A 3BY0A 4HPBA 1GT1A 1NP1A 1O8VA 1ZNEA 1OPBA 5EDBA 5H8TA 5FENA 3P6GA 3PH5A 1OBPA 4YGGA 4IMOA 3KFGA 2RD7C 4FBRA 1LPJA 1DV9A 1D3SA 1KT4A 1O1VA 2X46A 1BRPA 2AT0X 3FEPA 4U8UN 4ORWA 1EQDA 3O22A 3F9DA 4HFOA 5D45A 3CMPA 1KT6A 3GAQA 3NR3A 4QYNA 4O4UA 3WJGA 3FA9A 1EXSA 3STKA 1I05A 4CK4A 5HCEC 2AT6X 3HTYA 1EIIA 2KT4B 2L5PA 3FYFA 3LV4A 1T0VA 2FS6A 2N93A 4UU2A 3HWGA 1LIEA 2G7BA 2YMSA 1ALBA 2QO4A 3NP1A 1TOWA 5FQ8E 4AZQA 4KT5A 3FA6A 4I3BA 3P6EA 5HTEA 4QRLA 4ZHCA 1BSYA 2F09A 2X8TA 3GE2A 1N0SA 3D96A 2X8FA 5L8IA 5L8NA 1SA8A 4K19A 4WFVA 1TW4A 4KIIA 4TKBA 4GH7A 4GZVA 3AKNA 5HZ5A 4ZJ0A 4OMXA 4Y0SA 1YWBA 1EPBA 3NADA 2MWHA 4TJZA 3OE3A 4GU8A 1X8NA 1T68X 5BVQA 2A13A 4EEJA 5AEOA 3NQKA 3WJCA 1YWDA 1GM6A 2QMIA 4IBAA 1GKAA 5D4AA 4QGVA 3S26A 2A3FX 2LBVA 5DG4A 3E3CA 2K62A 1AB0A 1E02A 1BWYA 2W2AA 4YGZA 1ERXA 1IFCA 1AQBA 3JS1A 2P8GA 3FR4A 1QWDA 3P6CA 1U0XA 2FWVA 4U8UM 1ZNHA 2WSJA 3FA7A 1D2UA 2HLVA 5F7GA 2K23A 1CRBA 2OVDA 3APVA 2LBAA 3ZW1B 3TGCA 1BBPA 1JIWI 4MISA 4YFRA 3PP6A 3OD9A 2QO5A 1E00A 4ODDA 3IA8A 3TZSA 1EI5A 2MJIA 3CBCA 2FLJA 5AJCA 1KT7A 5HTDA 1ADLA 3WBGA 3FIQA 4O4SA 3ZUOA 4LQZA 2QM9A 4ZCBA 2L67A 4XMGA 1ZRYA 1LIFA 3PECA 2NNQA 4I3CA 4ZHDA 1FTPA 4NW4A 4D6BA 5LJCA 3ZW2A 1X8PA 3PQUA 2RN4A 3S5XA 3Q6LA 1L6MA 4XMEA 2WWPA 4ZGFA 2AL0X 1KZWA 1VYFA 4PSQA 4GRJA 3C76X 1BLRA 1EUOA 3KFFA 3JSQA 4U3QA 3S60A 1U18A 2W2FA 1X8OA 1GX8A 4ORUA 2Z4HA 2ZAIA 4U8UO 1DC9A 2BS5A 4AZNA 2AT5X 1OEEA 4NLJA 3WJFA 4DQ4A 3SOTA 2RQ0A 2WUTA 1JYJA 1TVQA 1PBOA 1FDQA 3IFBA 5HZQA 2MO5A 1S44A 3F6ZB 3HWEA 3RWXA 3WXQA 1X89A 3VG4A 2MHDA 4KCAA 4RUUA 4Y0PA 1LF7A 4YGHA 1LKEA 4TKHA 2LA7A 4BOEA 2BLGA 3O2YA 4QAEA 3NQ9A 2Q39A 3TGBA 2WQ9A 3MVFA 2AT8X 4OS8A 4YKOA 2AKQA 4YDAA 3HOEA 3UEXA 2WQAE 4XMFA 3STMX 4IB6A 5C0NA 3STNA 5JR8A 4A1HA 2F73A 4YH0A 3AKMA 2A2UA 1IKJA 1BEBA 2PY1A 3UEWA 3P6DA 4ALOA 1DZPA 1PMPA 4EFGA 1GGLA 5BVSA 2CM4A 3C77X 3FW4A 1P6PA 4MVEA 1YIVA 3NBXX 4O3XB 4GDZA 3L4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F58 A;  4YDB A;  2JN3 A;  3FEL A;  2ACP X;  4NNT A;  3TGA A;  3TF6 A;  1T8V A;  2ACO A;  2ANS A;  2AH7 X;  1DF3 A;  1QY2 A;  3B2L A;  3FR2 A;  1IKE A;  2NNE A;  1GT5 A;  3BRN A;  1ICM A;  4EXZ A;  3BDR A;  4ORR A;  3CBS A;  4NP1 A;  4N7D A;  3QKG A;  2R56 A;  3OJY C;  1BJ7 A;  1SY2 A;  4AZP A;  1VPR A;  5H9L A;  1QFT A;  2HMB A;  3UEU A;  4YFQ A;  1CBQ A;  5EZ2 A;  3B2J A;  5LJG A;  2KTD A;  2R74 A;  3VG6 A;  3HWF A;  1CBS A;  1G7N A;  1LIB A;  3U0D A;  1EAL A;  5IO7 A;  1G74 A;  4OMW A;  1YWC A;  1JJJ A;  3EMM A;  4WBK A;  2OVE A;  3U9P C;  4DQ3 A;  3MBT A;  1ZNK A;  4A1Y A;  3D97 A;  2HYS A;  4A8Z A;  1EPA A;  5HAE A;  2ASN X;  2AMM X;  4N7C A;  4M7M A;  1SXX A;  4Y0Q A;  5DPQ A;  1KQX A;  4IB9 A;  2OFR X;  4ALB A;  4QGX A;  1B8E A;  2XST A;  1AEL A;  1G5W A;  4ES7 A;  3EBW A;  4ZHG A;  5IO5 A;  4A60 A;  2GJ5 A;  5HZ9 A;  3FMZ A;  1TXL A;  1BSQ A;  3FA8 A;  3SAO A;  2POA A;  3O19 A;  2JOZ A;  5HA0 A;  2NND A;  2IFB A;  4YBU A;  1ZNL A;  1A3Y A;  1VYG A;  1CJ5 A;  1AVG I;  4BVM A;  1E5P A;  2NP1 A;  4ORS A;  5H9A A;  4I3D A;  5F6Z A;  1OBQ A;  2Q9S A;  4YFP A;  1IIU A;  4HPC A;  2HNX A;  3ELX A;  2ALL X;  3D95 A;  5HZ6 A;  5EPQ A;  2Q4N A;  1QFV A;  2FT9 A;  1LIC A;  5EEE A;  5LJD A;  3VG5 A;  1B0O A;  1OEJ A;  1ERB A;  3EYC A;  2OFM X;  1I04 A;  4I9R A;  4YCE A;  3KFI A;  1DZK A;  1LFO A;  2G78 A;  4ZFX A;  4NYQ A;  2CZT A;  5LKE A;  1E06 A;  1X71 A;  4ZH9 A;  4YBP A;  1DZJ A;  5FAZ A;  1JBH A;  1KT5 A;  1ZND