2QOMA

The crystal structure of the e.coli espp autotransporter beta-domain.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
278
structure length
265
Chain Sequence
b'NLNKRMGDLRDINGEAGAWARIMSGTGSASGGFSDNYTHVQVGVDKKHELLDLFTGFTVTHTDSSASADVFSGKTKSVGAGLYASAMFDSGAYIDLIGKYVHHDNEYTAGLGTRDYSTHSWYAGAEAGYRYHVTEDAWIEPQAELVYGSVSGKQFLSMKDKDYNPLIGRTGVDVGKSFSGKDWKVTARAGLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFEKSAFGKYNVDNAVNANFRYSFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease espP
publication title Autotransporter structure reveals intra-barrel cleavage followed by conformational changes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 70
structure length 265
sequence length 278
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03797 Autotransporter Autotransporter beta-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.130 Mainly Beta Beta Barrel Lipocalin Autotransporter beta-domain 2qomA00
3QQ2A 3SLOA 4MEEA 1UYNX 3KVNA 3AEHA 3SLTA 2QOMA 3SLJA 1UYOX
chains in the Genus database with same CATH superfamily
3VU1A 1N9MA 2X46A 3EMMA 4MIRA 2WPUA 4HFOA 2HZQA 2FHNX 1TXLA 1B4MA 3MG5A 4CDCA 1GXAA 1EUOA 5F2BA 2G7BA 3GE2A 1VYFA 3WZPA 1KT3A 1LKEA 1NP4A 3I0AA 4OKAA 4CDEA 4BJ8A 1QY2A 4CPEA 1GT1A 1SWNA 4YCEA 4NYQA 1B56A 1AVDA 3CR6A 3D95A 4ZCBA 3HWFA 2OY7A 5D45A 3O22A 4LQZA 1VWRB 1UYNX 3WVMA 1AB0A 3CQNA 3PH5A 2CAMA 3VGWA 1BSQA 5LJDA 2FS7A 3WBGA 4QNIA 4YKMA 4KCAA 4XMHA 1DC9A 1GKAA 4GH7A 1IKJA 1LIBA 1HXLA 1BSYA 1K24A 1SWCA 4IB7A 2BS6A 1B8EA 4YBUA 4AW8A 2IZHB 3P6HA 3S5XA 2Q39A 3BS2A 5BVQA 3RDMA 1N7YA 4IB9A 4Y0SA 4QAEA 4ZGFA 2IZAA 2P8GA 4ARHA 1EALA 5KICA 3BX8A 2FT9A 2IZBA 4K19A 1N9YA 1OEKA 2G8CO 1GGLA 1KT5A 1FDQA 1SRHA 3S5VA 4CPIA 2IZDB 1JIWI 4M7MA 2KD2A 4CPHA 2GTLM 5BVTA 1SWGA 3MVFA 1KZXA 3OD9A 1T8VA 4INNA 1RAVA 2RA6A 5L8OA 1X71A 3FR5A 2RTAA 3T1DA 3P6CA 3CKGA 4NNSA 3FIQA 3WYPA 2F09A 2AT0X 3HOLA 5B10O 1I78A 4B55A 1I06A 2G79A 5HTEA 1CRBA 2KTDA 3PPTA 2AMMX 1NQNA 5K68A 4A1YA 3FYFA 3SZIA 1HQPA 1BEBA 1ZNDA 1GM6A 1PEEA 3ZUIA 1RBPA 1K3BA 2NNQA 4CK4A 1SXXA 4Z27A 4YFRA 1CBIA 1I9HA 1SREA 3G7XA 4ZGUA 3RDSA 4DQ4A 3VHMA 1X89A 3FR4A 3EYCA 4Y5DA 3L4RA 4WFVA 2AT8X 2FR2A 4XMGA 5L8IA 1DZKA 4O9SA 3VG4A 1LCVA 1QG5A 4U46A 1S44A 1VWNB 2RTIB 4OEMA 1DFVA 5KIDA 3WZNA 1ZRYA 1I4UA 1JQPA 1PBYA 2E4JA 3D97A 4ML7B 5IO5A 4QGWA 4FBVA 1AELA 2M4LA 3NQKA 3TF6A 1ADLA 3RSWA 2F01A 4KC7A 1EIOA 1SRFA 5DPQA 4UU2A 2OL7A 2JU3A 1OPBA 4Y0RA 4GDZA 3E3CA 3FW5A 2AT6X 2A5CA 4ZH6A 3D9WA 