A;  1MX7 A;  1S7D A;  4GET A;  1Z24 A;  1YP7 A;  3WJE A;  2WR6 A;  1HBQ A;  2HZQ A;  4ZR2 A;  1CBI A;  4AZR A;  4GNW A;  5AQ6 A;  1SXW A;  3I0A A;  2FR3 A;  4QYP A;  4QZU A;  1IW2 A;  3CWK A;  1URE A;  1FE3 A;  4O9S A;  5B27 A;  2MM3 A;  5LJK A;  3UEV A;  5IO6 A;  2CZU A;  1RBP A;  1OEK A;  3EM0 A;  5H9K A;  1BSO A;  4IB8 A;  1KZX A;  3PH6 A;  4IB7 A;  4MVK A;  1OPA A;  1MVG A;  5LJH A;  2HZR A;  4OS0 A;  4AZO A;  3ZQ3 A;  1JJX A;  1LNM A;  1H91 A;  3RSW A;  1HMT A;  3HWD A;  5D8J A;  3C78 X;  1KXO A;  4GKC A;  4ORY A;  3APW A;  4YCH A;  1BRQ A;  4ARH A;  3CQR A;  1KT3 A;  3KFH A;  4TKJ A;  3PPT A;  4NLI A;  3FEN A;  3FEK A;  1QAB E;  1HQP A;  1PM1 X;  5KHP A;  3P6H A;  1TOU A;  2CBS A;  3NX1 A;  5L8O A;  2JU8 A;  3PED A;  1MUP A;  2R73 A;  3WJB A;  1KGL A;  2L9C A;  4MVI A;  1YP6 A;  3VG7 A;  1GT3 A;  1UZ2 X;  4UU3 A;  1DZM A;  4NYR A;  2EU7 X;  4TQ2 A;  1JYD A;  3BSZ E;  4XMD A;  4Y0R A;  2Q2M A;  5KIC A;  1FEL A;  2A2G A;  1SY3 A;  2RCQ A;  1MDC A;  5LJE A;  1MX8 A;  3FR5 A;  1YWA A;  1GT4 A;  5K06 A;  2JU3 A;  5LKF A;  4HPA A;  5F6B A;  1ML7 A;  3ELZ A;  5HCD C;  4LZV A;  1EW3 A;  1JV4 A;  1B56 A;  2FRS A;  3NX2 A;  1R0U A;  2GC9 A;  1NGL A;  2X45 A;  3VG3 A;  4IAX A;  1PEE A;  2Q2P A;  1A2D A;  3CR6 A;  1QY0 A;  3DTQ A;  1BM5 A;  1B4M A;  5B29 A;  4GNY A;  2LB6 A;  2QOS C;  4XMH A;  4ORX A;  3I17 A;  1A18 A;  5HWZ A;  2RA6 A;  3B2I A;  5H9N A;  2QO6 A;  2DM5 A;  5KID A;  3HK1 A;  1OBU A;  3APU A;  3WVM A;  5LJB A;  2YG2 A;  4LKP A;  1EIO A;  5D48 A;  1HMS A;  4LZU A;  4I9S A;  2CM9 A;  3NPO A;  4LKT A;  3KZA A;  1ICN A;  4OS3 A;  1HBP A;  5HA1 A;  1FEN A;  3ZUI A;  4D6A A;  5FFH A;  2XKL A;  1IFB A;  1DFV A;  3KQ0 A;  2FR2 A;  3BX7 A;  3VG2 A;  1I06 A;  1X8Q A;  2GTF X;  2L68 A;  2WEW A;  3FLL A;  1SY1 A;  4IAW A;  1G85 A;  5F1E A;  3NQ3 A;  4TLJ A;  3B2K A;  3BX8 A;  2AT3 X;  3K3L A;  3CQN A;  4ZGU A;  1S2P A;  4AZM A;  4QGW A;  2O62 A;  3BLG A;  2G79 A;  5HBS A;  3EBK A;  3G7X A;  2JU7 A;  5HZ8 A;  1ZNG A;  1I4U A;  4GE1 A;  1NP4 A;  1A57 A;  3APX A;  4ZHF A;  1QQS A;  2CBR A;  4ZH6 A;  1QG5 A;  1XKI A;  1GXA A;  3BU9 A;  2OVA A;  3F8A A;  1KQW A;  1ACD A;  3BS2 A;  1JZU A;  4MVL A;  4TNN A;  2W2B A;  2LKK A;  1SXU A;  3U03 A;  4HPD A;  1FEM A;  5BVT A;  2LFO A;  1LID A;  5EDC A;  3B2H A;  4ZHH A;  1HMR A;  1SXY A;  2WEX A;  4RUN A;  4EDE A;  4XMC A;  2FS7 A;  1KOI A;  5EED A;  1HN2 A;  2RCT A;  4NNS A;  3FW5 A;  2E4J A;  1GKA B;  1U17 A;  5D47 A;  1RLB E;  3WJD A;  3T1D A;  3RZY A;  5CE4 A;  1YUP A;  4WFU A;  4QZT A;  3DSZ A;  1XCA A;  4YMY A;  1O1U A;  3P6F A;  4AYH A;  4AW8 A;  2A0A A;  5HCC C;  1GX9 A;  1X8U A;  2OZQ A;  1CBR A;  1SY0 A;  4IMN A;  4M6S A;  4R0B A;  2FTB A;  4BQU A;  4YKM A;  1QY1 A;  3BU1 A;  3BY0 A;  4HPB A;  1GT1 A;  1NP1 A;  1O8V A;  1ZNE A;  1OPB A;  5EDB A;  5H8T A;  5FEN A;  3P6G A;  3PH5 A;  1OBP A;  4YGG A;  4IMO A;  3KFG A;  2RD7 C;  1LPJ A;  1DV9 A;  1D3S A;  1KT4 A;  1O1V A;  2X46 A;  1BRP A;  2AT0 X;  3FEP A;  4ORW A;  1EQD A;  3O22 A;  3F9D A;  4HFO A;  5D45 A;  3CMP A;  1KT6 A;  3GAQ A;  3NR3 A;  4QYN A;  3WJG A;  3FA9 A;  1EXS A;  3STK A;  1I05 A;  4CK4 A;  5HCE C;  2AT6 X;  1EII A;  2KT4 B;  2L5P A;  1T0V A;  2FS6 A;  2N93 A;  4UU2 A;  3HWG A;  1LIE A;  2G7B A;  1ALB A;  2QO4 A;  3NP1 A;  1TOW A;  4AZQ A;  3FA6 A;  4I3B A;  3P6E A;  5HTE A;  4ZHC A;  1BSY A;  1N0S A;  3D96 A;  5L8I A;  5L8N A;  1SA8 A;  4K19 A;  4WFV A;  1TW4 A;  4KII A;  4TKB A;  4GH7 A;  3AKN A;  5HZ5 A;  4ZJ0 A;  4OMX A;  4Y0S A;  1YWB A;  1EPB A;  3NAD A;  4TJZ A;  1X8N A;  1T68 X;  5BVQ A;  2A13 A;  4EEJ A;  3WJC A;  1YWD A;  1GM6 A;  4IBA A;  1GKA A;  5D4A A;  4QGV A;  3S26 A;  2A3F X;  2LBV A;  5DG4 A;  2K62 A;  1AB0 A;  1E02 A;  1BWY A;  2W2A A;  4YGZ A;  1ERX A;  1IFC A;  1AQB A;  3JS1 A;  2P8G A;  3FR4 A;  1QWD A;  3P6C A;  1U0X A;  2FWV A;  1ZNH A;  2WSJ A;  3FA7 A;  1D2U A;  2HLV A;  5F7G A;  2K23 A;  1CRB A;  2OVD A;  3APV A;  2LBA A;  3TGC A;  1BBP A;  4YFR A;  3PP6 A;  2QO5 A;  1E00 A;  4ODD A;  3IA8 A;  3TZS A;  2MJI A;  3CBC A;  2FLJ A;  1KT7 A;  5HTD A;  1ADL A;  3WBG A;  3FIQ A;  3ZUO A;  4ZCB A;  2QM9 A;  2L67 A;  4XMG A;  1ZRY A;  1LIF A;  3PEC A;  2NNQ A;  4I3C A;  4ZHD A;  1FTP A;  4D6B A;  5LJC A;  1X8P A;  3Q6L A;  1L6M A;  4XME A;  2WWP A;  1KZW A;  2AL0 X;  1VYF A;  4PSQ A;  4GRJ A;  3C76 X;  1BLR A;  1EUO A;  3KFF A;  3JSQ A;  1U18 A;  2W2F A;  1X8O A;  1GX8 A;  4ORU A;  1DC9 A;  4AZN A;  2AT5 X;  1OEE A;  4NLJ A;  3WJF A;  4DQ4 A;  2RQ0 A;  2WUT A;  1JYJ A;  1TVQ A;  1PBO A;  1FDQ A;  3IFB A;  5HZQ A;  2MO5 A;  1S44 A;  3HWE A;  3WXQ A;  1X89 A;  3VG4 A;  4RUU A;  4Y0P A;  1LF7 A;  4YGH A;  1LKE A;  4TKH A;  4BOE A;  2BLG A;  3O2Y A;  4QAE A;  3NQ9 A;  2Q39 A;  3TGB A;  2WQ9 A;  3MVF A;  2AT8 X;  4OS8 A;  4YKO A;  2AKQ A;  4YDA A;  3UEX A;  2WQA E;  4XMF A;  3STM X;  4IB6 A;  5C0N A;  3STN A;  5JR8 A;  4A1H A;  2F73 A;  4YH0 A;  3AKM A;  2A2U A;  1IKJ A;  1BEB A;  2PY1 A;  3UEW A;  3P6D A;  4ALO A;  1DZP A;  1PMP A;  4EFG A;  1GGL A;  5BVS A;  2CM4 A;  3C77 X;  3FW4 A;  1P6P A;  1YIV A;  3L4R A; 
#chains in the Genus database with same CATH topology
 5F58 A;  1SRF A;  4YDB A;  2JN3 A;  4NV8 A;  3FEL A;  1LEL A;  2ACP X;  4NNT A;  5B5F A;  3TGA A;  3TF6 A;  1T8V A;  2ACO A;  2ANS A;  2AH7 X;  3UAQ A;  1DF3 A;  1QY2 A;  3B2L A;  3FR2 A;  1MEP A;  1IKE A;  2NNE A;  1GT5 A;  3BRN A;  1ICM A;  4EXZ A;  2BHV A;  1SWK A;  3BDR A;  4ORR A;  1NC9 A;  3CBS A;  4NP1 A;  1VWC B;  4CV7 A;  4N7D A;  3QKG A;  1VWR B;  2R56 A;  3OJY C;  1BJ7 A;  1SY2 A;  3P02 A;  5B10 O;  4AZP A;  1VPR A;  2C1Q A;  2GTL M;  1I78 A;  5H9L A;  1NQM A;  1QFT A;  1RXJ A;  2HMB A;  3UEU A;  4YFQ A;  1CBQ A;  2JGS A;  5EZ2 A;  3B2J A;  5LJG A;  3S5V A;  4U9C A;  2KTD A;  2IZF B;  2R74 A;  3VG6 A;  3VGW A;  3HWF A;  3SLO A;  2IZK A;  4NV7 A;  4Z2P A;  1CBS A;  1G7N A;  1LIB A;  3U0D A;  1EAL A;  3FDC A;  3RY1 A;  5IO7 A;  1NQN A;  1SWD A;  2G5L A;  3AEH A;  3ZWE A;  1G74 A;  4OMW A;  1YWC A;  1JJJ A;  3EMM A;  4WBK A;  2OVE A;  2UYW A;  4OEL A;  3U9P C;  4DQ3 A;  3MBT A;  2A8G A;  2RTA A;  3QQ2 A;  2Y3F A;  1ZNK A;  4A1Y A;  4FQB B;  3D97 A;  2HYS A;  4KH8 A;  2AF5 A;  4A8Z A;  1EPA A;  5HAE A;  2ASN X;  2RTH B;  2AMM X;  4O3Y A;  4N7C A;  4M7M A;  4Y5D A;  4BX7 B;  3ZI8 A;  4BX5 B;  1SXX A;  4Y0Q A;  5DPQ A;  1UYN X;  1KQX A;  4IB9 A;  3T6L A;  2OFR X;  2OVS A;  4ALB A;  2GH7 A;  2GTL O;  4QGX A;  1B8E A;  2XST A;  1AEL A;  4FBV A;  3KVN A;  4CPH B;  1G5W A;  4ES7 A;  3EBW A;  1SWH A;  4WHI A;  4ZHG A;  1SWB A;  4A60 A;  2GJ5 A;  1LCZ A;  1SLE B;  3LHN A;  3FMZ A;  1TXL A;  3RDX A;  5F2B A;  5HZ9 A;  1BSQ A;  3FA8 A;  1SWR A;  2X55 A;  4O49 A;  2FGS A;  3SAO A;  2POA A;  2RTF B;  2JOZ A;  3O19 A;  5HA0 A;  2NND A;  2FHN X;  2IFB A;  1JQP A;  4YBU A;  1ZNL A;  4COT A;  1A3Y A;  1VYG A;  4FGI B;  1CJ5 A;  3HPE A;  