1RLBE 1ICMA 4GU8A 2DM5A 1ZNLA 3JSQA 1HXZA 3SZJA 3VHIA 4Z2PA 3TGCA 2RTOB 1YIVA 3BY0A 3ELZA 4QGVA 1SLGB 4YGGA 4CSBA 1O1VA 1YWCA 5IO7A 5IRWA 3P6FA 5B2AO 1JYJA 1FEMA 1LICA 1RSTB 3NPOA 1MX7A 3WJCA 3ZW0B 3UAQA 1RXJA 1SLFB 1BRQA 4YFQA 4Z6JA 3BDRA 1IIUA 3P6EA 3HWDA 2OFAA 1KOIA 5FQ8E 1KT7A 2X55A 2LBAA 1LIEA 3QKGA 4QQ1A 2BSZA 2FS6A 3TZSA 1JMXA 3F9DA 1I05A 1SWJA 2WSJA 2ANSA 2X34A 4PSQA 5H9LA 1MK5A 5LJBA 1AVGI 2O62A 1W5RA 4XMEA 4BX6B 1HN2A 1LF7A 1OEEA 1ALBA 2HMBA 2RTKA 2Z4IA 1SWTA 2RQ0A 3APUA 4IB8A 5FENA 1A57A 2X32A 2RTRB 2Q4NA 4Y0QA 1BLRA 2QOMA 4O3ZA 5CYBA 5HCDC 4GKCA 3B2IA 3WJBA 4BX5B 4D6AA 3FMZA 1Y9TA 2QOSC 2RTNB 1SWPA 1NBXA 2X8FA 4JNJA 2IZIA 2X45A 3CBSA 4A1HA 4DCBA 4MISA 4KIIA 4IAXA 1SXUA 1KQXA 5FAZA 3HTYA 1SWFA 1UREA 1VWQB 2FTBA 2QM9A 1VWEB 3FA9A 1OBQA 4GUZA 1P6PA 1E5PA 1SRGA 2A0AA 3NADA 1NQMA 2JOZA 3D4RA 2L5PA 4RUUA 1ZNKA 4HPDA 1BRPA 1IFCA 2FR3A 2OVSA 5LKFA 4BBOA 4NW4A 1VYGA 5EPQA 3SLTA 1JJXA 3WYQA 1ZNEA 4BGFA 4EQAC 4ZFXA 4U8UO 4U9CA 1GX9A 1YWAA 3KFIA 1CBQA 1SXYA 1CJ5A 3CWKA 4L1NA 3VPJE 4WFUA 3ZW0A 2AT5X 4EEJA 4I3DA 2RTQB 3RE6A 1XCAA 1SWSA 2OVAA 1LIDA 2RTHB 4XMFA 4YH0A 5K06A 3WJFA 2Q9SA 1SRIA 1IKEA 1I04A 2BLGA 3VG3A 1EPAA 5B3MO 4LZVA 3VG6A 1ERXA 2OFMX 4KH8A 3PDFA 4TQ2A 5LKEA 1VWHB 4CPFA 3BRNA 4FBOA 1VWFB 4QYPA 4BX6A 4ORYA 4ALOA 1RXKA 2ACOA 2RTCB 1NP1A 4EFGA 1OBPA 2FKJA 4YDBA 1DZPA 2KTSA 2LA7A 2BT9A 1VPRA 1PBOA 2OVDA 4GGRA 4AYHA 4ZR2A 2JU7A 1FELA 5H9NA 1D3SA 3SAOA 3T6FA 4IMNA 4ORRA 5IRUA 1X8NA 3IFBA 3KQ0A 3T6LA 1LCWA 3MM0A 3QQ2A 2MM3A 4JHQA 1TW4A 4NV8A 1EW3A 4TJZA 1NC9A 3ZW1A 2JU8A 2WWPA 2OFRX 4OMWA 2JW1A 2IFBA 3TGAA 1HBQA 1MDCA 3OBLA 1HMTA 1TVQA 4YBPA 5HCCC 4BVMA 1VWOB 1VWMB 1SA8A 2Q2PA 4N7CA 1Y53X 3HK1A 4RUNA 4QGXA 1OPAA 1VWGB 5HBSA 3KFFA 4O3XB 4O4SA 4XMCA 1KT4A 2W2FA 2Y3FA 4U8UN 5D8JA 4ON1A 5H9AA 3F8AA 2OY5O 5CHKA 2AL0X 4GNYA 4QYNA 2RTBB 1IW2A 1N43A 2RD7C 5C0NA 2BC3A 1AQBA 4LZUA 3U9PC 3UEWA 4IMOA 4NV7A 5IRAA 3OJYC 1LDQA 3NBXX 3PQUA 4ODDA 3RBYA 2WR6A 4I9SA 3C76X 5EZ2A 1HY2A 2HKDA 3FA6A 1SY0A 2LBVA 3HWEA 4ORUA 2HZRA 3B2JA 3OE3A 3U0DA 3B2HA 5H8TA 3FIDA 3WZOA 3FW4A 4COTA 4AZOA 2XKLA 5AEOA 3VG7A 1SWBA 1SWKA 4IABA 1GT5A 1ICNA 1FTPA 3DSZA 4FGIB 1KXOA 1SWEA 5HZ9A 4TKJA 1SWHA 1E00A 2A3FX 4GDAA 5LJEA 2IZLB 5HAEA 4AZRA 1LCZA 1Y55X 2N93A 1JZUA 3FELA 3NQ3A 3STNA 5L8NA 3EC5A 4MVKA 4Z28A 4KC8A 5K67A 2DJFA 3K3LA 5HTDA 1JV4A 3TGBA 1VWIB 3H3IA 3X00A 3RWXA 1MM9A 1SWLA 1B0OA 1YP7A 1KL3A 3O2YA 2X8TA 3JS1A 2HNXA 2KW1A 3O19A 1EQDA 2C1SA 1SMPI 4CDDA 2PY1A 4O3WA 1VWBB 4ORXA 