1AVG I;  4BVM A;  1E5P A;  2NP1 A;  4ORS A;  5H9A A;  4I3D A;  5F6Z A;  3X00 A;  1OBQ A;  3T2W A;  2Q9S A;  1WUB A;  1IIU A;  4YFP A;  3D4R A;  4HPC A;  2HNX A;  3ELX A;  2DJF A;  2ALL X;  3D95 A;  3P24 A;  2OY5 O;  5EPQ A;  5HZ6 A;  2BT9 A;  4DCB A;  2Q4N A;  1QFV A;  2FT9 A;  1LIC A;  3EW1 A;  5EEE A;  5LJD A;  3ZW0 B;  3VG5 A;  1B0O A;  1E2T A;  1HY2 A;  1OEJ A;  3SLT A;  2I5Z O;  1ERB A;  3EYC A;  2OFM X;  1I04 A;  4I9R A;  2RTE B;  2MF6 A;  4MIR A;  3FID A;  1VWQ B;  3KFI A;  3H3I A;  4YCE A;  1DZK A;  1LFO A;  2G78 A;  4Z2O A;  4ZFX A;  4NYQ A;  2CZT A;  2KW1 A;  5LKE A;  4OKA A;  1X71 A;  1E06 A;  1SLG B;  1SRH A;  4ZH9 A;  5L3Y A;  5B5G A;  4YBP A;  1DZJ A;  4O3Z A;  5FAZ A;  2RTB B;  1JBH A;  1SWP A;  1KT5 A;  1W6F A;  3VHH A;  3WOV A;  2AVI A;  1ZND A;  1MX7 A;  1S7D A;  4ID2 A;  1RXH A;  2UZ2 A;  4GET A;  1Z24 A;  1YP7 A;  3WJE A;  2VDF A;  2WR6 A;  1Y9T A;  3WZN A;  1HBQ A;  2HZQ A;  4ZR2 A;  1CBI A;  1K24 A;  2IZL B;  4AZR A;  4GNW A;  2IZD B;  4KC8 A;  5AQ6 A;  1SXW A;  3I0A A;  2FR3 A;  4QYP A;  1VWN B;  4QQ1 A;  4QZU A;  1IW2 A;  1I9H A;  3CWK A;  2OL8 O;  1URE A;  4GD9 A;  1FE3 A;  2JMB A;  4O9S A;  5B27 A;  4BX7 A;  2MM3 A;  4EKV A;  5LJK A;  3UEV A;  5IO6 A;  2CZU A;  2JW1 A;  2QOM A;  1SWQ A;  4L1N A;  1LCW A;  1RBP A;  1OEK A;  3EM0 A;  4INN A;  1BSO A;  4IB8 A;  5H9K A;  2BS6 A;  3PH6 A;  4IB7 A;  4MVK A;  3ZW1 A;  1OPA A;  5K68 A;  1MVG A;  5LJH A;  3Q34 A;  2HZR A;  2RTK A;  3RKG A;  4CPH A;  4OS0 A;  4AZO A;  2CAM A;  2DJG A;  5HCD C;  2X8S A;  1Y55 X;  1Y0G A;  1W5R A;  1OSP O;  3ZQ3 A;  1LNM A;  1MK5 A;  1H91 A;  1JJX A;  3RSW A;  4O4O A;  2VFB A;  1HMT A;  1Y53 X;  3HWD A;  3OBL A;  3C78 X;  1KXO A;  1Y52 X;  4GKC A;  3APW A;  4ORY A;  4GGZ A;  4YCH A;  1VWL B;  1BRQ A;  4ARH A;  1SRI A;  3CQR A;  1KT3 A;  3KFH A;  4TKJ A;  3PPT A;  4NLI A;  3FEN A;  3FEK A;  4HWM A;  3VE1 A;  1QAB E;  1HQP A;  1PM1 X;  1SWU A;  2M4L A;  5BYP A;  5KHP A;  2OF9 A;  1N43 A;  3P6H A;  5FQ7 E;  1TOU A;  2CBS A;  3NX1 A;  1SWT A;  5L8O A;  2JU8 A;  3PED A;  1MUP A;  2R73 A;  2RTI B;  2X56 A;  3WJB A;  1KGL A;  2L9C A;  4MVI A;  3RBY A;  1YP6 A;  1VWI B;  1K3B A;  3VG7 A;  1GT3 A;  1UZ2 X;  3ZW0 A;  3MX7 A;  4UU3 A;  1DZM A;  4GK9 A;  4NYR A;  2EU7 X;  4TQ2 A;  1JYD A;  3BSZ E;  4XMD A;  4Y0R A;  2Q2M A;  1LDQ A;  1FEL A;  5KIC A;  2RTP B;  5FQ6 E;  1SMP I;  2A2G A;  1SY3 A;  1RSU B;  2RCQ A;  1VWP B;  4ON1 A;  1MDC A;  5LJE A;  2RTJ A;  1MX8 A;  5JD2 A;  5IRA A;  3FR5 A;  1YWA A;  1GT4 A;  3WYQ A;  4CPF A;  2JU3 A;  5K06 A;  5LKF A;  1GX3 A;  1DF8 A;  4HPA A;  5F6B A;  1ML7 A;  1SRJ A;  3ELZ A;  5B2A O;  1VWK B;  1EW3 A;  1JV4 A;  1B56 A;  2FRS A;  3NX2 A;  4LZV A;  1KZX A;  1R0U A;  2KD2 A;  2GC9 A;  4U46 A;  1NGL A;  3JQO A;  2X45 A;  4IAB A;  3VG3 A;  4IAX A;  1PEE A;  2Q2P A;  4Z2V A;  1A2D A;  3CR6 A;  3LTW A;  1QY0 A;  2IZC B;  3DTQ A;  1BM5 A;  1B4M A;  4PJ2 A;  5B29 A;  4FBO A;  1MOY A;  4JNJ A;  1HQQ A;  1STP A;  4GNY A;  3VPJ E;  2LB6 A;  2QOS C;  1VWA B;  4XMH A;  4ORX A;  3VU1 A;  3I17 A;  1A18 A;  1FJ1 E;  4O4X A;  5HWZ A;  2RA6 A;  3B2I A;  5H9N A;  3ZZV A;  2QO6 A;  2DM5 A;  3MM0 A;  4IRW A;  2ZAG A;  1MM9 A;  2VFC A;  5KID A;  5IRW A;  3HK1 A;  1OBU A;  2RTL A;  3APU A;  3VHI A;  3WVM A;  5LJB A;  2YG2 A;  3VE2 A;  4LKP A;  1EIO A;  2Z4I A;  5D48 A;  1HMS A;  2OYB O;  4LZU A;  3RE6 A;  4I9S A;  3VHM A;  4C5P A;  2CM9 A;  3NPO A;  4LKT A;  5CSE A;  3KZA A;  1Y9L A;  1ICN A;  4OS3 A;  1HBP A;  5HA1 A;  2OY7 A;  3RY2 A;  1FEN A;  1NBX A;  1KL3 A;  3ZUI A;  4D6A A;  4GGR A;  5FFH A;  4CPI A;  2A5C A;  2XKL A;  1IFB A;  1DFV A;  3KQ0 A;  2FR2 A;  3BX7 A;  3VG2 A;  1I06 A;  2RTQ B;  1X8Q A;  2GTF X;  2L68 A;  2WEW A;  4CSB A;  2IZJ A;  3FLL A;  1SY1 A;  1SWF A;  1G85 A;  4IAW A;  4GGT A;  5F1E A;  3RDO A;  4DNE A;  4JHQ A;  3NQ3 A;  4CDD A;  2FKG A;  1JJU A;  3B2K A;  3BX8 A;  2AT3 X;  3K3L A;  4ML7 B;  3CQN A;  4TLJ A;  2Y32 A;  3WZQ A;  4ZGU A;  5IXG A;  1SRE A;  1S2P A;  4AZM A;  1VWH B;  4QGW A;  2O62 A;  1KL4 A;  2G79 A;  3BLG A;  3AUM O;  5HBS A;  1RAV A;  3EBK A;  3G7X A;  2JU7 A;  4OEM A;  5HZ8 A;  1PTS A;  4B55 A;  1ZNG A;  1I4U A;  4GE1 A;  1NP4 A;  1A57 A;  3APX A;  4ZHF A;  1QQS A;  2CBR A;  4I60 A;  1QG5 A;  4GUZ A;  4ZH6 A;  1XKI A;  3PQS A;  1GXA A;  1RST B;  1SLF B;  3BU9 A;  2OVA A;  3F8A A;  1KQW A;  1ACD A;  1RXK A;  3BS2 A;  4EQA C;  1JZU A;  4MVL A;  4TNN A;  2W2B A;  2LKK A;  4CDE A;  5AJB A;  1SXU A;  3U03 A;  2RTR B;  4HPD A;  3RDQ A;  1FEM A;  4CDC A;  4I95 A;  1N4J A;  3RDU A;  2LFO A;  3WZO A;  5BVT A;  1N7Y A;  4O3W A;  1SWN A;  1VWG B;  1LID A;  5EDC A;  3B2H A;  4Z6J A;  1HMR A;  4ZHH A;  4BX5 A;  4BX6 B;  1SXY A;  1N9M A;  2WEX A;  4RUN A;  4EDE A;  3CKF A;  3HOL A;  3N91 A;  2FS7 A;  4XMC A;  1KOI A;  5EED A;  1HN2 A;  2OF8 A;  4L3R A;  2RCT A;  4NNS A;  3FW5 A;  2E4J A;  1GKA B;  2GTL N;  4BGF A;  1U17 A;  2KTS A;  1RLB E;  4JGL A;  4JO6 A;  5D47 A;  2RTD B;  3T1D A;  4I6S A;  3WJD A;  4KC7 A;  3RZY A;  5IO5 A;  5CE4 A;  3V8U A;  1YUP A;  4WFU A;  4QZT A;  3DSZ A;  1XCA A;  1SWG A;  2BC3 A;  4QNI A;  4YMY A;  1SWA A;  1VWD B;  1STR B;  1O1U A;  3PDF A;  3P6F A;  3T6F A;  4AYH A;  2RTG B;  1VWF B;  2OL6 O;  4AW8 A;  4Z27 A;  2A0A A;  5HCC C;  3T2X A;  1GX9 A;  1X8U A;  2OZQ A;  1CBR A;  1SY0 A;  4IMN A;  4M6S A;  4R0B A;  5CYB A;  2FTB A;  1KFF A;  4BQU A;  4YKM A;  1KL5 A;  1QY1 A;  1IJ8 A;  3BU1 A;  3BY0 A;  4HPB A;  1GT1 A;  1NP1 A;  1O8V A;  1W4T A;  1ZNE A;  1OPB A;  5EDB A;  5H8T A;  3RE5 A;  5FEN A;  4BJ8 A;  3P6G A;  3PH5 A;  1OBP A;  2IZH B;  4YGG A;  4IMO A;  3KFG A;  2RD7 C;  5D8J A;  4FBR A;  1LPJ A;  2Y3E A;  1DV9 A;  1D3S A;  1KT4 A;  1O1V A;  1VWM B;  2X46 A;  1BRP A;  2AT0 X;  3FEP A;  4U8U N;  1SWS A;  1EQD A;  3O22 A;  4ORW A;  3EW2 A;  3F9D A;  4HFO A;  1SWE A;  3CMP A;  5D45 A;  1KT6 A;  3GAQ A;  3NR3 A;  4QYN A;  5CHK A;  4O4U A;  3WJG A;  3FA9 A;  1EXS A;  3STK A;  3WZP A;  1I05 A;  4CK4 A;  5HCE C;  2AT6 X;  3HTY A;  1EII A;  2KT4 B;  2L5P A;  3FYF A;  1AVE A;  1JMX A;  1T0V A;  2FS6 A;  2N93 A;  3HWG A;  3LV4 A;  2OY1 O;  1LIE A;  2G7B A;  4UU2 A;  2IZI A;  3SZJ A;  2RTM A;  1ALB A;  2QO4 A;  2YMS A;  3NP1 A;  1TOW A;  5FQ8 E;  4AZQ A;  4KT5 A;  3FA6 A;  4I3B A;  3P6E A;  1SWL A;  5HTE A;  4CDF A;  4BBO A;  4QRL A;  4ZHC A;  1BSY A;  2F09 A;  2X8T A;  1SWJ A;  1N0S A;  3GE2 A;  3D96 A;  2X8F A;  4Y59 A;  5L8I A;  4CPE A;  5L8N A;  1SA8 A;  4K19 A;  2OY8 A;  4WFV A;  1TW4 A;  4KII A;  4TKB A;  2ZSC A;  4GH7 A;  4GZV A;  3AKN A;  5HZ5 A;  1SLD B;  4ZJ0 A;  4OMX A;  4Y0S A;  1YWB A;  4Z28 A;  1EPB A;  3NAD A;  2WPU A;  4BX6 A;  2MWH A;  4TJZ A;  3OE3 A;  4GU8 A;  3SZH A;  1X8N A;  1T68 X;  5BVQ A;  3RDS A;  2A13 A;  4EEJ A;  5AEO A;  3NQK A;  3WJC A;  1YWD A;  1GM6 A;  1VYO A;  2QMI A;  1WBI A;  1GKA A;  4IBA A;  5D4A A;  4QGV A;  2C4I A;  2X4M