4AZMA 4CDFA 3EBKA 5AJBA 1X8PA 2GTLO 4I6SA 3MBTA 4GNWA 2EU7X 2AF5A 3RDQA 3MX7A 3CMPA 1LFOA 2A5BA 2AVIA 2G78A 3HWGA 4IRWA 5D47A 1SLEB 5JR8A 1SWQA 5LJHA 1QY0A 4YFPA 3B2KA 4LKPA 3RY1A 3ZW2A 3Q6LA 1JJUA 2CZUA 2FGSA 2GH7A 1JBHA 1SY1A 1SRJA 3PEDA 4BCSA 1EIIA 5F6BA 3RDXA 1CBRA 1HMSA 2OFBA 2R56A 2PI3O 1U17A 2LFOA 4ID2A 3VE1A 1G74A 5EDCA 4IAWA 2ZAIA 1GX3A 2L68A 2A2UA 1Y52X 3P02A 3DTQA 4FBRA 3BU9A 3FENA 1Z24A 2AT3X 3RDOA 1BSOA 3EW2A 1YWDA 1S7DA 2RCTA 3AKNA 1MX8A 3CBCA 4BX7B 3F6ZB 3T2WA 1W6FA 4DNEA 1LPJA 2QCBA 3LTWA 3ZZVA 3CQRA 1YP6A 5CE4A 4FQBB 2HYSA 1G85A 1HMRA 3BX7A 4L3RA 3P24A 3WZQA 1STPA 3WJDA 1OBUA 2IZCB 4ALBA 4YKOA 5FFHA 4MVEA 5HA0A 1VWKB 4Y59A 2FHLA 3NX1A 4NLIA 3FEPA 5HCEC 4YGZA 3T2XA 1QQSA 1O8VA 3AEHA 1RSUB 2OL6O 3NP1A 1VWCB 4AZQA 1SY2A 4GD9A 5AJCA 4A8ZA 1BBPA 1ERBA 2ZSCA 2K62A 3ZWEA 1HBPA 4Z2OA 4ZHDA 5AQ6A 5HZQA 2GTLN 5L3YA 1VWPB 2FKGA 4QZUA 4ZHGA 2QMIA 1NDJA 3PP6A 3C77X 5KHPA 2NNEA 4Y0PA 1VWDB 4I3CA 3JQOA 4XMDA 1JMZA 5DG4A 5EEEA 4LKTA 1JJJA 1KL5A 3UEVA 3SOTA 4OELA 5B29A 1X8QA 1RXHA 4YGHA 1ACDA 1ML7A 1PTSA 4IBAA 5IXGA 5D4AA 2NNDA 2X56A 3PK2A 2CZTA 3FA7A 2WQ9A 4UU3A 3RY2A 4EKVA 2WEWA 1PMPA 1SWAA 2A8GA 4JGLA 4TLJA 5F1EA 4ES7A 1VWLB 4ZH9A 1VYOA 4ZHCA 2W2BA 4OS8A 4BX5A 3ELXA 1WUBA 4EDEA 1GX8A 5BYPA 4BX7A 4MVIA 2L9CA 3KVNA 2RTGB 5B27A 4A60A 4QRLA 4TKHA 3WOVA 1X8UA 1DV9A 2RTLA 3PECA 2IZEB 2RTMA 4GETA 4GRJA 4NYRA 3Q34A 2L67A 5D48A 1Y9LA 3B2LA 3FA8A 3FR2A 4I60A 2F73A 2X8SA 2MJIA 1GT4A 2OYBO 5LJCA 1BJ7A 2GJ5A 2JGSA 2Q2MA 4M6SA 5B5GA 5BVSA 4AZPA 5HZ8A 5JD2A 3U03A 3SLOA 4ZHHA 2YG2A 1NGLA 4ORSA 2RTJA 4HWMA 3BU1A 2C1QA 2DJGA 2IZGB 2MF6A 2Z4HA 1IFBA 3NX2A 2Y32A 4IB6A 2BS5A 4OS3A 3BSZE 2FWVA 1DZMA 2UYWA 4I9RA 4DQ3A 1KFFA 3CKFA 3AKMA 2FRSA 3RZYA 1L6MA 1T0VA 1H91A 3NQ9A 1E06A 2ASNX 2JN3A 3KFHA 4KT5A 4OS0A 2QO5A 1FJ1E 2NP1A 1ZNGA 1KGLA 1FENA 1QFVA 2IZJA 2OL8O 1U0XA 2RTEB 4O3YA 4YCHA 1LELA 2MHDA 3C78X 5F6ZA 3ZQ3A 5HZ6A 4ORWA 3RKGA 1LIFA 1MEPA 1ZNHA 4Z2VA 1SXWA 1E02A 1LDOA 3EM0A 2BHVA 1BWYA 3P6DA 1N0SA 1VWJB 1DF8A 1UYOX 2R74A 1N4JA 2W2AA 2LKKA 3N91A 4OMXA 1WBIA 4U3QA 1KZWA 2POAA 1AVEA 3APVA 5FQ6E 2QO6A 1YWBA 4MVLA 4GJVA 4TKBA 3S60A 4ZHFA 4O49A 2A13A 1A2DA 3HPEA 4R0BA 2FLJA 1KQWA 1SWRA 4GGTA 1QABE 2AKQA 5CSEA 1LUQA 1DZJA 1SY3A 2ACPX 3GAQA 3UEUA 2WQAE 3HOEA 4NP1A 3EW1A 2WUTA 4YDAA 1KT6A 3FDCA 2OF9A 2R73A 1DF3A 2RCQA 3APXA 3AUMO 1S2PA 2LB6A 2MO5A 3NR3A 1A3YA 4O4UA 1Y0GA 1D2UA 5EDBA 3VHHA 2I5ZO 1VWAB 1HQQA 2WEXA 4GK9A 1EXSA 2ALLX 3D96A 2ZAGA 1U18A 3EBWA 4HPCA 2I5VO 