A;  2G8C O;  5K67 A;  3S26 A;  2A3F X;  2LBV A;  5DG4 A;  1JMZ A;  3E3C A;  2K62 A;  1AB0 A;  1E02 A;  1BWY A;  1LCV A;  2W2A A;  1ERX A;  4YGZ A;  1IFC A;  1AQB A;  3JS1 A;  2P8G A;  3FR4 A;  5IRU A;  1QWD A;  1LUQ A;  3P6C A;  1U0X A;  2FWV A;  4U8U M;  1ZNH A;  2WSJ A;  3FA7 A;  1D2U A;  2HLV A;  5F7G A;  2K23 A;  1CRB A;  2PI3 O;  2OVD A;  3APV A;  2LBA A;  3ZW1 B;  3TGC A;  1STS B;  1BBP A;  1JIW I;  1UYO X;  4MIS A;  3PP6 A;  4YFR A;  3OD9 A;  2QO5 A;  1E00 A;  4ODD A;  3IA8 A;  3TZS A;  1EI5 A;  2FKJ A;  2MJI A;  3CBC A;  2FLJ A;  3EC5 A;  4MEE A;  5AJC A;  5B3M O;  1KT7 A;  5HTD A;  1ADL A;  3WBG A;  1SRG A;  3FIQ A;  4O4S A;  3ZUO A;  4LQZ A;  2QM9 A;  4ZCB A;  2L67 A;  4XMG A;  1ZRY A;  1LIF A;  3PEC A;  2NNQ A;  4I3C A;  4ZHD A;  1FTP A;  2QCB A;  3WYP A;  1LDO A;  2RTC B;  4NW4 A;  4D6B A;  5LJC A;  3D9W A;  3ZW2 A;  1X8P A;  3PQU A;  2RN4 A;  3CKG A;  3Q6L A;  3S5X A;  1L6M A;  4XME A;  2WWP A;  4ZGF A;  2AL0 X;  1KZW A;  1VYF A;  4PSQ A;  4GRJ A;  3C76 X;  1BLR A;  1EUO A;  2HKD A;  2RTN B;  3KFF A;  3JSQ A;  4U3Q A;  3S60 A;  1U18 A;  2W2F A;  1VWO B;  1GX8 A;  1X8O A;  2Z4H A;  2ZAI A;  4ORU A;  4U8U O;  1DC9 A;  2BS5 A;  2OFB A;  1VWJ B;  4AZN A;  2AT5 X;  1OEE A;  3RDM A;  4NLJ A;  3WJF A;  4DQ4 A;  3SOT A;  1N9Y A;  2RQ0 A;  2WUT A;  1JYJ A;  2OFA A;  1TVQ A;  1PBO A;  1FDQ A;  3IFB A;  5HZQ A;  2MO5 A;  1S44 A;  2A5B A;  2F01 A;  2C1S A;  3F6Z B;  3HWE A;  3RWX A;  1AVD A;  3WXQ A;  3SLJ A;  1X89 A;  2OL7 A;  1SWO A;  2IZB A;  3VG4 A;  3PK2 A;  2MHD A;  4KCA A;  4RUU A;  4Y0P A;  1LF7 A;  4YGH A;  1LKE A;  4TKH A;  2LA7 A;  2IZA A;  4GDA A;  2X32 A;  4GJS A;  2I5V O;  4BOE A;  2BLG A;  3O2Y A;  4QAE A;  3NQ9 A;  2Q39 A;  3TGB A;  2WQ9 A;  3MVF A;  2AT8 X;  3MG5 A;  4OS8 A;  4YKO A;  1HXL A;  2RTO B;  1HXZ A;  2AKQ A;  4GJV A;  3HOE A;  4YDA A;  3UEX A;  2WQA E;  4BCS A;  5B11 O;  4XMF A;  3STM X;  2FHL A;  4IB6 A;  5C0N A;  2X34 A;  1VWB B;  3STN A;  5JR8 A;  4A1H A;  2F73 A;  2IZG B;  1SWC A;  3AKM A;  4YH0 A;  3SZI A;  2A2U A;  4YVB A;  1IKJ A;  1BEB A;  1VWE B;  2PY1 A;  3UEW A;  3P6D A;  4ALO A;  1DZP A;  1PMP A;  4EFG A;  1GGL A;  1NDJ A;  2BSZ A;  5BVS A;  2CM4 A;  3C77 X;  2IZE B;  3FW4 A;  1P6P A;  4MVE A;  1YIV A;  1PBY A;  3NBX X;  4O3X B;  4GDZ A;  3L4R A; 
#chains in the Genus database with same CATH homology
 5F58 A;  4YDB A;  2JN3 A;  3FEL A;  2ACP X;  4NNT A;  3TGA A;  3TF6 A;  1T8V A;  2ACO A;  2ANS A;  2AH7 X;  3UAQ A;  1DF3 A;  1QY2 A;  3B2L A;  3FR2 A;  1IKE A;  2NNE A;  1GT5 A;  3BRN A;  1ICM A;  4EXZ A;  2BHV A;  3BDR A;  4ORR A;  3CBS A;  4NP1 A;  4CV7 A;  4N7D A;  3QKG A;  2R56 A;  3OJY C;  1BJ7 A;  1SY2 A;  3P02 A;  4AZP A;  1VPR A;  2GTL M;  5H9L A;  1QFT A;  2HMB A;  3UEU A;  4YFQ A;  1CBQ A;  5EZ2 A;  3B2J A;  5LJG A;  3S5V A;  4U9C A;  2KTD A;  2R74 A;  3VG6 A;  3HWF A;  1CBS A;  1G7N A;  1LIB A;  3U0D A;  1EAL A;  5IO7 A;  3ZWE A;  1G74 A;  4OMW A;  1YWC A;  1JJJ A;  3EMM A;  4WBK A;  2OVE A;  3U9P C;  4DQ3 A;  3MBT A;  1ZNK A;  4A1Y A;  4FQB B;  3D97 A;  2HYS A;  4KH8 A;  4A8Z A;  1EPA A;  5HAE A;  2ASN X;  2AMM X;  4O3Y A;  4N7C A;  4M7M A;  3ZI8 A;  1SXX A;  4Y0Q A;  5DPQ A;  1KQX A;  4IB9 A;  2OFR X;  2OVS A;  4ALB A;  2GTL O;  4QGX A;  1B8E A;  2XST A;  1AEL A;  4FBV A;  1G5W A;  4ES7 A;  3EBW A;  4WHI A;  4ZHG A;  5IO5 A;  4A60 A;  2GJ5 A;  5HZ9 A;  3LHN A;  3FMZ A;  1TXL A;  1BSQ A;  3FA8 A;  4O49 A;  