4N7DA 3KZAA 2OY1O 1R0UA 3FLLA 5F58A 3VG2A 4NLJA 2OZQA 5F7GA 4U8UM 2KT4B 4C5PA 4YMYA 5LJKA 3LHNA 2CM4A 1SLDB 3UEXA 1G7NA 5B11O 4BOEA 5FQ7E 4YVBA 5IO6A 1PM1X 1E2TA 1TOUA 1TOWA 1CBSA 2RTFB 3STKA 5B5FA 1KL4A 1YUPA 4AZNA 4D6BA 3WJEA 2VDFA 1OSPO 4MEEA 1MUPA 1MVGA 2A2GA 4GZVA 1STSB 4WBKA 3ZW1B 2AH7X 1QFTA 1G5WA 1W4TA 4ZJ0A 1JYDA 2MWHA 3ZUOA 3I17A 1A18A 4CV7A 3FEKA 1LNMA 2IZFB 3STMX 3WXQA 1QWDA 3PH6A 2CBRA 2K23A 4GGZA 3S26A 1QY1A 2HLVA 1O1UA 2OF8A 2G5LA 3IA8A 4HPAA 2RN4A 1UZ2X 5LJGA 1OEJA 3SLJA 2UZ2A 4NNTA 1SWDA 2OVEA 2JMBA 5EEDA 4TNNA 3WJGA 1X8OA 1SWUA 2GTFX 4PJ2A 3SZHA 1GKAB 2Y3EA 1IJ8A 2GC9A 3LV4A 1T68X 2C4IA 2RTPB 1EPBA 2VFBA 2XSTA 4O4XA 2VFCA 4O4OA 1FE3A 3ZI8A 4QZTA 3V8UA 3KFGA 3RE5A 1BM5A 1MOYA 3BLGA 2CBSA 5H9KA 2QO4A 3VE2A 5HA1A 3VG5A 4WHIA 3P6GA 1XKIA 4I95A 5HZ5A 2OY8A 4GE1A 2IZKA 5HWZA 3PQSA 1STRB 3APWA 4I3BA 2YMSA 1EI5A 2CM9A 4JO6A 4HPBA 3RDUA 4CPHB 2X4MA 4EXZA 2RTDB 1SWOA 1GT3A 4GJSA 4BQUA
chains in the Genus database with same CATH topology
3QQ2A 3SLOA 4MEEA 1UYNX 3KVNA 3AEHA 3SLTA 2QOMA 3SLJA 1UYOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQ2 A;  3SLO A;  4MEE A;  1UYN X;  3KVN A;  3AEH A;  3SLT A;  2QOM A;  3SLJ A;  1UYO X; 
#chains in the Genus database with same CATH topology
 3VU1 A;  1N9M A;  2X46 A;  3EMM A;  4MIR A;  2WPU A;  4HFO A;  2HZQ A;  2FHN X;  1TXL A;  1B4M A;  3MG5 A;  4CDC A;  1GXA A;  1EUO A;  5F2B A;  2G7B A;  3GE2 A;  1VYF A;  3WZP A;  1KT3 A;  1LKE A;  1NP4 A;  3I0A A;  4OKA A;  4CDE A;  4BJ8 A;  1QY2 A;  4CPE A;  1GT1 A;  1SWN A;  4YCE A;  4NYQ A;  1B56 A;  1AVD A;  3CR6 A;  3D95 A;  4ZCB A;  3HWF A;  2OY7 A;  5D45 A;  3O22 A;  4LQZ A;  1VWR B;  1UYN X;  3WVM A;  1AB0 A;  3CQN A;  3PH5 A;  2CAM A;  3VGW A;  1BSQ A;  5LJD A;  2FS7 A;  3WBG A;  4QNI A;  4YKM A;  4KCA A;  4XMH A;  1DC9 A;  1GKA A;  4GH7 A;  1IKJ A;  1LIB A;  1HXL A;  1BSY A;  1K24 A;  1SWC A;  4IB7 A;  2BS6 A;  1B8E A;  4YBU A;  4AW8 A;  2IZH B;  3P6H A;  3S5X A;  2Q39 A;  3BS2 A;  5BVQ A;  3RDM A;  1N7Y A;  4IB9 A;  4Y0S A;  4QAE A;  4ZGF A;  2IZA A;  2P8G A;  4ARH A;  1EAL A;  5KIC A;  3BX8 A;  2FT9 A;  2IZB A;  4K19 A;  1N9Y A;  1OEK A;  2G8C O;  1GGL A;  1KT5 A;  1FDQ A;  1SRH A;  3S5V A;  4CPI A;  2IZD B;  1JIW I;  4M7M A;  2KD2 A;  4CPH A;  2GTL M;  5BVT A;  1SWG A;  3MVF A;  1KZX A;  3OD9 A;  1T8V A;  4INN A;  1RAV A;  2RA6 A;  5L8O A;  1X71 A;  3FR5 A;  2RTA A;  3T1D A;  3P6C A;  3CKG A;  4NNS A;  3FIQ A;  3WYP A;  2F09 A;  2AT0 X;  3HOL A;  5B10 O;  1I78 A;  4B55 A;  1I06 A;  2G79 A;  5HTE A;  1CRB A;  2KTD A;  3PPT A;  2AMM X;  1NQN A;  5K68 A;  4A1Y A;  3FYF A;  3SZI A;  1HQP A;  1BEB A;  1ZND A;  1GM6 A;  1PEE A;  3ZUI A;  1RBP A;  1K3B A;  2NNQ A;  4CK4 A;  1SXX A;  4Z27 A;  4YFR A;  1CBI A;  1I9H A;  1SRE A;  3G7X A;  4ZGU A;  3RDS A;  4DQ4 A;  3VHM A;  1X89 A;  3FR4 A;  3EYC A;  4Y5D A;  3L4R A;  4WFV A;  2AT8 X;  2FR2 A;  4XMG A;  5L8I A;  1DZK A;  4O9S A;  3VG4 A;  1LCV A;  1QG5 A;  4U46 A;  1S44 A;  1VWN B;  2RTI B;  4OEM A;  1DFV A;  5KID A;  3WZN A;  1ZRY A;  1I4U A;  1JQP A;  1PBY A;  2E4J A;  3D97 A;  4ML7 B;  5IO5 A;  4QGW A;  4FBV A;  1AEL A;  2M4L A;  3NQK A;  3TF6 A;  1ADL A;  3RSW A;  2F01 A;  4KC7 A;  1EIO A;  1SRF A;  5DPQ A;  4UU2 A;  2OL7 A;  2JU3 A;  1OPB A;  4Y0R A;  4GDZ A;  3E3C A;  3FW5 A;  2AT6 X;  2A5C A;  4ZH6 A;  3D9W A;  1RLB E;  1ICM A;  4GU8 A;  2DM5 A;  1ZNL A;  3JSQ A;  1HXZ A;  3SZJ A;  3VHI A;  4Z2P A;  3TGC A;  2RTO B;  1YIV A;  3BY0 A;  3ELZ A;  4QGV A;  1SLG B;  4YGG A;  4CSB A;  1O1V A;  1YWC A;  5IO7 A;  5IRW A;  3P6F A;  5B2A O;  1JYJ A;  1FEM A;  1LIC A;  1RST B;  3NPO A;  1MX7 A;  3WJC A;  3ZW0 B;  3UAQ A;  1RXJ A;  1SLF B;  1BRQ A;  4YFQ A;  4Z6J A;  3BDR A;  1IIU A;  3P6E A;  3HWD A;  2OFA A;  1KOI A;  5FQ8 E;  1KT7 A;  2X55 A;  2LBA A;  1LIE A;  3QKG A;  4QQ1 A;  2BSZ A;  2FS6 A;  3TZS A;  1JMX A;  3F9D A;  1I05 A;  1SWJ A;  2WSJ A;  2ANS A;  2X34 A;  4PSQ A;  5H9L A;  1MK5 A;  5LJB A;  1AVG I;  2O62 A;  1W5R A;  4XME A;  4BX6 B;  1HN2 A;  1LF7 A;  1OEE A;  1ALB A;  2HMB A;  2RTK A;  2Z4I A;  1SWT A;  2RQ0 A;  3APU A;  4IB8 A;  5FEN A;  1A57 A;  2X32 A;  2RTR B;  2Q4N A;  4Y0Q A;  1BLR A;  2QOM A;  4O3Z A;  5CYB A;  5HCD C;  4GKC A;  3B2I A;  3WJB A;  4BX5 B;  4D6A A;  3FMZ A;  1Y9T A;  2QOS C;  2RTN B;  1SWP A;  1NBX A;  2X8F A;  4JNJ A;  2IZI A;  2X45 A;  3CBS A;  4A1H A;  4DCB A;  4MIS A;  4KII A;  4IAX A;  1SXU A;  1KQX A;  5FAZ A;  3HTY A;  1SWF A;  1URE A;  1VWQ B;  2FTB A;  2QM9 A;  1VWE B;  3FA9 A;  1OBQ A;  4GUZ A;  1P6P A;  1E5P A;  1SRG A;  2A0A A;  3NAD A;  1NQM A;  2JOZ A;  3D4R A;  2L5P A;  4RUU A;  1ZNK A;  4HPD A;  1BRP A;  1IFC A;  2FR3 A;  2OVS A;  5LKF A;  4BBO A;  4NW4 A;  1VYG A;  5EPQ A;  3SLT A;  1JJX A;  3WYQ A;  1ZNE A;  4BGF A;  4EQA C;  4ZFX A;  4U8U O;  4U9C A;  1GX9 A;  1YWA A;  3KFI A;  1CBQ A;  1SXY A;  1CJ5 A;  3CWK A;  4L1N A;  3VPJ E;  4WFU A;  3ZW0 A;  2AT5 X;  4EEJ A;  4I3D A;  2RTQ B;  3RE6 