3SAO A;  2POA A;  3O19 A;  2JOZ A;  5HA0 A;  2NND A;  2IFB A;  4YBU A;  4COT A;  1ZNL A;  1A3Y A;  1VYG A;  4FGI B;  1CJ5 A;  1AVG I;  4BVM A;  1E5P A;  2NP1 A;  4ORS A;  5H9A A;  4I3D A;  5F6Z A;  1OBQ A;  2Q9S A;  4YFP A;  1IIU A;  3D4R A;  4HPC A;  2HNX A;  3ELX A;  2ALL X;  3D95 A;  3P24 A;  5HZ6 A;  5EPQ A;  2BT9 A;  2Q4N A;  1QFV A;  2FT9 A;  1LIC A;  5EEE A;  5LJD A;  3ZW0 B;  3VG5 A;  1B0O A;  1OEJ A;  1ERB A;  3EYC A;  2OFM X;  1I04 A;  4I9R A;  4MIR A;  4YCE A;  3KFI A;  3H3I A;  1DZK A;  1LFO A;  2G78 A;  4ZFX A;  4NYQ A;  2CZT A;  2KW1 A;  5LKE A;  1E06 A;  1X71 A;  4ZH9 A;  4YBP A;  1DZJ A;  4O3Z A;  5FAZ A;  1JBH A;  1KT5 A;  3WOV A;  1ZND A;  1MX7 A;  1S7D A;  4ID2 A;  4GET A;  1Z24 A;  1YP7 A;  3WJE A;  2WR6 A;  1Y9T A;  1HBQ A;  2HZQ A;  4ZR2 A;  1CBI A;  4AZR A;  4GNW A;  4KC8 A;  5AQ6 A;  1SXW A;  3I0A A;  2FR3 A;  4QYP A;  4QZU A;  4QQ1 A;  1IW2 A;  3CWK A;  1URE A;  1FE3 A;  2JMB A;  4O9S A;  5B27 A;  2MM3 A;  5LJK A;  3UEV A;  5IO6 A;  2CZU A;  2JW1 A;  4L1N A;  1RBP A;  1OEK A;  3EM0 A;  4INN A;  1BSO A;  4IB8 A;  5H9K A;  2BS6 A;  3PH6 A;  4IB7 A;  4MVK A;  3ZW1 A;  1OPA A;  1MVG A;  5LJH A;  2HZR A;  4OS0 A;  4AZO A;  2X8S A;  3ZQ3 A;  1JJX A;  1LNM A;  1H91 A;  3RSW A;  4O4O A;  1HMT A;  3HWD A;  3OBL A;  3C78 X;  1KXO A;  4GKC A;  4ORY A;  3APW A;  5D8J A;  4YCH A;  1BRQ A;  4ARH A;  3CQR A;  1KT3 A;  3KFH A;  4TKJ A;  3PPT A;  4NLI A;  3FEN A;  3FEK A;  4HWM A;  1QAB E;  1HQP A;  1PM1 X;  5BYP A;  2M4L A;  5KHP A;  3P6H A;  5FQ7 E;  1TOU A;  2CBS A;  3NX1 A;  5L8O A;  2JU8 A;  3PED A;  1MUP A;  2R73 A;  3WJB A;  1KGL A;  2L9C A;  4MVI A;  3RBY A;  1YP6 A;  3VG7 A;  1GT3 A;  1UZ2 X;  3ZW0 A;  3MX7 A;  4UU3 A;  1DZM A;  4GK9 A;  4NYR A;  2EU7 X;  4TQ2 A;  1JYD A;  3BSZ E;  4XMD A;  4Y0R A;  2Q2M A;  5KIC A;  1FEL A;  5FQ6 E;  1SMP I;  2A2G A;  1SY3 A;  2RCQ A;  4ON1 A;  1MDC A;  5LJE A;  1MX8 A;  3FR5 A;  1YWA A;  1GT4 A;  5K06 A;  2JU3 A;  5LKF A;  4HPA A;  5F6B A;  3RKG A;  1ML7 A;  3ELZ A;  3VE1 A;  5HCD C;  4LZV A;  1EW3 A;  1JV4 A;  1B56 A;  2FRS A;  3NX2 A;  1KZX A;  1R0U A;  2KD2 A;  2GC9 A;  1NGL A;  3JQO A;  2X45 A;  4IAB A;  3VG3 A;  4IAX A;  1PEE A;  2Q2P A;  1A2D A;  3CR6 A;  1QY0 A;  3DTQ A;  1BM5 A;  1B4M A;  4PJ2 A;  5B29 A;  4FBO A;  3VPJ E;  4GNY A;  2LB6 A;  2QOS C;  4XMH A;  3VU1 A;  4ORX A;  3I17 A;  1A18 A;  4O4X A;  5HWZ A;  2RA6 A;  3B2I A;  5H9N A;  3ZZV A;  2QO6 A;  2DM5 A;  2ZAG A;  5KID A;  3HK1 A;  1OBU A;  3APU A;  3WVM A;  5LJB A;  2YG2 A;  3VE2 A;  4LKP A;  1EIO A;  2Z4I A;  5D48 A;  1HMS A;  4LZU A;  4I9S A;  2CM9 A;  3NPO A;  4LKT A;  3KZA A;  1Y9L A;  1ICN A;  4OS3 A;  1HBP A;  5HA1 A;  1FEN A;  3ZUI A;  4D6A A;  5FFH A;  2XKL A;  1IFB A;  1DFV A;  3KQ0 A;  2FR2 A;  3BX7 A;  3VG2 A;  1I06 A;  1X8Q A;  2GTF X;  2L68 A;  2WEW A;  4CSB A;  3FLL A;  1SY1 A;  4IAW A;  1G85 A;  5F1E A;  3NQ3 A;  4TLJ A;  3B2K A;  3BX8 A;  2AT3 X;  3K3L A;  4ML7 B;  3CQN A;  4ZGU A;  1S2P A;  4AZM A;  4QGW A;  2O62 A;  3BLG A;  2G79 A;  5HBS A;  3EBK A;  3G7X A;  2JU7 A;  5HZ8 A;  1ZNG A;  1I4U A;  4GE1 A;  1NP4 A;  1A57 A;  3APX A;  4ZHF A;  1QQS A;  2CBR A;  4ZH6 A;  1QG5 A;  1XKI A;  3PQS A;  1GXA A;  3BU9 A;  2OVA A;  3F8A A;  1KQW A;  1ACD A;  3BS2 A;  4EQA C;  1JZU A;  4MVL A;  4TNN A;  2W2B A;  2LKK A;  5AJB A;  1SXU A;  3U03 A;  4HPD A;  1FEM A;  4I95 A;  5BVT A;  2LFO A;  4O3W A;  1LID A;  5EDC A;  3B2H A;  4ZHH A;  