A;  1XCA A;  1SWS A;  2OVA A;  1LID A;  2RTH B;  4XMF A;  4YH0 A;  5K06 A;  3WJF A;  2Q9S A;  1SRI A;  1IKE A;  1I04 A;  2BLG A;  3VG3 A;  1EPA A;  5B3M O;  4LZV A;  3VG6 A;  1ERX A;  2OFM X;  4KH8 A;  3PDF A;  4TQ2 A;  5LKE A;  1VWH B;  4CPF A;  3BRN A;  4FBO A;  1VWF B;  4QYP A;  4BX6 A;  4ORY A;  4ALO A;  1RXK A;  2ACO A;  2RTC B;  1NP1 A;  4EFG A;  1OBP A;  2FKJ A;  4YDB A;  1DZP A;  2KTS A;  2LA7 A;  2BT9 A;  1VPR A;  1PBO A;  2OVD A;  4GGR A;  4AYH A;  4ZR2 A;  2JU7 A;  1FEL A;  5H9N A;  1D3S A;  3SAO A;  3T6F A;  4IMN A;  4ORR A;  5IRU A;  1X8N A;  3IFB A;  3KQ0 A;  3T6L A;  1LCW A;  3MM0 A;  3QQ2 A;  2MM3 A;  4JHQ A;  1TW4 A;  4NV8 A;  1EW3 A;  4TJZ A;  1NC9 A;  3ZW1 A;  2JU8 A;  2WWP A;  2OFR X;  4OMW A;  2JW1 A;  2IFB A;  3TGA A;  1HBQ A;  1MDC A;  3OBL A;  1HMT A;  1TVQ A;  4YBP A;  5HCC C;  4BVM A;  1VWO B;  1VWM B;  1SA8 A;  2Q2P A;  4N7C A;  1Y53 X;  3HK1 A;  4RUN A;  4QGX A;  1OPA A;  1VWG B;  5HBS A;  3KFF A;  4O3X B;  4O4S A;  4XMC A;  1KT4 A;  2W2F A;  2Y3F A;  4U8U N;  5D8J A;  4ON1 A;  5H9A A;  3F8A A;  2OY5 O;  5CHK A;  2AL0 X;  4GNY A;  4QYN A;  2RTB B;  1IW2 A;  1N43 A;  2RD7 C;  5C0N A;  2BC3 A;  1AQB A;  4LZU A;  3U9P C;  3UEW A;  4IMO A;  4NV7 A;  5IRA A;  3OJY C;  1LDQ A;  3NBX X;  3PQU A;  4ODD A;  3RBY A;  2WR6 A;  4I9S A;  3C76 X;  5EZ2 A;  1HY2 A;  2HKD A;  3FA6 A;  1SY0 A;  2LBV A;  3HWE A;  4ORU A;  2HZR A;  3B2J A;  3OE3 A;  3U0D A;  3B2H A;  5H8T A;  3FID A;  3WZO A;  3FW4 A;  4COT A;  4AZO A;  2XKL A;  5AEO A;  3VG7 A;  1SWB A;  1SWK A;  4IAB A;  1GT5 A;  1ICN A;  1FTP A;  3DSZ A;  4FGI B;  1KXO A;  1SWE A;  5HZ9 A;  4TKJ A;  1SWH A;  1E00 A;  2A3F X;  4GDA A;  5LJE A;  2IZL B;  5HAE A;  4AZR A;  1LCZ A;  1Y55 X;  2N93 A;  1JZU A;  3FEL A;  3NQ3 A;  3STN A;  5L8N A;  3EC5 A;  4MVK A;  4Z28 A;  4KC8 A;  5K67 A;  2DJF A;  3K3L A;  5HTD A;  1JV4 A;  3TGB A;  1VWI B;  3H3I A;  3X00 A;  3RWX A;  1MM9 A;  1SWL A;  1B0O A;  1YP7 A;  1KL3 A;  3O2Y A;  2X8T A;  3JS1 A;  2HNX A;  2KW1 A;  3O19 A;  1EQD A;  2C1S A;  1SMP I;  4CDD A;  2PY1 A;  4O3W A;  1VWB B;  4ORX A;  4AZM A;  4CDF A;  3EBK A;  5AJB A;  1X8P A;  2GTL O;  4I6S A;  3MBT A;  4GNW A;  2EU7 X;  2AF5 A;  3RDQ A;  3MX7 A;  3CMP A;  1LFO A;  2A5B A;  2AVI A;  2G78 A;  3HWG A;  4IRW A;  5D47 A;  1SLE B;  5JR8 A;  1SWQ A;  5LJH A;  1QY0 A;  4YFP A;  3B2K A;  4LKP A;  3RY1 A;  3ZW2 A;  3Q6L A;  1JJU A;  2CZU A;  2FGS A;  2GH7 A;  1JBH A;  1SY1 A;  1SRJ A;  3PED