1HMR A;  1SXY A;  2WEX A;  4RUN A;  4EDE A;  3HOL A;  3N91 A;  2FS7 A;  4XMC A;  1KOI A;  5EED A;  1HN2 A;  4L3R A;  2RCT A;  4NNS A;  3FW5 A;  2E4J A;  1GKA B;  2GTL N;  1U17 A;  2KTS A;  1RLB E;  4JGL A;  5D47 A;  3T1D A;  3WJD A;  4I6S A;  4KC7 A;  3RZY A;  5CE4 A;  3V8U A;  1YUP A;  4WFU A;  4QZT A;  3DSZ A;  1XCA A;  4YMY A;  4QNI A;  1O1U A;  3P6F A;  4AYH A;  4AW8 A;  2A0A A;  5HCC C;  1GX9 A;  1X8U A;  2OZQ A;  1CBR A;  1SY0 A;  4IMN A;  4M6S A;  4R0B A;  5CYB A;  2FTB A;  4BQU A;  4YKM A;  1QY1 A;  3BU1 A;  3BY0 A;  4HPB A;  1GT1 A;  1NP1 A;  1O8V A;  1ZNE A;  1OPB A;  5EDB A;  5H8T A;  5FEN A;  3P6G A;  3PH5 A;  1OBP A;  4YGG A;  4IMO A;  3KFG A;  2RD7 C;  4FBR A;  1LPJ A;  1DV9 A;  1D3S A;  1KT4 A;  1O1V A;  2X46 A;  1BRP A;  2AT0 X;  3FEP A;  4U8U N;  4ORW A;  1EQD A;  3O22 A;  3F9D A;  4HFO A;  5D45 A;  3CMP A;  1KT6 A;  3GAQ A;  3NR3 A;  4QYN A;  4O4U A;  3WJG A;  3FA9 A;  1EXS A;  3STK A;  1I05 A;  4CK4 A;  5HCE C;  2AT6 X;  3HTY A;  1EII A;  2KT4 B;  2L5P A;  3FYF A;  3LV4 A;  1T0V A;  2FS6 A;  2N93 A;  4UU2 A;  3HWG A;  1LIE A;  2G7B A;  2YMS A;  1ALB A;  2QO4 A;  3NP1 A;  1TOW A;  5FQ8 E;  4AZQ A;  4KT5 A;  3FA6 A;  4I3B A;  3P6E A;  5HTE A;  4QRL A;  4ZHC A;  1BSY A;  2F09 A;  2X8T A;  3GE2 A;  1N0S A;  3D96 A;  2X8F A;  5L8I A;  5L8N A;  1SA8 A;  4K19 A;  4WFV A;  1TW4 A;  4KII A;  4TKB A;  4GH7 A;  4GZV A;  3AKN A;  5HZ5 A;  4ZJ0 A;  4OMX A;  4Y0S A;  1YWB A;  1EPB A;  3NAD A;  2MWH A;  4TJZ A;  3OE3 A;  4GU8 A;  1X8N A;  1T68 X;  5BVQ A;  2A13 A;  4EEJ A;  5AEO A;  3NQK A;  3WJC A;  1YWD A;  1GM6 A;  2QMI A;  4IBA A;  1GKA A;  5D4A A;  4QGV A;  3S26 A;  2A3F X;  2LBV A;  5DG4 A;  3E3C A;  2K62 A;  1AB0 A;  1E02 A;  1BWY A;  2W2A A;  4YGZ A;  1ERX A;  1IFC A;  1AQB A;  3JS1 A;  2P8G A;  3FR4 A;  1QWD A;  3P6C A;  1U0X A;  2FWV A;  4U8U M;  1ZNH A;  2WSJ A;  3FA7 A;  1D2U A;  2HLV A;  5F7G A;  2K23 A;  1CRB A;  2OVD A;  3APV A;  2LBA A;  3ZW1 B;  3TGC A;  1BBP A;  1JIW I;  4MIS A;  4YFR A;  3PP6 A;  3OD9 A;  2QO5 A;  1E00 A;  4ODD A;  3IA8 A;  3TZS A;  1EI5 A;  2MJI A;  3CBC A;  2FLJ A;  5AJC A;  1KT7 A;  5HTD A;  1ADL A;  3WBG A;  3FIQ A;  4O4S A;  3ZUO A;  4LQZ A;  2QM9 A;  4ZCB A;  2L67 A;  4XMG A;  1ZRY A;  1LIF A;  3PEC A;  2NNQ A;  4I3C A;  4ZHD A;  1FTP A;  4NW4 A;  4D6B A;  5LJC A;  3ZW2 A;  1X8P A;  3PQU A;  2RN4 A;  3S5X A;  3Q6L A;  1L6M A;  4XME A;  2WWP A;  4ZGF A;  2AL0 X;  1KZW A;  1VYF A;  4PSQ A;  4GRJ A;  3C76 X;  1BLR A;  1EUO A;  3KFF A;  3JSQ A;  4U3Q A;  3S60 A;  1U18 A;  2W2F A;  1X8O A;  1GX8 A;  4ORU A;  2Z4H A;  2ZAI A;  4U8U O;  1DC9 A;  2BS5 A;  4AZN A;  2AT5 X;  1OEE A;  4NLJ A;  3WJF A;  4DQ4 A;  3SOT A;  2RQ0 A;  2WUT A;  1JYJ A;  1TVQ A;  1PBO A;  1FDQ A;  3IFB A;  5HZQ A;  2MO5 A;  1S44 A;  3F6Z B;  3HWE A;  3RWX A;  3WXQ A;  1X89 A;  3VG4 A;  2MHD A;  4KCA A;  4RUU A;  4Y0P A;  1LF7 A;  4YGH A;  1LKE A;  4TKH A;  2LA7 A;  4BOE A;  2BLG A;  3O2Y A;  4QAE A;  3NQ9 A;  2Q39 A;  3TGB A;  2WQ9 A;  3MVF A;  2AT8 X;  4OS8 A;  4YKO A;  2AKQ A;  4YDA A;  3HOE A;  3UEX A;  2WQA E;  4XMF A;  3STM X;  4IB6 A;  5C0N A;  3STN A;  5JR8 A;  4A1H A;  2F73 A;  4YH0 A;  3AKM A;  2A2U A;  1IKJ A;  1BEB A;  2PY1 A;  3UEW A;  3P6D A;  4ALO A;  1DZP A;  1PMP A;  4EFG A;  1GGL A;  5BVS A;  2CM4 A;  3C77 X;  3FW4 A;  1P6P A;  4MVE A;  1YIV A;  3NBX X;  4O3X B;  4GDZ A;  3L4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...