A;  4BCS A;  1EII A;  5F6B A;  3RDX A;  1CBR A;  1HMS A;  2OFB A;  2R56 A;  2PI3 O;  1U17 A;  2LFO A;  4ID2 A;  3VE1 A;  1G74 A;  5EDC A;  4IAW A;  2ZAI A;  1GX3 A;  2L68 A;  2A2U A;  1Y52 X;  3P02 A;  3DTQ A;  4FBR A;  3BU9 A;  3FEN A;  1Z24 A;  2AT3 X;  3RDO A;  1BSO A;  3EW2 A;  1YWD A;  1S7D A;  2RCT A;  3AKN A;  1MX8 A;  3CBC A;  4BX7 B;  3F6Z B;  3T2W A;  1W6F A;  4DNE A;  1LPJ A;  2QCB A;  3LTW A;  3ZZV A;  3CQR A;  1YP6 A;  5CE4 A;  4FQB B;  2HYS A;  1G85 A;  1HMR A;  3BX7 A;  4L3R A;  3P24 A;  3WZQ A;  1STP A;  3WJD A;  1OBU A;  2IZC B;  4ALB A;  4YKO A;  5FFH A;  4MVE A;  5HA0 A;  1VWK B;  4Y59 A;  2FHL A;  3NX1 A;  4NLI A;  3FEP A;  5HCE C;  4YGZ A;  3T2X A;  1QQS A;  1O8V A;  3AEH A;  1RSU B;  2OL6 O;  3NP1 A;  1VWC B;  4AZQ A;  1SY2 A;  4GD9 A;  5AJC A;  4A8Z A;  1BBP A;  1ERB A;  2ZSC A;  2K62 A;  3ZWE A;  1HBP A;  4Z2O A;  4ZHD A;  5AQ6 A;  5HZQ A;  2GTL N;  5L3Y A;  1VWP B;  2FKG A;  4QZU A;  4ZHG A;  2QMI A;  1NDJ A;  3PP6 A;  3C77 X;  5KHP A;  2NNE A;  4Y0P A;  1VWD B;  4I3C A;  3JQO A;  4XMD A;  1JMZ A;  5DG4 A;  5EEE A;  4LKT A;  1JJJ A;  1KL5 A;  3UEV A;  3SOT A;  4OEL A;  5B29 A;  1X8Q A;  1RXH A;  4YGH A;  1ACD A;  1ML7 A;  1PTS A;  4IBA A;  5IXG A;  5D4A A;  2NND A;  2X56 A;  3PK2 A;  2CZT A;  3FA7 A;  2WQ9 A;  4UU3 A;  3RY2 A;  4EKV A;  2WEW A;  1PMP A;  1SWA A;  2A8G A;  4JGL A;  4TLJ A;  5F1E A;  4ES7 A;  1VWL B;  4ZH9 A;  1VYO A;  4ZHC A;  2W2B A;  4OS8 A;  4BX5 A;  3ELX A;  1WUB A;  4EDE A;  1GX8 A;  5BYP A;  4BX7 A;  4MVI A;  2L9C A;  3KVN A;  2RTG B;  5B27 A;  4A60 A;  4QRL A;  4TKH A;  3WOV A;  1X8U A;  1DV9 A;  2RTL A;  3PEC A;  2IZE B;  2RTM A;  4GET A;  4GRJ A;  4NYR A;  3Q34 A;  2L67 A;  5D48 A;  1Y9L A;  3B2L A;  3FA8 A;  3FR2 A;  4I60 A;  2F73 A;  2X8S A;  2MJI A;  1GT4 A;  2OYB O;  5LJC A;  1BJ7 A;  2GJ5 A;  2JGS A;  2Q2M A;  4M6S A;  5B5G A;  5BVS A;  4AZP A;  5HZ8 A;  5JD2 A;  3U03 A;  3SLO A;  4ZHH A;  2YG2 A;  1NGL A;  4ORS A;  2RTJ A;  4HWM A;  3BU1 A;  2C1Q A;  2DJG A;  2IZG B;  2MF6 A;  2Z4H A;  1IFB A;  3NX2 A;  2Y32 A;  4IB6 A;  2BS5 A;  4OS3 A;  3BSZ E;  2FWV A;  1DZM A;  2UYW A;  4I9R A;  4DQ3 A;  1KFF A;  3CKF A;  3AKM A;  2FRS A;  3RZY A;  1L6M A;  1T0V A;  1H91 A;  3NQ9 A;  1E06 A;  2ASN X;  2JN3 A;  3KFH A;  4KT5 A;  4OS0 A;  2QO5 A;  1FJ1 E;  2NP1 A;  1ZNG A;  1KGL A;  1FEN A;  1QFV A;  2IZJ A;  2OL8 O;  1U0X A;  2RTE B;  4O3Y A;  4YCH A;  1LEL A;  2MHD A;  3C78 X;  5F6Z A;  3ZQ3 A;  5HZ6 A;  4ORW A;  3RKG A;  1LIF A;  1MEP A;  1ZNH A;  4Z2V A;  1SXW A;  1E02 A;  1LDO A;  3EM0 A;  2BHV A;  1BWY A;  3P6D A;  1N0S A;  1VWJ B;  1DF8 A;  1UYO X;  2R74 A;  1N4J A;  2W2A A;  2LKK A;  3N91 A;  4OMX A;  1WBI A;  4U3Q A;  1KZW A;  2POA A;  1AVE A;  3APV A;  5FQ6 E;  2QO6 A;  1YWB A;  4MVL A;  4GJV A;  4TKB A;  3S60 A;  4ZHF A;  4O49 A;  2A13 A;  1A2D A;  3HPE A;  4R0B A;  2FLJ A;  1KQW A;  1SWR A;  4GGT A;  1QAB E;  2AKQ A;  5CSE A;  1LUQ A;  1DZJ A;  1SY3 A;  2ACP X;  3GAQ A;  3UEU A;  2WQA E;  3HOE A;  4NP1 A;  3EW1 A;  2WUT A;  4YDA A;  1KT6 A;  3FDC A;  2OF9 A;  2R73 A;  1DF3 A;  2RCQ A;  3APX A;  3AUM O;  1S2P A;  2LB6 A;  2MO5 A;  3NR3 A;  1A3Y A;  4O4U A;  1Y0G A;  1D2U A;  5EDB A;  3VHH A;  2I5Z O;  1VWA B;  1HQQ A;  2WEX A;  4GK9 A;  1EXS A;  2ALL X;  3D96 A;  2ZAG A;  1U18 A;  3EBW A;  4HPC A;  2I5V O;  4N7D A;  3KZA A;  2OY1 O;  1R0U A;  3FLL A;  5F58 A;  3VG2 A;  4NLJ A;  2OZQ A;  5F7G A;  4U8U M;  2KT4 B;  4C5P A;  4YMY A;  5LJK A;  3LHN A;  2CM4 A;  1SLD B;  3UEX A;  1G7N A;  5B11 O;  4BOE A;  5FQ7 E;  4YVB A;  5IO6 A;  1PM1 X;  1E2T A;  1TOU A;  1TOW A;  1CBS A;  2RTF B;  3STK A;  5B5F A;  1KL4 A;  1YUP A;  4AZN A;  4D6B A;  3WJE A;  2VDF A;  1OSP O;  4MEE A;  1MUP A;  1MVG A;  2A2G A;  4GZV A;  1STS B;  4WBK A;  3ZW1 B;  2AH7 X;  1QFT A;  1G5W A;  1W4T A;  4ZJ0 A;  1JYD A;  2MWH A;  3ZUO A;  3I17 A;  1A18 A;  4CV7 A;  3FEK A;  1LNM A;  2IZF B;  3STM X;  3WXQ A;  1QWD A;  3PH6 A;  2CBR A;  2K23 A;  4GGZ A;  3S26 A;  1QY1 A;  2HLV A;  1O1U A;  2OF8 A;  2G5L A;  3IA8 A;  4HPA A;  2RN4 A;  1UZ2 X;  5LJG A;  1OEJ A;  3SLJ A;  2UZ2 A;  4NNT A;  1SWD A;  2OVE A;  2JMB A;  5EED A;  4TNN A;  3WJG A;  1X8O A;  1SWU A;  2GTF X;  4PJ2 A;  3SZH A;  1GKA B;  2Y3E A;  1IJ8 A;  2GC9 A;  3LV4 A;  1T68 X;  2C4I A;  2RTP B;  1EPB A;  2VFB A;  2XST A;  4O4X A;  2VFC A;  4O4O A;  1FE3 A;  3ZI8 A;  4QZT A;  3V8U A;  3KFG A;  3RE5 A;  1BM5 A;  1MOY A;  3BLG A;  2CBS A;  5H9K A;  2QO4 A;  3VE2 A;  5HA1 A;  3VG5 A;  4WHI A;  3P6G A;  1XKI A;  4I95 A;  5HZ5 A;  2OY8 A;  4GE1 A;  2IZK A;  5HWZ A;  3PQS A;  1STR B;  3APW A;  4I3B A;  2YMS A;  1EI5 A;  2CM9 A;  4JO6 A;  4HPB A;  3RDU A;  4CPH B;  2X4M A;  4EXZ A;  2RTD B;  1SWO A;  1GT3 A;  4GJS A;  4BQU A; 
#chains in the Genus database with same CATH homology
 3QQ2 A;  3SLO A;  4MEE A;  1UYN X;  3KVN A;  3AEH A;  3SLT A;  2QOM A;  3SLJ A;  1UYO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...